Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30326.28ON37737720330.0
ACL003C6.28ON37537612381e-170
SAKL0E01518g6.28ON37937912361e-170
ZYRO0C07546g6.28ON37737811891e-163
Kpol_1037.236.28ON37837911861e-162
KLTH0C10978g6.28ON37737911721e-160
Kwal_56.224596.28ON38337811531e-157
TDEL0G044106.28ON38138011431e-155
NCAS0D021406.28ON37637811381e-155
Suva_15.1726.28ON39837811371e-154
NDAI0C026506.28ON38938811251e-153
CAGL0E02497g6.28ON37637811221e-152
YOL003C (PFA4)6.28ON37837811071e-150
Smik_15.1676.28ON37837811051e-150
KLLA0C06204g6.28ON37738010941e-148
Skud_15.1596.28ON37937910871e-147
TPHA0J003906.28ON38038010631e-143
KAFR0A051306.28ON3963979811e-131
KNAG0F029306.28ON3863859301e-123
TBLA0B004806.28ON3774154858e-57
Kpol_1014.293.12ON3262082114e-18
NCAS0E013003.12ON3271871974e-16
Skud_14.153.12ON3361891922e-15
TBLA0H001503.12ON3452201903e-15
TPHA0P015603.12ON3311521885e-15
KAFR0A085903.12ON3311411885e-15
Suva_14.153.12ON3301891869e-15
KNAG0K025703.12ON3281321851e-14
NDAI0G013403.12ON3351481841e-14
CAGL0D02508g3.12ON3321951806e-14
YNL326C (PFA3)3.12ON3361891806e-14
ZYRO0C03410g3.12ON3271711797e-14
SAKL0H16434g8.286ON5551221792e-13
Smik_14.63.12ON3341891743e-13
Kwal_55.221263.12ON360641736e-13
TBLA0D040408.286ON3291391717e-13
ADL197C3.12ON3901281701e-12
KLTH0F19580g3.12ON342511691e-12
KLLA0E02069g3.12ON3252421682e-12
TDEL0A003103.12ON3291101672e-12
SAKL0C13596g3.12ON3331011673e-12
TPHA0C010708.286ON3331501664e-12
TDEL0F041308.286ON3281771654e-12
Ecym_20143.12ON3391171655e-12
NCAS0B035908.286ON329641647e-12
KLLA0F19690g8.286ON3241601592e-11
Skud_12.3218.389ON356591594e-11
ZYRO0D06600g8.286ON3301391566e-11
KLTH0G13112g8.286ON3492481568e-11
ZYRO0C04092g8.389ON366841569e-11
KNAG0A027108.389ON354741559e-11
Suva_2.2898.286ON3351721559e-11
TDEL0F051308.389ON359961551e-10
CAGL0B01991g8.286ON3301281541e-10
NDAI0J010008.286ON3391221531e-10
NCAS0C029208.389ON374611532e-10
Ecym_41788.389ON3681231532e-10
TPHA0C023608.389ON404741532e-10
SAKL0H13860g8.389ON352841522e-10
Smik_12.3068.389ON359601504e-10
YDR126W (SWF1)8.286ON3361421504e-10
KLTH0F08668g8.389ON358581504e-10
YLR246W (ERF2)8.389ON359591487e-10
Smik_4.3728.286ON3351481487e-10
KAFR0B053708.286ON3291411461e-09
Suva_10.3428.389ON356611461e-09
Skud_4.3878.286ON336571452e-09
TBLA0H009208.389ON360971442e-09
Ecym_42828.286ON3401601433e-09
AGL125C8.389ON367831424e-09
KAFR0H019808.389ON361491424e-09
NDAI0G022508.389ON389611425e-09
Kwal_23.33028.389ON353501408e-09
CAGL0G08217g8.389ON326501398e-09
Kpol_1033.168.286ON3211051399e-09
KLLA0D18370g8.389ON355491372e-08
Ecym_41145.579ON3721101302e-07
AGR065W8.286ON326621292e-07
Kwal_56.236978.286ON338891292e-07
Skud_4.7345.579ON3802251292e-07
KNAG0H031108.286ON3311501247e-07
NCAS0F013905.579ON374831249e-07
NDAI0H018905.579ON406741221e-06
CAGL0K06347g5.579ON3522171212e-06
Smik_4.7375.579ON3782421202e-06
Kwal_47.183665.579ON356681193e-06
ZYRO0D13860g5.579ON3652061176e-06
YDR459C (PFA5)5.579ON374681168e-06
TBLA0E028305.579ON386651169e-06
KAFR0I011105.579ON370721151e-05
KLTH0G04972g5.579ON367671141e-05
KNAG0C028305.579ON354841122e-05
Kpol_1004.575.579ON3622061087e-05
Suva_2.6345.579ON3882181088e-05
SAKL0G06160g5.579ON364471052e-04
TDEL0A044405.579ON3651401042e-04
KLLA0D06149g5.579ON34962999e-04
KNAG0C062305.626ON752103980.002
Suva_8.875.626ON730158960.003
Kpol_526.325.626ON77775940.006
NCAS0C052805.626ON757137920.008
ABR203W5.579ON35968910.009
TBLA0J008305.626ON739108900.017
KAFR0F031704.97ON59289870.030
TPHA0C003705.626ON759146870.037
Suva_2.4325.626ON76355860.052
Smik_15.2135.626ON744233860.053
YOR034C (AKR2)5.626ON749121850.061
NDAI0H008505.626ON78675850.064
ACL040C7.281ON342109820.11
Skud_4.5275.626ON76455820.15
KLTH0E02420g5.626ON73463810.17
Smik_4.5155.626ON76459810.18
TDEL0A049205.626ON75075790.30
ZYRO0C11132g5.626ON75975790.32
YDR264C (AKR1)5.626ON76455780.45
NCAS0D004602.84ON31671750.68
Ecym_13305.626ON73977750.93
Skud_15.1995.626ON741161751.1
AER388C5.626ON72484751.1
CAGL0M08712g5.626ON76358741.5
NCAS0A044202.453ON21271711.9
NDAI0G027902.84ON31871703.2
KAFR0H005705.626ON75758704.0
KNAG0B031405.626ON682124695.2
KNAG0E040104.329ON38237686.5
Ecym_70988.601ON43260686.6
SAKL0G07326g5.626ON73760686.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3032
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   787   0.0  
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   481   e-170
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   480   e-170
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   462   e-163
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   461   e-162
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   456   e-160
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   448   e-157
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   444   e-155
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   442   e-155
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   442   e-154
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     437   e-153
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   436   e-152
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   431   e-150
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   430   e-150
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   426   e-148
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   423   e-147
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   414   e-143
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   382   e-131
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   362   e-123
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   191   8e-57
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    86   4e-18
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    80   4e-16
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    79   2e-15
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    78   3e-15
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    77   5e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    77   5e-15
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    76   9e-15
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    76   1e-14
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      75   1e-14
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    74   6e-14
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    74   6e-14
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    74   7e-14
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    74   2e-13
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    72   3e-13
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    71   6e-13
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    70   7e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    70   1e-12
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    70   1e-12
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    69   2e-12
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    69   2e-12
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    69   3e-12
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    69   4e-12
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    68   4e-12
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    68   5e-12
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      68   7e-12
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    66   2e-11
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    66   4e-11
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    65   6e-11
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    65   8e-11
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    65   9e-11
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    64   9e-11
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    64   9e-11
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    64   1e-10
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    64   1e-10
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    64   1e-10
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     64   2e-10
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    64   2e-10
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    64   2e-10
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    63   2e-10
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    62   4e-10
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    62   4e-10
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    62   4e-10
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    62   7e-10
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    62   7e-10
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    61   1e-09
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    61   1e-09
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    60   2e-09
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    60   2e-09
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    60   3e-09
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    59   4e-09
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    59   4e-09
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     59   5e-09
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    59   8e-09
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    58   8e-09
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    58   9e-09
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    57   2e-08
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    55   2e-07
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    54   2e-07
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    54   2e-07
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    54   2e-07
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    52   7e-07
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    52   9e-07
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    52   1e-06
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    51   2e-06
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    51   2e-06
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    50   3e-06
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    50   6e-06
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    49   8e-06
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    49   9e-06
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    49   1e-05
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    49   1e-05
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    48   2e-05
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    46   7e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    46   8e-05
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    45   2e-04
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    45   2e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    43   9e-04
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    42   0.002
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    42   0.003
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    41   0.006
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    40   0.008
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    40   0.009
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    39   0.017
KAFR0F03170 Chr6 complement(627907..629685) [1779 bp, 592 aa] {O...    38   0.030
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    38   0.037
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    38   0.052
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    38   0.053
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    37   0.061
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    37   0.064
ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON} S...    36   0.11 
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    36   0.15 
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    36   0.17 
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    36   0.18 
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    35   0.30 
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    35   0.32 
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    35   0.45 
NCAS0D00460 Chr4 (71070..72020) [951 bp, 316 aa] {ON} Anc_2.84 Y...    33   0.68 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    33   0.93 
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    33   1.1  
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    33   1.1  
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    33   1.5  
NCAS0A04420 Chr1 complement(892456..893094) [639 bp, 212 aa] {ON...    32   1.9  
NDAI0G02790 Chr7 (649288..650244) [957 bp, 318 aa] {ON} Anc_2.84...    32   3.2  
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    32   4.0  
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    31   5.2  
KNAG0E04010 Chr5 (792199..793347) [1149 bp, 382 aa] {ON} Anc_4.3...    31   6.5  
Ecym_7098 Chr7 (190468..191766) [1299 bp, 432 aa] {ON} similar t...    31   6.6  
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    31   6.9  

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/377 (100%), Positives = 377/377 (100%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240
           ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240

Query: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300
           DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE
Sbjct: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300

Query: 301 HGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEWYN 360
           HGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEWYN
Sbjct: 301 HGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEWYN 360

Query: 361 DWGENLAHFGVDVDADD 377
           DWGENLAHFGVDVDADD
Sbjct: 361 DWGENLAHFGVDVDADD 377

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  481 bits (1238), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 221/376 (58%), Positives = 284/376 (75%), Gaps = 1/376 (0%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M V +KWPWLG+AIPCFLI+F GY A  FVL  FLS K+ +WFQ SL+MIW+SY+KAIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P  GF+PL++EW+NYC KC+ +KPERTHHCK C QCVLVMDHHCP+TMNC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
                   WII TT  L   F KR  F W  R++TA LV+K+E+IFLTILTP +AF+LLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240
           IS+LF RC+KNQ++NG TQIEAWEMDRIE++FY++RL+PQLL+NL+E+YP SL+G + E+
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240

Query: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300
           +  L++   SF++++NFPYD +PW NL+NCMG  L WLNPFG P  +GMVF+KNE+S Y+
Sbjct: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300

Query: 301 HGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEWYN 360
             +++ DKLL+LPWPPD  R   +  S   VE  T+ GE ++R+R   P     R EWYN
Sbjct: 301 EATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRRH-VPIAVPPRNEWYN 359

Query: 361 DWGENLAHFGVDVDAD 376
           DWGE+L HFGVDV+ +
Sbjct: 360 DWGESLEHFGVDVEVE 375

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  480 bits (1236), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 227/379 (59%), Positives = 285/379 (75%), Gaps = 3/379 (0%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M VKLKWPWLGIAIP FLI+FIGY A  F+L  FL  K+Q+WF+FSL MIW+SYY AIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P PGF+P K EW+N+C KC N+KPER HHCK C QCVL MDHHCP+TMNCVG+ NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
            HF+RFLFW+I TT++L     KR  F+WN RH     V + E+IFLTILTP +AFVLLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240
           IS+L  RC KNQ+L GMTQIE+WEMDRIE+MF++ +L+P++L NL+E+ P SL     +I
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300
            ++L+  ++S +++VNFPYD +PW N +N +G M +W+ P+G   GNGM+FEKNELS YE
Sbjct: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300

