Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30316.27ON32832816780.0
KNAG0M012406.27ON3143129831e-133
ZYRO0C07612g6.27ON3192939441e-127
NCAS0H015106.27ON3132959421e-127
SAKL0E01474g6.27ON3112959371e-126
ACL002C6.27ON3292729301e-125
CAGL0E02519g6.27ON3152739261e-124
KAFR0G026506.27ON3213009211e-124
Kpol_1032.96.27ON3182949191e-123
NDAI0F017406.27ON3132899161e-123
KLLA0D01331g6.27ON3083009151e-123
KLTH0C11044g6.27ON3152929101e-122
Kwal_56.224546.27ON3152848981e-120
Smik_15.1686.27ON3273168861e-118
TBLA0E030606.27ON3193218841e-118
Skud_15.1606.27ON3273118841e-118
YOL002C (IZH2)6.27ON3173168821e-118
Suva_15.1736.27ON3272828561e-114
TDEL0G044206.27ON3222898491e-113
TPHA0M002906.27ON3272678261e-109
TPHA0A006403.90ON3272906901e-88
SAKL0C09218g3.90ON3142816846e-88
Suva_2.6683.90ON3153066793e-87
KLTH0C09504g3.90ON3192966725e-86
CAGL0G04631g3.90ON3163196647e-85
Kwal_56.227043.90ON3202856612e-84
Skud_4.7663.90ON3162726584e-84
YDR492W (IZH1)3.90ON3162726552e-83
Smik_4.7693.90ON3162726516e-83
ZYRO0B06556g3.90ON3182766439e-82
Kpol_1053.263.90ON3242736291e-79
TDEL0D053403.90ON3162866178e-78
AFR337W3.90ON3172896161e-77
KLLA0C12441g3.90ON3152916115e-77
KAFR0A081303.90ON3192786116e-77
Ecym_35883.90ON3052695975e-75
NDAI0A071603.90ON3303245892e-73
NCAS0I025703.90ON3142775863e-73
TBLA0B022903.90ON3262895822e-72
KNAG0K021603.90ON3233165716e-71
TBLA0B082553.90ON2963023293e-35
NDAI0G043003.90ON3182743216e-34
NCAS0C049203.90ON3262863182e-33
CAGL0I07491g3.90ON3012862226e-20
Suva_15.643.90ON3122922069e-18
Skud_15.533.90ON3123311901e-15
Smik_15.563.90ON3122991841e-14
YOL101C (IZH4)3.90ON3122891742e-13
KLLA0F15510g5.197ON6222781584e-11
KAFR0J006705.197ON5091811513e-10
Ecym_71095.197ON5681841381e-08
KNAG0B051005.197ON5382511344e-08
KLTH0B03498g5.197ON5462971302e-07
Skud_12.915.197ON5421871273e-07
TBLA0C060505.197ON4372051255e-07
AAL153C5.197ON4193421247e-07
Smik_12.865.197ON5421921247e-07
YLR023C (IZH3)5.197ON5431821221e-06
TDEL0E043205.197ON4501901151e-05
Kpol_2002.945.197ON5771871141e-05
NCAS0D026005.197ON5431891132e-05
KNAG0K006703.90ON3212181122e-05
Suva_10.1045.197ON5411901132e-05
NDAI0I023305.197ON5781841123e-05
TPHA0E031205.197ON5692401095e-05
Kwal_33.151225.197ON5662481087e-05
CAGL0D03322g5.197ON5451821015e-04
ZYRO0B10538g5.197ON531185980.001
SAKL0G12980g5.197ON563197910.008
Skud_4.373singletonON18665683.2
Kpol_397.68.366ON58586694.6
TDEL0H008001.200ON46949684.6
TBLA0B043008.599ON135049677.8
KAFR0E024407.50ON98794678.0
KAFR0C014603.90ON21999658.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3031
         (328 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   650   0.0  
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   383   e-133
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   368   e-127
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   367   e-127
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   365   e-126
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   362   e-125
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   361   e-124
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   359   e-124
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   358   e-123
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      357   e-123
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   357   e-123
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   355   e-122
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   350   e-120
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   345   e-118
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   345   e-118
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   345   e-118
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   344   e-118
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   334   e-114
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   331   e-113
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   322   e-109
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   270   1e-88
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   268   6e-88
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   266   3e-87
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   263   5e-86
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   260   7e-85
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   259   2e-84
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   258   4e-84
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   256   2e-83
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   255   6e-83
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   252   9e-82
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   246   1e-79
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   242   8e-78
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   241   1e-77
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   239   5e-77
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   239   6e-77
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   234   5e-75
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   231   2e-73
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   230   3e-73
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   228   2e-72
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   224   6e-71
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             131   3e-35
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    128   6e-34
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   127   2e-33
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    90   6e-20
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    84   9e-18
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    78   1e-15
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    75   1e-14
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    72   2e-13
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    65   4e-11
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    63   3e-10
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    58   1e-08
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    56   4e-08
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    55   2e-07
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    54   3e-07
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    53   5e-07
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    52   7e-07
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    52   7e-07
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    52   1e-06
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    49   1e-05
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    49   1e-05
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    48   2e-05
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    48   2e-05
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    48   2e-05
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     48   3e-05
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    47   5e-05
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    46   7e-05
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    44   5e-04
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    42   0.001
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    40   0.008
Skud_4.373 Chr4 (651175..651735) [561 bp, 186 aa] {ON} YDR112W (...    31   3.2  
Kpol_397.6 s397 (19242..20999) [1758 bp, 585 aa] {ON} (19242..20...    31   4.6  
TDEL0H00800 Chr8 (135222..136631) [1410 bp, 469 aa] {ON} Anc_1.2...    31   4.6  
TBLA0B04300 Chr2 complement(994891..998943) [4053 bp, 1350 aa] {...    30   7.8  
KAFR0E02440 Chr5 complement(494552..497515) [2964 bp, 987 aa] {O...    30   8.0  
KAFR0C01460 Chr3 (300109..300768) [660 bp, 219 aa] {ON} Anc_3.90...    30   8.2  