Query: 301 HGSTLTDKLLSLPWPPDGERAP---NSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357
               + DKLLSLPWPPDG R       +N    VESSTR+GE ++RKR  +PR  + R +
Sbjct: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360

Query: 358 WYNDWGENLAHFGVDVDAD 376
           WYNDWGENLA FGVD+D +
Sbjct: 361 WYNDWGENLADFGVDLDEE 379

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  462 bits (1189), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 223/378 (58%), Positives = 276/378 (73%), Gaps = 3/378 (0%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPV+LKWP+LGIAIPCFLI+FIGY+A  F+L  FLS ++QIWF+FSLTMIW SYY AIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
            PG P+P FQP K+ WK+YCKKC+N+KPER HHCKTC QCVL MDHHCP+T NCVGY NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHFMRFLFW+I TT YL  +   R +F+ +  +S   L  K E+IFLTIL P + F+LLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGH-KGE 239
           ISILF RC+ NQ+  G TQIE WE +R+E ++Y++RL+P LL+N  ELYP       + E
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
             R+   R+I  + LVNFPYD DPW N I  +G  L WL PFGKP G+GM F KN++S +
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 300 EHGSTLTDKLLSLPWPPDGERAPN-SSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEW 358
           E  + LTD LL+LPWPPDG +    S +    VE++ R+GE +IRKR  +PR   SRT+W
Sbjct: 301 EE-TNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359

Query: 359 YNDWGENLAHFGVDVDAD 376
            N WGENL  FGVDVDA+
Sbjct: 360 QNTWGENLEDFGVDVDAE 377

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/379 (58%), Positives = 283/379 (74%), Gaps = 4/379 (1%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPVKLK+PW+GIAIPCFLI+FI Y+A  F+L  FLS+ +QIWF+ S+TMIW+SYY AIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P   + P  ++WKNYCKKC  +KPERTHHCKTC QCVL+MDHHCP+TMNCVGY NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFLFW+I TTTYL      R  F+W  R+  + L  K EIIFLTI TP + FVLLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPN-SLDGHKGE 239
           IS+LF RC  NQ+L+G TQIE WE +R+ES+FY RRL PQL+SNL E +P      ++ +
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
            ++I++ R I F+ LV+FPYD     N+   +G  +TWL  +G+P+G+GM+F+KNE S +
Sbjct: 241 AEKIVSKR-IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299

Query: 300 EHGSTLTDKLLSLPWPPD-GERAPNSSNSRL-KVESSTRNGEHIIRKRSPEPRLNLSRTE 357
           E  S L D++LSLPWPPD G+   N  NS    +E+ST++GEH+IRKRSP  +L  SRT+
Sbjct: 300 EEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQ 359

Query: 358 WYNDWGENLAHFGVDVDAD 376
           WYNDWGENL  FGVD+D +
Sbjct: 360 WYNDWGENLEDFGVDIDVE 378

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  456 bits (1172), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 210/379 (55%), Positives = 285/379 (75%), Gaps = 6/379 (1%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPV+LKWPWLGIA+P FLIA+IGYS+  F+LQ F S  QQ+WF+FSLT+IW+SY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P P F+P  H+WKNYCKKC N+KPERTHHCKTC QCVL MDHHCP+TMNCVG+NNF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFL W++ TT+YL +   +R +  W  R+ T + V   E+ FL +  P NAF+LLT
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRN-TRKFVHTSELCFLFVNAPLNAFILLT 179

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYP-NSLDGHKGE 239
           +S+L  RC+KNQ LNGMTQIE+WE DRIE++F+N RLVPQL+ NL+EL+P ++ D  +G 
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFD--EGA 237

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
             ++L+++++  ED++NFPYD D   N+ + MGP+ +W  P G+P   G  F  N+LS Y
Sbjct: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297

Query: 300 EHGSTLTDKLLSLPWPPDG--ERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357
           +  +++ DKLLSLPWPPDG  +++  S++    +E+ +  GE  +R RS + R+++ RTE
Sbjct: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357

Query: 358 WYNDWGENLAHFGVDVDAD 376
           W+NDWGENL+ FGVDVDA+
Sbjct: 358 WHNDWGENLSDFGVDVDAE 376

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  448 bits (1153), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 277/378 (73%), Gaps = 4/378 (1%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPVKLKWPWLGIAIP  LIAFIGY +  F+L  FLS+ QQ+WFQ  L+MIW+SY  AI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P  GFQPL H+WKN C+KC+ +KPERTHHCKTC QCVLVMDHHCP+TMNCVG+NNF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFL W+I TT+YL    +KR +  W +RH T   V K E++F+ I TP NAFV LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRH-TRIYVQKIELVFIFINTPLNAFVWLT 179

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240
           I +L  RC KNQ L GMTQIE WE +RIE+ F N RL+PQLL NL E+Y + +       
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNA- 238

Query: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300
            +++N R +  E++VNFPYD +   N  + +G +LT + P+  P GNG+ F KN+LS+Y+
Sbjct: 239 KKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYD 298

Query: 301 HGSTLTDKLLSLPWPPDGERAPNSSNSRL--KVESSTRNGEHIIRKRSPEPRLNLSRTEW 358
              T+ DKLLSLPWPPDG R   + +S++  ++E  +  GE ++RKR  +PR+N+ RTEW
Sbjct: 299 TCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEW 358

Query: 359 YNDWGENLAHFGVDVDAD 376
           YNDWGENL+ FGVDV+++
Sbjct: 359 YNDWGENLSDFGVDVESE 376

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  444 bits (1143), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/380 (54%), Positives = 270/380 (71%), Gaps = 6/380 (1%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPVKLKWPWLGIAIPC L++FIGY    F+L  FLS  +Q+WFQ +L +IWLSYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P P F+  K+EWKNYCKKCQN+KPER HHCKTC QCVL+MDHHCP+TMNCVG+NNF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFL W+I  T +L  Q   R   +W  R+    +  + E++FLTILTP +AFVLLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDG-HKGE 239
           I+IL  RC+ NQ+ NGM+QIE WE++R++++F ++RLVP L+    +++P + +  ++  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
              +  N+++  ED+VNFPYD DPW N    +G  L WL PFG+P G+GM F KNE+S Y
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 300 EHGSTLTDKLLSLPWPPDGER---APNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRT 356
              ++  D LLSLPWPPDG R    P S +S   +ES T+ GE +IR+R  +    + R 
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSS--SIESITKQGEQLIRRRPNDTSDLIGRR 358

Query: 357 EWYNDWGENLAHFGVDVDAD 376
           +W NDWGENL  FGVDVD +
Sbjct: 359 QWQNDWGENLEDFGVDVDTE 378

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  442 bits (1138), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/378 (54%), Positives = 269/378 (71%), Gaps = 4/378 (1%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPVKLK+PW+G+ IPC L +FIGYSA +FVL  F+S K Q+WFQ SLTM+W+SY  AI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P   F+PLK EW ++CKKCQ FKPER HHCKTC QCVL+MDHHCP+TMNCVG+ NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFLFW++ TT +L  Q  KRT ++W ++   + L  K EI FL IL P + FVL+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240
           +++LF RC+ NQ++ G TQIE+WE++R+E+++Y ++L+PQLL NL E+YPN        +
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 DRILN--NRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSA 298
            + L    RK+ FE++V FPYD D W N +  +G  + WL  FG P+ +GM F+KNEL+ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 299 YEHGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEW 358
           YE G+ + D LLSLPWPPDG R          VES T NGE +IR+R+ E   N  R  W
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQKGT-NVESITENGEQVIRQRNFEND-NSYRKTW 358

Query: 359 YNDWGENLAHFGVDVDAD 376
            NDWGENL  FGVDVD +
Sbjct: 359 NNDWGENLEDFGVDVDVE 376

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  442 bits (1137), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 207/378 (54%), Positives = 272/378 (71%), Gaps = 2/378 (0%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M VKLKWPWLGIAIP FLI+FIGY A  F+L  FLSV +QI F+ SL+MIW+SYY AIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P P +QP  + W NYCKKCQN+KPER+HHCK C QCVL+MDHHCP+TMNCVG+ N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RF+FW+I TT +L     KR  F+W  RH    L  K E++FLTILTP N FVLLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGH-KGE 239
           I ILF RC+ NQ++NG +QIE+W+MDR+ES+F ++RL+ +L+ N   +YP +     + +
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
            +++L   KI FE++VNFPY+ D + N    +GP+  WL P G P G+G  F+KN++S Y
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 300 EHGSTLTDKLLSLPWPPDGERAPNSSN-SRLKVESSTRNGEHIIRKRSPEPRLNLSRTEW 358
           E  S+L D +LSLPWPPDG +   +SN S L +E+    GE ++R R  +   + +R +W
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380

Query: 359 YNDWGENLAHFGVDVDAD 376
           YNDWGE+L  FGVDVD +
Sbjct: 381 YNDWGESLDDFGVDVDME 398

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  437 bits (1125), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/388 (53%), Positives = 277/388 (71%), Gaps = 13/388 (3%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M +KLK+PWLG+AIP F+I+FIGY++  F+L  FLS+K+QIWFQFSL+MIW+SY  AI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGSPVPGFQPL----KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVG 116
           NPG P    +P+    + +W  +CKKC N+KPER+HHCKTC QCVL+MDHHCP+TMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 YNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAF 176
           Y NFPHF+RFL WII TT +L +   KRT  +WN+RH  + +  + EIIFLTIL P +AF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 VLLTISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDG- 235
           +LLTIS+LF RC  NQ++ GMTQIE WE++R+E++FYN++L+P +++ L E+YPN     
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 236 HKGEIDRILNNR-KISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKN 294
                D +L+ R K+ FE++VNFPYD D W N+   MG    W+  FG P+ NG+ FEKN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 295 ELSAYEHGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEP----- 349
           E+S YE GS++ D LLSLPWPPD  R    SN    VES   +GE ++R R+        
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNF-ISNKDTSVESLVYDGEQVVRNRASNDTNIST 359

Query: 350 -RLNLSRTEWYNDWGENLAHFGVDVDAD 376
              ++SR EW NDWGE+L  FGVD++A+
Sbjct: 360 INKDISREEWNNDWGESLVDFGVDIEAE 387

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  436 bits (1122), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/378 (55%), Positives = 273/378 (72%), Gaps = 4/378 (1%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPVKLKWPWLGIAIP FLIA IGY A  F+L  FLS+++Q+W+QF  TMIWLSYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
            PG P   F+P K+EWK YCKKC+ +KPER+HHCKTC QCVL+MDHHCP+TMNCVGYNNF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFLFW+I  TT L+I    R   +W  R S + L  K E+IFLTILTP NAF+LLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGH-KGE 239
           ISIL  RC+ NQ+ NG +QIE+WEMDR+E++    +L+P L+ N+  ++PN  + H + +
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
            + +LN +++S ++LVNFPYD  P+RN I  +G    WL PF  P  +G+ F+KNE S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 300 EHGSTLTDKLLSLPWPPDGERAPNSSNSRLK-VESSTRNGEHIIRKRSPEPRLNLSRTEW 358
           E  ++L D +L LPWPPD  +  NS++     V+  +  GE +IR R+PE +  LSR+EW
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKK--LSRSEW 358

Query: 359 YNDWGENLAHFGVDVDAD 376
            NDWGE+L  FGVDVD +
Sbjct: 359 LNDWGESLEDFGVDVDVE 376

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  431 bits (1107), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 207/378 (54%), Positives = 269/378 (71%), Gaps = 2/378 (0%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPVKL+WPWLGIAIP FLI+FIGY A  F+L  FLSV +QI F+F L+MIWLSYY AI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P+P ++P    W+N+CKKCQ++KPER+HHCKTC QCVL+MDHHCP+TMNCVG+ N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFLFWII TT+ L     KR +F+W  RH       K E+IFLTI +P N+FVLLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLD-GHKGE 239
           I+ILF RC+ NQ+LNG +QIE+W+MDR+ES+F + RL  +L+ N   +YP S    +K +
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
            +  L  ++  F++LVNFPYD D + N +  +GP+  WL P+G P G+G  F KN +S Y
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 300 EHGSTLTDKLLSLPWPPDGERAPNSSN-SRLKVESSTRNGEHIIRKRSPEPRLNLSRTEW 358
           E  S+L D +LSLPWPPDG +     N     +E    +GE +IR R P+   + SR +W
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 359 YNDWGENLAHFGVDVDAD 376
           YNDWGE+L  FGVDVD +
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  430 bits (1105), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 267/378 (70%), Gaps = 2/378 (0%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M VKL+WPWLGIAIP  LI+FIGY A  F+L  FL + +QI F+FSL+MIW SYY AIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P+P +QP    W N+CKKCQN+KPER+HHCKTC QCVL+MDHHCP+TMNCVG+ N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFLFWII TT+ L     KR  F+W  R+    L  K E+ FLTIL+P N FVLLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLD-GHKGE 239
           I++LF RC+ NQ++NG +QIE+W+MDR+ES+F +RRL+ +L+ N   +YP S    H+ +
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
            + +L  ++ SFE LVNFPY+ D   N I  +GP+  WL P+G P GNG  F KN++S Y
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 300 EHGSTLTDKLLSLPWPPDGERAPNSSNSRLK-VESSTRNGEHIIRKRSPEPRLNLSRTEW 358
           E  S L D +LSLPWPPDG      SN +   +E+    GE ++R R  +   + SR +W
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360

Query: 359 YNDWGENLAHFGVDVDAD 376
           +NDWGE+L  FGVDVD +
Sbjct: 361 FNDWGESLDDFGVDVDME 378

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  426 bits (1094), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 203/380 (53%), Positives = 261/380 (68%), Gaps = 7/380 (1%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M +KLK  WLG+AIP FL+A IGY +  F+L  FLS  +QI++Q   TMIW+SYY AIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P   F+P   EW NYCKKC+ +KPER HHCKTC QCVL MDHHCP+T+NCVG++NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHFMRFLFW+I +T YL      R + +W+IRH+     +  EIIF+ I+TP +AFVLLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240
           +S L GRCI NQ L+GMTQIE+WEMDRI+S+ Y  RL+ Q++  L E  P  L   + EI
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240

Query: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300
           +++L+ R ++ ED  NFPYD +PW N+ N MGP   WL P+ KP   G  F KNEL  Y+
Sbjct: 241 NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD 300

Query: 301 HGSTLTDKLLSLPWPPDG----ERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRT 356
             S++ D L+SLPWPPDG     RA  S +S   +E+    GE +IR +S + R  L R 
Sbjct: 301 PNSSIEDMLMSLPWPPDGLTHHSRALGSGSS---IETIVSGGEQVIRDKSVDLRDRLGRN 357

Query: 357 EWYNDWGENLAHFGVDVDAD 376
            WYNDWGE+L+ FGVD + +
Sbjct: 358 SWYNDWGEDLSDFGVDTELE 377

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  423 bits (1087), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 269/379 (70%), Gaps = 3/379 (0%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M VKLKWPWLGIAIP FLI+FIGY A  F+L  FLS+ +Q+ F+ SL+MIW+SYY AIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           N G P+P ++P    W N+CKKCQ++KPER+HHCK C QCVL+MDHHCP+TMNCVG+ N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHF+RFLFW+I TT+ L     KR  F+W  R     L  K E+IFLTIL+P + FVLLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDG-HKGE 239
           I+ILF RC+ NQ++NG +QIE+W+MDR+ES+  + +L+P+L+ N   +YP +    H+ +
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 240 IDRILNNR-KISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSA 298
            D++L  R +  F++LV+FPY+ +P  N I  +GP+  WL P+G P G+G  F KN++S 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 299 YEHGSTLTDKLLSLPWPPDGERAPNSSN-SRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357
           YE  S L D +LSLPWPPDG +    SN +   +E+    GE I+R R+ +   +  R +
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 358 WYNDWGENLAHFGVDVDAD 376
           WYNDWGE+L  FGVDVD +
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  414 bits (1063), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 204/380 (53%), Positives = 273/380 (71%), Gaps = 3/380 (0%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPVK KWPW+GIAIPC LI+FIGY +  ++L+  LS+ +Q +F+FSLTMIW+SYY AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120
           NPG P   F+PL HEW+N+CKKC N+KPER+HHCKTC QCVL+MDHHCP+TMNC+G+NNF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180
           PHFMRFL WI+ TT +L     KR  ++WN R+  + L  + E+I L + TP N F+LLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDG-HKGE 239
           I++LF RC+ NQ++NG TQIE WEMDR+E+ FY ++L+PQL+ NL ELYP      H  E
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299
            +R++  + I ++ +VNFPYD   ++N+   +G  L WL PFG P+GNGM FEKNE++ +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 300 EHGSTLTDKLLSLPWPPDGERAPNSS--NSRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357
           +  S+L    L+LPWPPD  R  NS   N+   VE  T +GE ++R R+      LSR E
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 358 WYNDWGENLAHFGVDVDADD 377
           W+N+WGENL  FGVDV+ ++
Sbjct: 361 WFNEWGENLEDFGVDVEMEN 380

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  382 bits (981), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 194/397 (48%), Positives = 265/397 (66%), Gaps = 22/397 (5%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M ++LKWPWLGIAIP FLI+FIGYSA  F+L   LS K Q+WFQFSL+MIWLSYY AI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGSP-VPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNN 119
           +PGSP +          + YCKKC  +KP R HHCKTC +C+L+MDHHCP+TMNCVG+ N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 FPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLL 179
           +PHF+RFLFW+I TT +L  Q F+R  F+W   +S++ LV ++EI+ LTILTP +AF+LL
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 180 TISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRR-----LVPQLLSNLEELYP-NSL 233
           TI++L  RC  NQ+ +GM+QIE WEM+R+ES FY+R+      +  L++N+  ++   S 
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 234 DGHKGEIDRIL---NNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMV 290
           + ++ E++ +L   + R+++F  ++NFPYD D   N    +GP  +WLNPFG P G+GM 
Sbjct: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300

Query: 291 FEKNELSAYEHGSTLTDKLLSLPWPPD---GERAPNSSNSRLKVESSTRNGEHIIRKRSP 347
           FE NE+ A E  STL D LLSLPWPPD    +   +       VE+    GE ++R R+ 
Sbjct: 301 FELNEI-ASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359

Query: 348 EPRLN--------LSRTEWYNDWGENLAHFGVDVDAD 376
            P  +        LSR  W N+WGENL  FGVD++ +
Sbjct: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 245/385 (63%), Gaps = 16/385 (4%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           MPV+LK PW GIAIPC LI FIGY A  F+L+  LS K+QI FQF LTMIW+SYY AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGSPVPGF--QPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYN 118
           NPG P  G   Q    +   YC KC  FKPER+HHCKTC QCVL+MDHHCP+TMNC+G+ 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRH----STAQLVTKKEIIFLTILTPAN 174
           NFP FMRFL W+I TT+ L      R   +W  R+          T KE++ L +LTP +
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 AFVLLTISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNS-L 233
            FVL TI+ LF RC+ NQV+ GMTQIE+WEM+R+++MFY+++L+P ++  + E +P+   
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 234 DGHKGEIDRILNNRK---ISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMV 290
             H+ E +++L   +   + F  +VNFPYD D   N+   +G  +  L PF    GNG+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 291 FEKNELSAYEHGSTLTDKLLSLPWPPDGERA---PNSSNSRLKVESSTRNGEHIIRKRSP 347
           F+KN++S YE   +++D LL L WPPDG R    P   +    ++ +  +GE +IRKR+ 
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360

Query: 348 EPRLNLSRTEWYNDWGENLAHFGVD 372
                 SRT W N WGE L  FGVD
Sbjct: 361 PIE---SRTTWENQWGETLEGFGVD 382

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  191 bits (485), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 138/415 (33%), Positives = 204/415 (49%), Gaps = 80/415 (19%)

Query: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60
           M ++   PW G+AIP  +I  +   +   +LQ  L+  Q IW+  +  MI  SYY AI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGSPVPGFQPLKHEWKNYCKKCQN-------------FKPERTHHCKTCAQCVLVMDHH 107
            P +P P    L   + +     +N              K  R HHCKTC  CV++MDHH
Sbjct: 61  -PPTPAPS--TLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHH 117

Query: 108 CPFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLV--TKKEII 165
           CP+TMNCVGY N+PHF+RFL W+I +TT L  Q  K+ + ++  R+S   L    K +II
Sbjct: 118 CPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKII 177

Query: 166 FLTILTPANAFVLLTISILFGRCIKNQVLNGMTQIEAWEMDRIES--------------- 210
            LT+L P   FV LT+ +L  + ++NQ+ NGMTQIE W+ + IE+               
Sbjct: 178 ILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQ 237

Query: 211 ------MFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNNRKISFEDLVNFPYDSDPW 264
                  FYN++L    ++ +++L  +  +G +            SF  ++NFPYD    
Sbjct: 238 LLENLLNFYNKKLSTDSITKIQKLISSLQNGARW---------NTSFHSIINFPYDLGLS 288

Query: 265 RNLINCMGPM--LTWLNPFGKPNGNGMVFEKNELSAYEHGST---LTDKLLSLPWPPDGE 319
            N+   MG +  L+W NP+  P       + NE + ++   T   + D LL LPWP    
Sbjct: 289 NNITTTMGSLNPLSWFNPWYTP-LTASYNKINEFAIWDDNETHDNIKDMLLCLPWP---- 343

Query: 320 RAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEWYNDWGENLAHFGVDVD 374
              N SN+     S+ ++GE +++                ND+GE L  FGVD D
Sbjct: 344 --LNYSNN-----STFQDGELVVKS---------------NDYGETLQDFGVDYD 376

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 85.9 bits (211), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 95/208 (45%), Gaps = 41/208 (19%)

Query: 53  SYYKAIYTNPGSPV--------------------PGFQP-----LKHEWK-NYCKKCQNF 86
           +YYK I   PGSP+                    P F       LKH+ +   C+ C  +
Sbjct: 53  TYYKVIIVGPGSPLDFGQLTVRNIKDAEDGIELPPDFLAQRSFTLKHDGRFRVCRTCNVW 112

Query: 87  KPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI----ITTTTYLSIQFF 142
           KP+R HHC  C +C+L MDHHCP+   CVG+ N  +F++FL +     I   TY S Q +
Sbjct: 113 KPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYAILVMTYTSFQIY 172

Query: 143 KRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQIEA 202
              WF   +  +    + K  ++ + IL+ A   V LT++   G  I  Q +N  T IE 
Sbjct: 173 D--WFKNELYETE---IIKIRLLMVWILSVA---VFLTVTCFTGFSIY-QTINNRTTIEM 223

Query: 203 WEMD--RIESMFYNRRLVPQLLSNLEEL 228
           + +   R E   Y      QL  N+ +L
Sbjct: 224 YTLRKYREELELYGNYRDSQLTRNIFDL 251

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 94/187 (50%), Gaps = 34/187 (18%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ CQ +KP+R HHC TC +C+L MDHHCP+   C+G+ N  +F++FL  I  T   + +
Sbjct: 101 CQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFL--IYCTAYSIVV 158

Query: 140 QFFKRT----WFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIK-NQVL 194
            FF       WF      S  Q   + E+I L +LT     +++T+S++F       Q+L
Sbjct: 159 LFFTSCELHYWF------SGKQY--EDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLL 210

Query: 195 NGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRI--LNNRKISFE 252
              T IE + M R       R L  +LL  LE+           E+D I  L +R+ ++E
Sbjct: 211 KNQTTIEMYGMKR-----EKRDL--ELLRGLED----------AEVDNIFDLGSRRRNWE 253

Query: 253 DLVNFPY 259
            ++   Y
Sbjct: 254 SVMGESY 260

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 82/189 (43%), Gaps = 33/189 (17%)

Query: 46  SLTMIWLSYYKAIYTNPGSPVPGFQPLKHEWK--------------------------NY 79
           +L +   +YYK I T PGSP+     L H+ K                            
Sbjct: 46  TLMVALYTYYKVISTGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCMTLKRDGRFRV 105

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C  +KP+R HHC +C  C+L MDHHCP+   C G+ N   F++FL +    TT+ + 
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMY----TTFYAF 161

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISIL-FGRCIKNQVLNGMT 198
                T +      ++      +E+I L +L  A   + + IS+L F      QV N  T
Sbjct: 162 LVLIDTCYELGTWFNSGSF--SRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQT 219

Query: 199 QIEAWEMDR 207
            IE   M R
Sbjct: 220 TIELHSMRR 228

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 97/220 (44%), Gaps = 42/220 (19%)

Query: 24  YSAQLFVLQGFLSVKQQIW--FQFSLTMIW-------LSYYKAIYTNPGSPV-------- 66
           ++  L++   F ++ Q  W  + F +TM+W        +Y +A    PGSP         
Sbjct: 15  FTTFLYLWSFFTAIYQIKWINYTFMITMLWSLYLIGYYAYVQAFMVGPGSPSDFPELRVN 74

Query: 67  --------PGFQP---------LKHEWK-NYCKKCQNFKPERTHHCKTCAQCVLVMDHHC 108
                     F P         LKH+ +   C+ C  +KP+R HHC +C +C+L MDHHC
Sbjct: 75  SIEAAEAGTEFPPEYLSQKSITLKHDGRARVCRTCLVWKPDRCHHCSSCDRCILKMDHHC 134

Query: 109 PFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLV-TKKEIIFL 167
           P+   C+G+ N  +F+ FL +     T++ +   K  W  ++      +L+     ++F+
Sbjct: 135 PWFAECIGFKNHKYFINFLIYNSLYATFVCLISSKELWNWFSQEKYVTELINIHLLLLFI 194

Query: 168 TILTPANAFVLLTISILFGRCIKNQVLNGMTQIEAWEMDR 207
             L  + +  L T   ++      QVL   T IE +   R
Sbjct: 195 VSLITSVSMTLFTAYSIY------QVLINRTTIELYAYRR 228

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 9/152 (5%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C  +KP+R+HHC TC +CVL MDHHCP+   C+G+ N   F++FL +  TT  Y+  
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIY-NTTYAYVIA 168

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
               +  + W    S         ++FL IL      V L +S   G  +   V+N  T 
Sbjct: 169 ILTSKQMYNWFDDGSYENEFVNMYLLFLWILALV---VSLALSCFAGFSVY-MVMNNKTT 224

Query: 200 IEAWEMD--RIESMFYNRRLVPQLLSNLEELY 229
           IE + M   R +   YNR   P  + ++E ++
Sbjct: 225 IEMYAMRKYRDDLELYNRN--PNRVPSVENIF 254

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 78/141 (55%), Gaps = 8/141 (5%)

Query: 72  LKHEWK-NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI 130
           +KH+ +   C+ C  +KP+R HHC +C +C+L MDHHCP+   C+G+ N  +F++FLF+ 
Sbjct: 97  MKHDGRFRICQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFY- 155

Query: 131 ITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTIS-ILFGRCI 189
              T+Y  I  F  +  +++   ST+    + E I   +LT     +++ IS +LF    
Sbjct: 156 --CTSYSIIVLFVTSIQIYHWFRSTSY---EYEFIDFKLLTVWLLAIVIFISLVLFTGFS 210

Query: 190 KNQVLNGMTQIEAWEMDRIES 210
             Q+L   T IE +   R ++
Sbjct: 211 VFQLLGNQTTIELYAYRRYKA 231

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 86/189 (45%), Gaps = 33/189 (17%)

Query: 46  SLTMIWLSYYKAIYTNPGSPV--------------------PGFQP-----LKHEWK-NY 79
           +L +   +Y+KAI   PGSP+                    P +       LKH+ +   
Sbjct: 46  TLLVALYTYFKAIAKGPGSPLDFPDLLVHDLQAAENGLELPPEYMSKRCMTLKHDGRFRV 105

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C  +KP+R HHC +C  C+L MDHHCP+   C G+ N   F++FL +   TT Y  +
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY---TTFYAFL 162

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISIL-FGRCIKNQVLNGMT 198
                 + +    HS +     +E+I   +L  A   + + IS+L F      QV N  T
Sbjct: 163 VLIYSCYELGTWFHSGS---FNQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQT 219

Query: 199 QIEAWEMDR 207
            IE + M R
Sbjct: 220 TIELYGMRR 228

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 13/132 (9%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYL-- 137
           C+ C+ +KP+R HHC +C +C+L MDHHCP+   CVG+ N   F++FL +      ++  
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 138 --SIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLN 195
             S+Q ++     W       + +    ++FL I     + V+     LF     +QVL 
Sbjct: 163 MTSVQLYR-----WFYNDKFQEELISGYLLFLWIF----SLVVFIAMTLFSAFSVSQVLK 213

Query: 196 GMTQIEAWEMDR 207
             T IE + + R
Sbjct: 214 NQTTIEMYGVQR 225

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 72/148 (48%), Gaps = 12/148 (8%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ CQ +KP+R HHC TC +C+L MDHHCP+   C+G+ N   F++FL +  T   ++++
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIY-CTIYAFVAL 167

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
                 +  W       Q    + I F  ++    AFV+    + F      QVL   T 
Sbjct: 168 GLISYQFVNW----YKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTT 223

Query: 200 IEAWEMDRIESMFYNRRLVPQLLSNLEE 227
           IE + + R     YNR     +L+  EE
Sbjct: 224 IEMYGIRR-----YNRDFA--ILNGTEE 244

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 91/195 (46%), Gaps = 42/195 (21%)

Query: 45  FSLTMIWL-SYYKAIYTNPG--------------SPVPGFQ--PLKHEWKNY-------- 79
           F++ M+ L +Y K IY  PG              +   GF+  P     ++Y        
Sbjct: 44  FTIAMVALYTYAKLIYVGPGTTKEYSILRVYDLNAAESGFELPPEMLVKRSYTQKRNGRF 103

Query: 80  --CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYL 137
             CK C ++KP+R HHC TC  CVL MDHHCP+   CVGY N   F++FL +    +  +
Sbjct: 104 RVCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILV 163

Query: 138 ----SIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISI-LFGRCIKNQ 192
               S++ +  TWF             + E+I  T+L+     ++++ISI +F     +Q
Sbjct: 164 LILSSMEIY--TWFKGEF--------FEVELINFTLLSLWLLALVVSISITIFTVFSISQ 213

Query: 193 VLNGMTQIEAWEMDR 207
           V    T IE + + R
Sbjct: 214 VCQNQTTIELYSLRR 228

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 80/189 (42%), Gaps = 33/189 (17%)

Query: 46  SLTMIWLSYYKAIYTNPGSPVPGFQPLKHEWK--------------------------NY 79
           +L +   +YYK I   PGSP+     L H+ K                            
Sbjct: 46  TLAVALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCLTLKHDGRFRV 105

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C  +KP+R HHC +C  C+L MDHHCP+   C G+ N   F++FL +   TT Y  +
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMY---TTLYAFL 162

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIK-NQVLNGMT 198
                 + +    +S +     +E+I   +L  A   V + IS+L   C    QV    T
Sbjct: 163 VLIYTCYELGTWFNSGS---FNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQT 219

Query: 199 QIEAWEMDR 207
            IE   M R
Sbjct: 220 TIEVHGMRR 228

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 83/171 (48%), Gaps = 43/171 (25%)

Query: 28  LFVLQGFLSVKQ--QIWFQFSLTM-IWL------SYYKAIYTNPGSP-------VPGFQP 71
           L++   ++S+ +  QIW++F +++ ++L      +YYK I T PGSP       V   Q 
Sbjct: 20  LYLWTSYVSLTRINQIWYKFLVSVDVFLVAIGLYTYYKVIITGPGSPLDYDTIKVYDMQA 79

Query: 72  LKHEWK-------------------NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTM 112
           ++   +                     C+ C  +KP+R HHC  C +C+L MDHHCP+  
Sbjct: 80  VESGAELPPEFLSRRSITTKRDGRFRVCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFP 139

Query: 113 NCVGYNNFPHFMRFLFWIITTTTYL----SIQFFKRTWFVWNIRHSTAQLV 159
            C+G+NN   F+++L +  T +  +    SIQ     WF  N +    +L+
Sbjct: 140 GCIGFNNQRFFIQYLLYATTYSIVIFLFSSIQLLH--WF--NTKQYEVELI 186

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 61/122 (50%), Gaps = 10/122 (8%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C   KP R+ HC  C +C+L++DHHC +  NC+G  N+ +F  FL   ++  T LS 
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL---LSNVTLLSY 188

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
            F + T        S  + +  K ++ LTILT         I  +FG    N V +GMT 
Sbjct: 189 SFLRLTSIQL---MSQTENIKTKPMLVLTILTGC----FDIIVAVFGYTQFNLVHDGMTT 241

Query: 200 IE 201
            E
Sbjct: 242 NE 243

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 84/189 (44%), Gaps = 33/189 (17%)

Query: 46  SLTMIWLSYYKAIYTNPGSPV--------------------PGF-----QPLKHEWK-NY 79
           +LT+   +YYK I   PGSP+                    P +       LKH+ +   
Sbjct: 46  TLTVALYTYYKVISRGPGSPLDFPDLIVHDLKAAENGLELPPEYISKRCMTLKHDGRFRV 105

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C  +KP+R HHC +C  CVL MDHHCP+   C G+ N   F++FL +   TT Y  +
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY---TTCYAFL 162

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISIL-FGRCIKNQVLNGMT 198
                 + +    +S +     +E+I   +L  A   V + I++L F      QV    T
Sbjct: 163 VLIYTCYELGTWFNSGS---FNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCKNQT 219

Query: 199 QIEAWEMDR 207
            IE   M R
Sbjct: 220 TIEVHGMRR 228

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           +C+ C  +KP+R HHC  C +C L MDHHCP+  +CVGY N  +F+ FL +   TT Y  
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLY---TTAYSI 188

Query: 139 IQFF 142
           + FF
Sbjct: 189 LVFF 192

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 9/139 (6%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           CK C+  KP R+ HC  C QC+LV DHHC +  NC+G  NF +F  FLF      +Y S+
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSYASM 196

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
           +  + T    N R +   +   ++++ L IL     F+  T S +    +K    +GMT 
Sbjct: 197 RLLEIT---LNFRRAGENV--PRDVMTLDILCGCFLFICGTFSYMQLLIVK----DGMTT 247

Query: 200 IEAWEMDRIESMFYNRRLV 218
            E  +   I+ +  +++LV
Sbjct: 248 NEKDKWYTIQCLMEDKKLV 266

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 57/128 (44%), Gaps = 33/128 (25%)

Query: 49  MIWLSYYKAIYTNPGSPV--------------------PGFQPLKHEWKN------YCKK 82
           +I  +Y+  I   PGSP+                    P F   K    +      YC K
Sbjct: 114 LILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLDSTGRHRYCVK 173

Query: 83  CQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL-------FWIITTTT 135
           C+ +KP+R HHC  C +C L  DHHC +   C+GYNN   F+ FL       FWI   TT
Sbjct: 174 CKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWICIITT 233

Query: 136 YLSIQFFK 143
           +  + +F+
Sbjct: 234 WDLVVWFR 241

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFW 129
           +C+ C  +KP+R HHC  C +C L MDHHCP+  +CVGY N  +F++FL +
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIY 155

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 104/242 (42%), Gaps = 40/242 (16%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYL- 137
           +C+ C+ +KP+R HHC  C +C L MDHHCP+  +CVG+ N   F++FL +    + Y+ 
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVL 163

Query: 138 ---SIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISIL-FGRCIKNQV 193
              S Q +  +WF         Q+  K E++ L +L      V+  I+   F       V
Sbjct: 164 LMTSAQLY--SWF--------RQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLV 213

Query: 194 LNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRI--LNNRKISF 251
               T IE +E   I                  E+Y +S++ + G +D +  L +R  +F
Sbjct: 214 TKNETTIEQYEWGNIRHDL--------------EIYGDSINCNMGSVDNVFDLGSRSANF 259

Query: 252 EDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVF--EKNELSAYEHGSTLTDKL 309
             ++        W  L+  +   +   +PF      G+ F  + +    Y     L  +L
Sbjct: 260 NCVMG-----ASWAELL--LPIQVRADDPFDPYANQGLFFPVQSDTYRIYRESVNLQQRL 312

Query: 310 LS 311
           ++
Sbjct: 313 IT 314

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 26/110 (23%)

Query: 46  SLTMIWLSYYKAIYTNPGSPVPGFQPLKHEWK--------------------------NY 79
           +L +   +YYK I   PGSP+   + +  +                              
Sbjct: 48  TLVLGLYTYYKLISEGPGSPLEYSELVVRDVAAAENGTELPPEFLSRRSITSKRDGRFRL 107

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFW 129
           C+ C  +KP+R HHC  C +C+L MDHHCP+  +CVG+ N  +F++FL +
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMY 157

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 59/101 (58%), Gaps = 7/101 (6%)

Query: 72  LKHEWK-NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI 130
           LKH  +   C+ C+ +KP+R+HHC +C +C L MDHHCP+  +C+G+ N   F++FL + 
Sbjct: 96  LKHNGRFRICRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY- 154

Query: 131 ITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILT 171
             TT Y    F      +W    +    + +KE+I L+++T
Sbjct: 155 --TTWYAVFVFMTTGLQLWKWLDNK---MYEKELIDLSLMT 190

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 69/150 (46%), Gaps = 11/150 (7%)

Query: 69  FQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLF 128
           F  + +   N C  C   KP R+ HC  C  C+L+ DHHC +  NC+G  N+ +F  FL 
Sbjct: 128 FDNIIYHSGNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFL- 186

Query: 129 WIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRC 188
             +  T  LS  F +    + +I  S   +   K I+ L ILT + +     I  +F   
Sbjct: 187 --LLNTISLSYAFLR----LLHITLSKPDVPKSKNILALCILTGSFS----VICGVFFYL 236

Query: 189 IKNQVLNGMTQIEAWEMDRIESMFYNRRLV 218
              QV NGMT  E  +   ++ +    +L+
Sbjct: 237 QMKQVNNGMTTNETDKWYAVQELMREGKLI 266

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 77/177 (43%), Gaps = 16/177 (9%)

Query: 51  WLSYYKAIYTNPGSPVPGFQPLKHEWKNY-----CKKCQNFKPERTHHCKTCAQCVLVMD 105
           WLS      T+ G      Q   +++  Y     C+ C   KP R+ HC  C +CVLV D
Sbjct: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163

Query: 106 HHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEII 165
           HHC +  NC+G  N+  F  FL   +     LS  F +  W   ++    + +V  + I+
Sbjct: 164 HHCVWVNNCIGKGNYQFFYAFL---VVNVISLSYGFLRVLWI--SVMKDPSMVVYPRSIL 218

Query: 166 FLTILTPANAFVLLTISILFGRCIKNQVLN-GMTQIEAWEMDRIESMFYNRRLVPQL 221
             TIL    A +    + L     + Q++N GMT  E  +   I+ +     LV  L
Sbjct: 219 IFTILCGTFAIICGVFTYL-----QLQLVNDGMTTGEKDKWYTIQQIMREGNLVRTL 270

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 32/117 (27%)

Query: 53  SYYKAIYTNPGSPVPGFQPLK---------------------------HEWKNYCKKCQN 85
           +Y+K I    GSP+  F+PLK                           +    YC  C  
Sbjct: 57  TYFKVISIGAGSPL-DFEPLKVKNSEHAEVGLEFPPEFLSKKSVTLRQNGRYRYCATCGV 115

Query: 86  FKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFF 142
           +KP+R+HHC +C +C L  DHHCP+  +C+G+NN   F++FL +    +T  SI  F
Sbjct: 116 WKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMY----STLYSISIF 168

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ CQ++KP R+ HC  C +CVLV DHHC +  NCVG  N+ +F  FL   IT T  L+ 
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL---ITNTFSLTY 193

Query: 140 QFFK 143
            F +
Sbjct: 194 AFIR 197

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 72/160 (45%), Gaps = 20/160 (12%)

Query: 67  PGFQP--LKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFM 124
           P FQP  +       C+ C+  K  R+ HC  C +C+ + DHHC +  NCVGY N+ +F 
Sbjct: 114 PQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFY 173

Query: 125 RFLFWIITTTTYLSIQ---FFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTI 181
            FL       TY S++    F+ T F             KK+  FL++     AF L  I
Sbjct: 174 SFLLSNCLLLTYASLRLLTLFRITAF-------------KKDKFFLSLFLLTTAFSL--I 218

Query: 182 SILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQL 221
           +I+F       V +GMT  E  +   ++    N  LV  +
Sbjct: 219 AIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVKDM 258

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYL 137
           YC+ C+ ++P RT HC TC  CV+V DHHC +  NCVG  N+  F+ FL   I ++ +L
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFL 232

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 62/139 (44%), Gaps = 11/139 (7%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ CQ  KP R+ HC  C QCVL +DHHC +  NCVG  N+ +F  FL     + +Y  I
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAFI 194

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
           +         NI++        + I+   +LT   A     I I+F       V  GMT 
Sbjct: 195 RSMSIVGLKPNIKYP-------RSILAFNLLTGCFAL----ICIVFTYLQLCMVREGMTT 243

Query: 200 IEAWEMDRIESMFYNRRLV 218
            E  +   I      +RLV
Sbjct: 244 NEKDKWFTIHEYMREKRLV 262

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 105/248 (42%), Gaps = 35/248 (14%)

Query: 6   KWPWLGIAIPCFLIAFIGYSAQLFV--LQGFL-----SVKQQIWFQFSLTMIWLSYYKAI 58
           ++ W   AIP F ++   Y   LF   ++G +      V++ +    +L+   ++    I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  YTNPGSP-----VPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMN 113
           +  P S      +  +  L       C+ C+  K  RT HC  C QCV + DHHC +  N
Sbjct: 107 WIKPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANN 166

Query: 114 CVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPA 173
           C+G  N+ +F  FL     +  +L+   F R  F+    HS       ++++ L+IL   
Sbjct: 167 CIGRGNYQYFYLFL----VSNVFLTNYGFLRLLFLQRFVHS-------RQLLILSILLGC 215

Query: 174 NAFVLLTISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVP--------QLLSNL 225
              +L   S      ++    +GMT  E  +   I  M   R++V         +LL++ 
Sbjct: 216 FGVILAVFSYFQFVLVR----DGMTTNEENKWLVIHDMIRARQMVTDDTGKYYFRLLADC 271

Query: 226 EELYPNSL 233
           +E    SL
Sbjct: 272 QEDSAESL 279

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 54  YYKAIYTNPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMN 113
           YY  I       + G    K E K YC  C+ ++P R  HC TC  C+L  DHHC +  N
Sbjct: 156 YYSTISLPAPQTIRGDIQAKIELK-YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNN 214

Query: 114 CVGYNNFPHFMRFLFWIITTTTYL 137
           C+G  N+ +F+ FL   I ++ +L
Sbjct: 215 CIGQRNYRYFILFLASAILSSIFL 238

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 38/74 (51%)

Query: 66  VPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMR 125
           +P  Q   H    YC  C+ ++P R  HC+ C  CV   DHHC +  NCVG  N+ +F+ 
Sbjct: 172 LPTAQRSAHVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLT 231

Query: 126 FLFWIITTTTYLSI 139
           FL     T T L +
Sbjct: 232 FLTATCATCTVLFV 245

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 79/172 (45%), Gaps = 14/172 (8%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C  C+  K  R+ HC  C +CVLV DHHC +  NC+G  N+  F  FLF  I + +Y   
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYA-- 193

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
             F R +F+    +STA  V  + ++ LTIL      +    + L    +K     GMT 
Sbjct: 194 --FLRLYFI--SFNSTA--VLPRAVLTLTILCGCFTIICAIFTYLQLAIVK----EGMTT 243

Query: 200 IEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNNRKISF 251
            E  +   I+      +LV  L  +    +    +  KG+  + L ++ ++F
Sbjct: 244 NEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTE--KGDTGQPLQDQHVTF 293

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 54  YYKAIYTNPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMN 113
           YY +I  +  +P     PL      YC  C+ ++P R  HC TC  CV+  DHHC +  N
Sbjct: 157 YYSSI--SLPTPKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNN 214

Query: 114 CVGYNNFPHFMRFLFWIITTTTYL----SIQFFKRT 145
           CVG  N+ +F+ FL   +    +L    SI   +R+
Sbjct: 215 CVGQRNYRYFIIFLIGTVLAELFLIANCSIHIARRS 250

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C+  KP R+ HC  C  C+ + DHHC +  NCVG  N+ +F  FL    +    LS 
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL---CSNLLLLSY 192

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMT- 198
            F +  +  +N          +K ++ L+IL  +   V+L +   F   +   V +GMT 
Sbjct: 193 SFIRLIFIQFNKSAYNTTPTGEKSLLILSILCGSFT-VILAVYCYF---VFELVNSGMTT 248

Query: 199 -QIEAWEM 205
            + + W+M
Sbjct: 249 NEKDKWQM 256

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 12/122 (9%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C   KP R+ HC+ C  C+L+ DHHC +  NC+G  N+ +F  FL     T TY  I
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
           + F        + +      + + I+ L IL  + A +    + L  + +K    +GMT 
Sbjct: 199 RLF--------LMYCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVK----DGMTT 246

Query: 200 IE 201
            E
Sbjct: 247 NE 248

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           YCK C+ ++P R+ HC  C  CVL+ DHHC +  NCVG  N+ +F+ FL     T+ +L 
Sbjct: 183 YCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLI 242

Query: 139 I 139
           +
Sbjct: 243 V 243

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 24/123 (19%)

Query: 41  IWFQFSLTMIWLSYYKAIYTNPGS-PVPGFQP-LKHEWK--------------------- 77
           I F +S T+ +LS+ K   T+PG+ P     P L+++++                     
Sbjct: 126 ILFYYSWTLCFLSFIKTATTDPGTLPRNIHLPQLRNDYELPSEYYSIITLPSSSTNSPIQ 185

Query: 78  -NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTY 136
             YC  C+ ++P R  HC TC  C++  DHHC +  NCVG  N+ +F+ F++  + T   
Sbjct: 186 LKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIIL 245

Query: 137 LSI 139
           L I
Sbjct: 246 LVI 248

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 71  PLKHEWK----NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRF 126
           P+K E +     YC+ C+ ++P R+ HC  C  CV+ +DHHC +  NCVG  N+ +F+ F
Sbjct: 183 PIKDESQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIF 242

Query: 127 LFWIITTTTYLSIQ 140
           L   I T  +L I 
Sbjct: 243 LTSTIMTVIFLLIN 256

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 54  YYKAIYTNPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMN 113
           YY  I    G+P+     +K     YC  C+ ++P R  HC TC  C++  DHHC +  N
Sbjct: 151 YYNMITLPTGNPLIANIEVK-----YCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNN 205

Query: 114 CVGYNNFPHFMRFLFWIITTTTYL 137
           C+G  N+ +F  FL   +  T ++
Sbjct: 206 CIGQRNYHYFFTFLVSCVIATAFI 229

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%)

Query: 78  NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYL 137
            YC+ C+ ++P R+ HC TC  CV+V DHHC +  NC+G  N+  F+ FL   + ++  L
Sbjct: 173 KYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIIL 232

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 65/142 (45%), Gaps = 12/142 (8%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C  C+  KP R+ HC  C +CVLV DHHC +  NC+G  N+  F  FL   I +  Y   
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYA-- 193

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
             F R W++    +ST+ L   + ++ LTIL      +    + L    +K     GMT 
Sbjct: 194 --FLRLWYI--SLNSTSTL--PRAVLTLTILCGCFTIICAIFTYLQLAIVK----EGMTT 243

Query: 200 IEAWEMDRIESMFYNRRLVPQL 221
            E  +   I+      +LV  L
Sbjct: 244 NEQDKWYTIQEYMREGKLVRSL 265

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (56%)

Query: 78  NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTT 135
            YC  C+ ++P R  HC TC  CVL  DHHC +  NC+G  N+ +F+ FL      TT
Sbjct: 176 KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATT 233

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYL 137
           YC  C+ ++P R+ HC TC  CV+V DHHC +  NC+G  N+  F+ FL   I ++  L
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVIL 232

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 66/148 (44%), Gaps = 12/148 (8%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C  C   KP R+ HC  C +C+LV DHHC +  NC+G  N+  F  FL   I +  Y   
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYA-- 193

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199
             F R W + ++   TA     + ++ LTIL     F +  I I+F       V  GMT 
Sbjct: 194 --FLRLWCI-SLNSKTA---LPRAVLTLTIL--CGCFTI--ICIIFTYLQLTIVREGMTT 243

Query: 200 IEAWEMDRIESMFYNRRLVPQLLSNLEE 227
            E  +   I+      +LV  L  N + 
Sbjct: 244 NEQDKWYTIQEYMREGKLVRSLNDNCQS 271

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (44%), Gaps = 12/141 (8%)

Query: 78  NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYL 137
            +C  C+  KP R+ HC  C +CVL+ DHHC +  NC+G  N+ +F  FL   ++ T  L
Sbjct: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL---VSNTLLL 191

Query: 138 SIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGM 197
              F +       I   TA        I LT L  + AF    I ++F       V +GM
Sbjct: 192 GYAFLR-------IILLTAYSDIGFPNIVLTFLILSGAF--FAILLVFTYLQFALVYDGM 242

Query: 198 TQIEAWEMDRIESMFYNRRLV 218
           T  E  +   I+      RL+
Sbjct: 243 TTNEKDKWFTIQEFMREGRLI 263

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           YC  C+ ++P R+ HC TC  CV+V DHHC +  NC+G  N+  F+ FL   I ++  L 
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILLL 233

Query: 139 I 139
           +
Sbjct: 234 V 234

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTY 136
           C  C+  KP R+ HC  C +C+LV DHHC +  NC+G  N+  F  FL   I + +Y
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSY 192

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           YC  C  ++P R  HC  C  C+ V DHHC +  NCVG  N+ +F+ FL   I ++ ++ 
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

Query: 139 IQFFKRTWFVWNIRHSTAQLVTKKEIIF--LTILTPA 173
           I     +  V  IR ++   V    I++  LTI+ P 
Sbjct: 249 INC---SIHVARIRRASNAPVAILLIVYGCLTIIYPG 282

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 15/160 (9%)

Query: 59  YTNPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYN 118
           Y  P  P  G   + H+    C+ C+  K  R+ HC  C +C+LV DHHC +  NC+G  
Sbjct: 115 YVGPEIPFDGI--IFHD-NIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLG 171

Query: 119 NFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVL 178
           N+ +F  FL    +  +Y +I+          +       + +    FL+++     F +
Sbjct: 172 NYQYFYLFLLSNCSMLSYATIR----------LSSVAPSGLWRSNKSFLSLMILVCCFAV 221

Query: 179 LTISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLV 218
           ++IS  + +     V +GMT  E  +   I  +  N +L+
Sbjct: 222 ISISFTYMQ--FALVRDGMTTNEKDKWYTIHKLMRNEQLL 259

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 5/83 (6%)

Query: 55  YKAIYTNPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNC 114
           Y +I T P SPV    P++     YC  C+ ++P R  HC  C  C+L  DHHC +  NC
Sbjct: 167 YYSIITLP-SPVAN-APVR---LKYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNC 221

Query: 115 VGYNNFPHFMRFLFWIITTTTYL 137
           +G  N  +F+ FLF  + ++ +L
Sbjct: 222 IGQRNHRYFLAFLFSSVLSSIWL 244

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 31/49 (63%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL 127
           YC+ C+ ++P R  HC  C  CV+  DHHC +  NCVG  N+ +F+ FL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFL 225

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           YC  C+ ++P R+ HC  C  C++  DHHC +  NC+G  N+  F+ FL     T+ +L 
Sbjct: 216 YCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLI 275

Query: 139 I 139
           I
Sbjct: 276 I 276

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%)

Query: 78  NYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL 127
            YC  C+ ++P R  HC  C  C+L  DHHC +  NC+G  N+ +F+ FL
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFL 220

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLF 128
           YC  C+ ++P R  HC  C  CVL  DHHC +  NCVG  N+ +F+ FL 
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLL 208

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           CK C+  KP R+ HC  C +C+L+ DHHC +  NC+G  N+  F  F    I   +   I
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLF----IGGNSLTMI 190

Query: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISIL 184
             F R  F+ +I++   ++ + + I+ + IL  + A +    + L
Sbjct: 191 YCFTRLLFI-SIKY---KVTSSRAILTMNILCGSFAIICSVFTYL 231

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 31/49 (63%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL 127
           YC+ C+ ++P R+ HC  C  CVL  DHHC +  NC+G  N+  F+ FL
Sbjct: 173 YCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFL 221

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 5/110 (4%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL--FWIITTTTY 136
           +C  CQ+ K ER+HH +    CV   DH+C +    +G  N+  FM+++  F I   T  
Sbjct: 126 WCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTAS 185

Query: 137 LSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFG 186
           L+I  F +    +N  H    L     II L IL  A AF +  +  +F 
Sbjct: 186 LTIALFMKRIVDYNKEHD---LTLNLNIIVLFILVLAFAFFVTPLFAVFS 232

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139
           C+ C+  KP R+ HC  C +CV + DHHC +  NCVG  N+  F   L       TY ++
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGAHCALLTYGAV 185

Query: 140 QF 141
           + 
Sbjct: 186 RL 187

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

Query: 60  TNPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNN 119
           T    PV  F  +       C+ C+  K  R+ HC  C +C  + DHHC +  NC+G  N
Sbjct: 111 TYIAPPVDQFDGILFHAGVECRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGN 170

Query: 120 FPHFMRFLFWIITTTTYLSIQFFKRTWFV 148
           + +F  FL     +  +L++  F R  ++
Sbjct: 171 YEYFYLFL----ASNVFLTVYGFTRLLYL 195

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 92/225 (40%), Gaps = 31/225 (13%)

Query: 65  PVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFM 124
           P   +Q   H +  +C  CQ+ K ERTHH      CV   DH+C +    +G +N+  F+
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFV 176

Query: 125 RFL--FWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFV--LLT 180
           +F+  F I+    + SI  + +   +    HS    +         +LT A A +  LLT
Sbjct: 177 QFVAYFSILLLIMWASICVYTKE--ITQRHHSQGPRINVN-----VMLTLAFAILGWLLT 229

Query: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240
            S L G  I     N  T +EA  MD     F  R++      + +  +    D  + E 
Sbjct: 230 TSTL-GSAIFYMSQNK-TSLEA-IMDSKRKKFGTRKIFSYYSESNKLRFVVEFD--RSEF 284

Query: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGP-MLTWLNPFGKP 284
               + + I                N+ + MGP ML WL P GKP
Sbjct: 285 HAFWSKKTI--------------LANVKDFMGPNMLMWLIPLGKP 315

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 63/150 (42%), Gaps = 21/150 (14%)

Query: 14  IPCFLIAFIGYSAQLF------VLQGFLSVKQQIWFQ-FSLTMIWLSYYKAIYTNP---G 63
           +P F  +   Y   L+      V+ G L   +  +FQ   L  I +S    ++T P   G
Sbjct: 54  VPVFYFSLYCYMLNLYRSELLPVIWGRLYFIELYFFQPLLLAAIPVSGLLTMFTRPEGCG 113

Query: 64  SPVPGFQPLKHEW---------KNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNC 114
               G  P + +W            C+ C   K  R+ HC  C +C+ + DHHC +   C
Sbjct: 114 GRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTC 173

Query: 115 VGYNNFPHFMRFL--FWIITTTTYLSIQFF 142
           +G  NF +F  FL    +I T  +  + FF
Sbjct: 174 IGRGNFFYFYVFLACHCLILTYAFARLFFF 203

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 65  PVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFM 124
           P   +Q  K+ +  +C  CQ+ K  R+HH K   +C+L  DH+C +    +  NN+  F+
Sbjct: 103 PPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFL 162

Query: 125 RFLFW--IITTTTYLSIQFFKRT 145
           +++ W  ++    +L+I  F RT
Sbjct: 163 QYVGWFNLLLLWYWLTIAVFIRT 185

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFW--IITTTTY 136
           +C  CQ+ K ER HH +    C+   DH+C +    +G NN+  F++++F+  ++    +
Sbjct: 116 WCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLLAWIW 175

Query: 137 LSIQFFKRTWFVWN 150
           LSI  F R+   +N
Sbjct: 176 LSISAFIRSIVTFN 189

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 91/217 (41%), Gaps = 31/217 (14%)

Query: 69  FQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLF 128
           +Q   H +  +C  CQ+ K  RT H      CV   DH+C +    +G+ N+  F++F+F
Sbjct: 105 YQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVF 164

Query: 129 W--IITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFG 186
           +  ++    +++I  + R     +IR   A+L        L +L   +    L  S LF 
Sbjct: 165 YFAVLLMIVWITISVYIR-----DIRQYHARLNAN-----LIVLLIISGIGWLMTSGLFV 214

Query: 187 RCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNN 246
             I     N +T IE  ++ +       R+  P+L       Y NS D H   + ++ N+
Sbjct: 215 SYIYYMSQN-LTSIEVIDLKK-------RKRTPELSMQRLYCYYNS-DDHYRYVVKLDND 265

Query: 247 RKISFEDLVNFPYDSDPWRNLINCMG--PMLTWLNPF 281
            K S        Y     +N+   MG  PML W  P 
Sbjct: 266 FKGSV-------YKKHWLKNIKEFMGSNPML-WFIPL 294

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 95/242 (39%), Gaps = 36/242 (14%)

Query: 65  PVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFM 124
           P   +Q   + +  +C  CQ+ K ER+HH      C+   DH+C +    +G +N+  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RF--LFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTIS 182
           +F   F  +    ++SI  F R     +  H+                +P NA V LT++
Sbjct: 176 QFTGYFSSLLLIMWVSICVFIRNITQHHHNHN----------------SPLNANVFLTLA 219

Query: 183 I-LFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEID 241
             +FG      +L             +E++  ++R         +      +  +  E +
Sbjct: 220 FAIFGWLFTTSMLASNIFYMCQNKTYLEAIMDSKR---------KNFGTRKIFCYYSEAN 270

Query: 242 RILNNRKISFEDLVNFPYDSDPWRNLINCMGP-MLTWLNPFGKP-------NGNGMVFEK 293
           ++    +    +  +F      + N+ + MGP ML WL PFGKP       N  G  F  
Sbjct: 271 KLRFVVEFERTEFHSFWSKKTIFANIKDFMGPNMLMWLIPFGKPLSFSCKSNDKGRPFRS 330

Query: 294 NE 295
            E
Sbjct: 331 GE 332

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL--FWIITTTTY 136
           +C  CQ+ K  RTHH  T   C+   DH+C +    VG  N+  F++F   FW+ T    
Sbjct: 124 WCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMI 183

Query: 137 LSIQFFKR 144
            SI  F R
Sbjct: 184 ASIASFLR 191

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 88/206 (42%), Gaps = 26/206 (12%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           +C  CQ+ K ER HH +    CV   DH C +  + +G +N+  F+++  ++   T +L+
Sbjct: 126 WCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFM---TIWLA 182

Query: 139 IQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMT 198
           I +     ++ +I        +      + IL     F +   S+L  +   N ++   T
Sbjct: 183 IIWTSIVAYIRSITRDYRGHGSHLNGNLIAILILTTLFWITVTSLLLTQL--NCIVKNKT 240

Query: 199 QIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNNRKISFEDLVNFP 258
            IE   M+R    F  R++           Y N  DG +  ++  LN ++  +E      
Sbjct: 241 SIEV--MERRRKAFSTRKMF---------CYYNPDDGCRYVVE--LNKKE--YESC---- 281

Query: 259 YDSDP-WRNLINCMGP-MLTWLNPFG 282
           +  D  W N +  +G  +  W+ P+G
Sbjct: 282 WSKDSWWANAVESLGSNIFMWVIPWG 307

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%)

Query: 65  PVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFM 124
           P   +Q   H +  +C +CQ+ K ERTHH      C+   DH+C +    +G +N+  F+
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFV 175

Query: 125 RFLFWIIT 132
           +F  +  T
Sbjct: 176 QFAAYFST 183

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%)

Query: 65  PVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFM 124
           P   +Q   H +  +C +CQ+ K ERTHH      CV   DH+C +    +G +N+  F+
Sbjct: 108 PPITYQCDPHGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFL 167

Query: 125 RFLFW 129
           +F+ +
Sbjct: 168 QFVAY 172

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 60  TNPGSPVPG--FQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGY 117
           T P S VP   +Q   + +  +C  C+  K  R+HH      C+   DH+C +    +G 
Sbjct: 97  TQPTSTVPAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGK 156

Query: 118 NNFPHFMRFLFW 129
           +N+  F+ FLF+
Sbjct: 157 DNYKQFVIFLFY 168

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFW--------I 130
           +C  CQ+ K  RTHH  T   C+   DH+C +    VG  N+  F++F F+        I
Sbjct: 131 WCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFVI 190

Query: 131 ITTTTYL 137
           ++T ++L
Sbjct: 191 VSTASFL 197

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 69  FQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLF 128
           +Q  ++ +  +C  CQ+ K  RTHH      CV   DH+C +    +G  N+  F++FL 
Sbjct: 115 YQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLV 174

Query: 129 WI--------ITTTTYLSIQFFKR 144
           ++        I+ + ++ +  F+R
Sbjct: 175 YMDCLLLIMWISMSPFIRVYTFRR 198

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 85/206 (41%), Gaps = 28/206 (13%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           +C  C++ K  RTHH K    C+   DHHC +    +G +N+  F +F+F+         
Sbjct: 123 WCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYFSCLLLIFW 182

Query: 139 IQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMT 198
           I        + +  H+  +L        + IL  +  F ++T+S LF   +    +N  T
Sbjct: 183 ISIVSYIKRIVDYPHTGYKLDPN----LIVILILSVPFSIMTLS-LFLSHVYFTFMN-RT 236

Query: 199 QIEAWEMDRIESMFYNRRLVPQLLSNLEEL--YPNSLDGHKGEIDRILNNRKISFEDLVN 256
            +E   + R      N++L      N+++   Y +   G++  I+       +S ED+ N
Sbjct: 237 SLEIINIKR------NKKL------NIKKFVCYLDKTSGNRYVIE-------MSPEDMAN 277

Query: 257 FPYDSDPWRNLINCMG-PMLTWLNPF 281
                  W N    +G   L W  PF
Sbjct: 278 IWKKRSIWENFKEVLGNNFLFWFIPF 303

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 84/218 (38%), Gaps = 25/218 (11%)

Query: 69  FQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLF 128
           +Q   H +  +C  CQ+ K ERTHH      CV   DH+C +    +G +N+  F++F+ 
Sbjct: 126 YQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFV- 184

Query: 129 WIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISI-LFGR 187
                T + S+           IR  T +              P N  V+LT+++ LFG 
Sbjct: 185 -----TYFSSLLLLMWLSICVYIRDITQRHRGHNP--------PLNVNVILTLALALFGW 231

Query: 188 CIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNNR 247
            +   +L       A     +E++  ++R       N              +   ++   
Sbjct: 232 LMNTSMLAATVFYMAQNKTSLEAIMDSKR------KNFGTRKIFCYYSVPNKSRFVVEFD 285

Query: 248 KISFEDLVNFPYDSDPWRNLINCMGP-MLTWLNPFGKP 284
           K  F     F        NL + MGP ML W+ P GKP
Sbjct: 286 KTEFH---AFWSKKTMLANLKDFMGPNMLMWIIPLGKP 320

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%)

Query: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRF 126
           C  CQ+ K ERTHH  T   CV   DH+C +    VG  N+  F++F
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 62/140 (44%), Gaps = 14/140 (10%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           +C  C + K ER HH      CV   DH C +    +G +N+  F++F+ ++   + ++ 
Sbjct: 126 WCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVF 185

Query: 139 I---QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLN 195
           +    F +R     + +HS    +    I+ L I   A    L+T S+L    +   ++ 
Sbjct: 186 VPICAFIRRIIHDGDTQHS----LNPNLIVILIIAVFA---WLMTTSMLVTHAVC--IVT 236

Query: 196 GMTQIEAWEMDRIESMFYNR 215
             T +E   M R +   +NR
Sbjct: 237 NTTSVEV--MARRDDSSFNR 254

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLS 138
           +C  CQ+ K  RTHH      CV   DH+C +    +G  N+  F++F F++      L 
Sbjct: 127 WCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVLILM 186

Query: 139 IQ 140
           I 
Sbjct: 187 IS 188

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 13/103 (12%)

Query: 41  IWFQFSLTMIWLSYYKAIYTNPG--SPVPGFQPL-----------KHEWKNYCKKCQNFK 87
           I F   L  + L +++ +Y++PG   P   F  +           K + KN+C +    K
Sbjct: 408 ILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQRK 467

Query: 88  PERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI 130
           P R       ++ VL  DH+CP+  N VG  N   FM ++  +
Sbjct: 468 PLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 70/158 (44%), Gaps = 11/158 (6%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI-- 130
           K++  N+C +    KP R+ +       V   +H+CP+  N +G  N   FM F F +  
Sbjct: 424 KYDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSVQY 483

Query: 131 -ITTTTYLSIQFFKRTWFVWNIRHSTAQ--LVTKKEIIFLTILTPANAFVLLTISILF-- 185
            +    +L +++FK+T  ++      A+   +  + +   +   P+  F+ + IS+ F  
Sbjct: 484 EMFLFMWLCLEYFKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWISMNFVW 543

Query: 186 --GRCIKN--QVLNGMTQIEAWEMDRIESMFYNRRLVP 219
             G  I    Q+  G+T  E + + + E       L+P
Sbjct: 544 LGGMLIVQCFQIFKGITSPELYALIKEERKAEALNLIP 581

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIIT 132
           K +  N+C +    KP R+ +    +  V   DH CP+  N +G  N   F+ F+  ++ 
Sbjct: 472 KFDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVI 531

Query: 133 TT---TYLSIQFFKR 144
                TYL++++F  
Sbjct: 532 GIWEYTYLAMEYFDE 546

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 55/137 (40%), Gaps = 25/137 (18%)

Query: 28  LFVLQGFLSVKQQIWFQFSLTMIWLSYY----KAIYTNPGS-PVPG------------FQ 70
           +F +  F   K ++   F + +I +  Y    K I+++PG  P+                
Sbjct: 388 IFKIAPFTIFKSRLLTNFFMFLILMQIYYLFIKLIFSDPGCVPIETDHENVRGTIKELLD 447

Query: 71  PLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL--- 127
             K + KN+C +    KP R+H        V   DH CP+  N +G  N  +FM F+   
Sbjct: 448 TGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLT 507

Query: 128 -----FWIITTTTYLSI 139
                F+I  T  Y  I
Sbjct: 508 EVGIWFFISLTMKYFDI 524

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 79  YCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL--FWIITTTTY 136
           +C  CQ+ K  RTHH      CV  +DH+C +    +G  N+  F +FL  F +     +
Sbjct: 121 WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIF 180

Query: 137 LSIQFFKR 144
           +S+   +R
Sbjct: 181 VSVVSLQR 188

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 47/108 (43%), Gaps = 16/108 (14%)

Query: 38  KQQIW---FQFSLTMIWLSYYKAIYTNPG---------SPVPGFQPL----KHEWKNYCK 81
           ++ IW   F  S+  +   +YK I +NPG         S     Q L    K + +++C 
Sbjct: 410 EEPIWNSIFGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCL 469

Query: 82  KCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFW 129
           +    KP R+         V   DH+CP+  N +G  N   F+ F+F+
Sbjct: 470 ETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFF 517

>KAFR0F03170 Chr6 complement(627907..629685) [1779 bp, 592 aa] {ON}
           Anc_4.97 YGL023C
          Length = 592

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 9/89 (10%)

Query: 25  SAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYTNPGSPVPGFQPLKHEW-----KNY 79
           SA    L    S+   I   F L  +  SY K    +   P+   QP K  W     +  
Sbjct: 408 SADSMSLHSNNSIYDTIKQNFILKFVP-SYLKDYAASENEPIISIQPTKKHWVPDSQRTN 466

Query: 80  CKKC-QNFKP-ERTHHCKTCAQCVLVMDH 106
           CKKC + F   ER HHC+ C + +   DH
Sbjct: 467 CKKCGKKFTVVERKHHCRHCGE-IFCQDH 494

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 64/146 (43%), Gaps = 14/146 (9%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIIT 132
           K++  N+C +    KP R+ +       V   DH+CP+  N VG  N   F+ F+  + T
Sbjct: 457 KYDTSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILSMET 516

Query: 133 TT---TYLSIQFFKRTWFVWNIRHSTAQLVTKKEII-------FLTILTPANAFVLLTIS 182
                T L +++F +   +++       L+   E+        F  ++   +AF  L +S
Sbjct: 517 GIGLFTSLCLEYFDQLEDLYDDDKLKCLLLGDDELCAGFTHDRFSFLIMAWSAFQFLWVS 576

Query: 183 ILFGRCIKNQVLNGMTQIEAWEMDRI 208
           +L    I  QV      + ++E ++I
Sbjct: 577 LL----IFVQVFQVTKGVTSYEFNKI 598

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL 127
           K + KN+C +    KP R+         V   DH+CP+  N VG  N   FM F+
Sbjct: 464 KFDTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 97/233 (41%), Gaps = 36/233 (15%)

Query: 16  CFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYTNPGSPVPG------- 68
           CFLI F+ ++ +L+    +  + + + F  +  + ++ + K + ++PG            
Sbjct: 370 CFLI-FV-WTKKLYPYSVYDYIMKNVQFLVTSLLTFILFLKLVRSDPGCLKTDDSLISIQ 427

Query: 69  ------FQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPH 122
                  Q  K + +N+C +    KP R+         V   DH CP+  N +G  N   
Sbjct: 428 ETIKQLIQLGKFDRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHK- 486

Query: 123 FMRFLFWIITTTTY------LSIQFFKRTWFVWNIRHSTAQ--LVTKKEIIFLTILTPAN 174
              FLF+ +T   +      L + +FKRT  ++      A+  L   + +   +   P+ 
Sbjct: 487 --LFLFFALTVQYHMFLFMWLCLAYFKRTNHIYEQVDGYARCALFKNETLCKGSNYDPST 544

Query: 175 AFVLLTISI--------LFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVP 219
            F+ + +S+        L  +C   Q+L G+T  E + + + E    +  L+P
Sbjct: 545 FFLFIWVSVNFLWLGAMLIVQCF--QILKGITVPELFILIKEERRAKSFSLIP 595

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 11/121 (9%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIIT 132
           K + +N+C +    KP R+ +       V   DH+CP+  N VG  N      F+F+ +T
Sbjct: 441 KFDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHK---LFVFFAVT 497

Query: 133 TTTY------LSIQFFKRTWFVWNIRHSTAQ--LVTKKEIIFLTILTPANAFVLLTISIL 184
              +      L + +FK+T +++      A+  L+  + +   +   P+  F+ + IS+ 
Sbjct: 498 VQYHMFLFMWLCLAYFKKTNYIYEQVEEYARCALLKNETLCKGSNYDPSTFFLFIWISVN 557

Query: 185 F 185
           F
Sbjct: 558 F 558

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI-- 130
           K + KN+C +    KP R+ +       V   DH CP+  N VG  N  +F+ F+  +  
Sbjct: 467 KFDSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEA 526

Query: 131 -ITTTTYLSIQFFKR 144
            I T   L  ++F  
Sbjct: 527 GIITFASLCFEYFDE 541

>ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL175C
           (AIR2) and YIL079C (AIR1)
          Length = 342

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 41/109 (37%), Gaps = 19/109 (17%)

Query: 74  HEWKNYCKKCQNFKPERTHHCKTCAQ-----CVLVMDH---HCPFTMNCVGYNNFPHFM- 124
           HE +  CK C     +R H  K C       C L+ DH   HCP TM C   N+  H+  
Sbjct: 63  HEAEAKCKNCS----QRGHIKKNCPHVICSYCGLMDDHYSQHCPRTMRCSHCNDSGHYRQ 118

Query: 125 ------RFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFL 167
                 + ++  +  +   S       W  + +R +  + V     IF 
Sbjct: 119 NCPQKWKRIYCTLCNSKKHSRDRCPSVWRSYCLRGAKEKRVLASHKIFC 167

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL 127
           K + KN+C +    KP R+         V   DH+CP+  N VG  N   F+ F+
Sbjct: 465 KFDTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 30/63 (47%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIIT 132
           K + +++C      KP R+   +     ++  DH CP+  N VG  N   F+ FL  +++
Sbjct: 447 KFDTRHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVS 506

Query: 133 TTT 135
             +
Sbjct: 507 GVS 509

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%)

Query: 69  FQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL 127
            Q  K + K++C +    KP R+ +       V   DH+CP+  N VG  N   F+ F+
Sbjct: 461 LQIGKFDTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIIT 132
           K++ +++C +    KP R+         +   DH+CP+  N VG  N   F+ F+  I  
Sbjct: 455 KYDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEV 514

Query: 133 TT---TYLSIQFFKR 144
                 +L +++F  
Sbjct: 515 AVWIFAHLCLEYFDE 529

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 3/75 (4%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI-- 130
           K + KN+C +    KP R+         V   DH+CP+  N +G  N   F+  +  +  
Sbjct: 457 KFDSKNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEI 516

Query: 131 -ITTTTYLSIQFFKR 144
            +    YL +++F  
Sbjct: 517 LMLLFNYLCMEYFDE 531

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFL 127
           K + KN+C +    KP R+         V   DH+CP+  N VG  N   F+ F+
Sbjct: 465 KFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>NCAS0D00460 Chr4 (71070..72020) [951 bp, 316 aa] {ON} Anc_2.84
           YHR144C
          Length = 316

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 29/71 (40%), Gaps = 7/71 (9%)

Query: 58  IYTNPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGY 117
           I  NP   VP   PL+ +W  Y  K       R++  K    CV+V DH    T    GY
Sbjct: 152 IKKNPFENVP---PLRPDWDTYFMKLATLAASRSNCMKRKVGCVIVRDHRVIAT----GY 204

Query: 118 NNFPHFMRFLF 128
           N  P  +   F
Sbjct: 205 NGTPRHLTNCF 215

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI-- 130
           K + K++C       P R+ +       +   DH+CP+  N +G+ N   F+ F+ ++  
Sbjct: 449 KFDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQI 508

Query: 131 -ITTTTYLSIQFFKRTW 146
            +     LSI++F+  W
Sbjct: 509 GVFIFVRLSIRYFELEW 525

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 71/161 (44%), Gaps = 17/161 (10%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIIT 132
           K + +N+C +    K  R+ +       V   DH+CP+  N +G  N  H +  LF+ +T
Sbjct: 435 KFDKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN--HKLS-LFFAMT 491

Query: 133 TTTY------LSIQFFKRTWFVWNI--RHSTAQLVTKKEIIFLTILTPANAFVLLTISIL 184
              +      LS+ +FK+T  ++     ++    +  + +   +   P+  F+ + IS+ 
Sbjct: 492 VQYHMFLFMWLSLAYFKKTNHIYEQVDEYAKCTFLKNETLCKGSNYDPSTFFLFIWISVN 551

Query: 185 F---GRCIKN---QVLNGMTQIEAWEMDRIESMFYNRRLVP 219
           F   G  +     Q+L G+T  E + + + E       L+P
Sbjct: 552 FVWLGAMLSVQFFQILKGITTPELFTLIKEERRAETFNLIP 592

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 13/84 (15%)

Query: 56  KAIYTNPGSPVPG-------------FQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVL 102
           K + ++PG  VP               +  K++ K++C       P R  + +     +L
Sbjct: 411 KLLQSDPGYIVPATDHNQIRATIIELLRVGKYDSKHFCIHSWIRLPLRAKYKRFVHSVIL 470

Query: 103 VMDHHCPFTMNCVGYNNFPHFMRF 126
             DH+CP+  N +G+ N   F+ F
Sbjct: 471 RYDHYCPWIYNYIGFRNHKIFIYF 494

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI 130
           K + +++C +    KP R+ +       +L  DH+CP+  N VG  N   F+ F+  +
Sbjct: 449 KFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILAL 506

>NCAS0A04420 Chr1 complement(892456..893094) [639 bp, 212 aa] {ON}
           Anc_2.453 YKL119C
          Length = 212

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 211 MFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNNRKISFEDLVNFPYDSDPWRNLINC 270
           MF  +  VP L   L EL   + D  + EID +LNN  I  + L+   Y S+ W+N I  
Sbjct: 1   MFDIKLNVP-LKEALGELKEKAKDPLRKEIDTLLNNGYIPMKTLLK--YHSEYWKNQI-- 55

Query: 271 MGPMLTWLNPF 281
             PM   LNP 
Sbjct: 56  --PMRQLLNPI 64

>NDAI0G02790 Chr7 (649288..650244) [957 bp, 318 aa] {ON} Anc_2.84
           YHR144C
          Length = 318

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 28/71 (39%), Gaps = 7/71 (9%)

Query: 58  IYTNPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGY 117
           +  NP   VP   PL+  W  Y  K       R++  K    CV+V DH    T    GY
Sbjct: 154 VKKNPFENVP---PLRPSWDTYFMKLATLAATRSNCMKRKVGCVIVRDHRVIAT----GY 206

Query: 118 NNFPHFMRFLF 128
           N  P  +   F
Sbjct: 207 NGTPRHLTNCF 217

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWI 130
           K + +N+C +    KP R+         V   DH+CP+  N +G  N   F+ F+  +
Sbjct: 456 KFDTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISV 513

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 19/124 (15%)

Query: 48  TMIWLSYYKAIYTNPGSPVP---GFQPLKHEWKNYCK----KCQNF-------KPERTHH 93
           T++ L Y + I+++PG  +P       ++++ +   K     C  F       KP R   
Sbjct: 360 TLLLLCYGRLIFSDPGC-IPEETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIRKPVRCSL 418

Query: 94  CKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRH 153
            K   Q V   DH+C +  N VG  N      ++F++I   T+L + F    W  + +  
Sbjct: 419 SKLNQQQVARFDHYCAWIYNDVGLKNHK---LYIFFLILLETFL-MTFGVLNWRYFGLME 474

Query: 154 STAQ 157
            TA+
Sbjct: 475 KTAE 478

>KNAG0E04010 Chr5 (792199..793347) [1149 bp, 382 aa] {ON} Anc_4.329
           YML066C
          Length = 382

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 28  LFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYTNPGS 64
           +F+L+   S+   +WF  S  +I +  YK  Y NPGS
Sbjct: 224 VFLLEFVASIACTLWFLCSFGVIKICRYKGAYANPGS 260

>Ecym_7098 Chr7 (190468..191766) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii AGR226W
          Length = 432

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 202 AWEMD-RIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNNRKISFEDLVNFPYD 260
           AW+M  ++ S     ++  QLL +L+  YP +      E+++I  +R I + DLV   +D
Sbjct: 325 AWDMSQKLNSGRQFSQIKRQLLKDLQLNYPTTDTSLTSELEKINQDRHILYLDLVRLSFD 384

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 26/60 (43%)

Query: 73  KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIIT 132
           K + K++C      KP R+         V   DH CP+  N +G  N   F+ F+  + T
Sbjct: 445 KFDAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFILCLET 504

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.465 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,166,880
Number of extensions: 2034490
Number of successful extensions: 7100
Number of sequences better than 10.0: 137
Number of HSP's gapped: 7197
Number of HSP's successfully gapped: 137
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 66 (30.0 bits)