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/328 (96%), Positives = 316/328 (96%)

Query: 1   MAQQQVFQRKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRD 60
           MAQQQVFQRKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRD
Sbjct: 1   MAQQQVFQRKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRD 60

Query: 61  NEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTT 120
           NEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTT
Sbjct: 61  NEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTT 120

Query: 121 WKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYY 180
           WKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYY
Sbjct: 121 WKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYY 180

Query: 181 GFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXX 240
           GFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFG           
Sbjct: 181 GFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGLSSILPILASI 240

Query: 241 XYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVI 300
            YYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVI
Sbjct: 241 LYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVI 300

Query: 301 AALCHFKAVTQSYELVHFRLNEAVQLKL 328
           AALCHFKAVTQSYELVHFRLNEAVQLKL
Sbjct: 301 AALCHFKAVTQSYELVHFRLNEAVQLKL 328

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  383 bits (983), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 180/312 (57%), Positives = 228/312 (73%), Gaps = 1/312 (0%)

Query: 15  TSSLAGKNRTLETSVIFEDLN-QATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETN 73
           +S +  +  T+   V++ED   +  T   K   ++++W+EIPEWQ+DNEHI+ GYV+ETN
Sbjct: 2   SSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETN 61

Query: 74  SFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVG 133
           SF + +HSL YLHNESVN+Y+HLIP +CFF VLFLNKY +  F+TT+  DY  ID FF+G
Sbjct: 62  SFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLG 121

Query: 134 AFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFS 193
           AF CL++S T+HC KSHS  V+  GN+LDY+GIV+LI TSM S+LYYGFY+SS MFY FS
Sbjct: 122 AFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFS 181

Query: 194 GVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQ 253
            VTL  GT C VV+L   FRSR WRPYRA +FVAFG             YG EE ++ +Q
Sbjct: 182 FVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQ 241

Query: 254 LGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSY 313
           + WIILEGV YI GAF+YGIRFPE  +PG +DIWGHSHQ+FH+LVV+AALCH K +  SY
Sbjct: 242 IKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSY 301

Query: 314 ELVHFRLNEAVQ 325
           ELVH  L+ A +
Sbjct: 302 ELVHKGLSSATK 313

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 169/293 (57%), Positives = 213/293 (72%), Gaps = 5/293 (1%)

Query: 33  DLNQA-TTIPLKPASK----LFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHN 87
           ++NQ  TTI ++P +     L++W+EIP+WQ+DNEHI+GGYV+ETNS +E L SLLYLHN
Sbjct: 22  EVNQEQTTIKIEPVNTQKKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHN 81

Query: 88  ESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCL 147
           ES+NIYTH +PG+CF      +K+ I  F TTTW DY  ID FF GAF+CL++S T+HC 
Sbjct: 82  ESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCF 141

Query: 148 KSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVT 207
           KSHS  VS+ GN+LDY+GIVILI  SM S+LYY F++S+K+FY F+ +    G  CT+ +
Sbjct: 142 KSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIAS 201

Query: 208 LDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFG 267
            D  FRSR WRPYRA +FVAFG             YG  ETW  +Q+ W+ILEG+ YIFG
Sbjct: 202 FDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFG 261

Query: 268 AFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320
           AF+Y IRFPE +APG+FD  GHSHQ+FHVLVVIAALCH  A+  SYELVH  L
Sbjct: 262 AFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 214/295 (72%), Gaps = 5/295 (1%)

Query: 26  ETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL 85
           + +V  +   + TTI      KL++W EIPEWQ+DNEHI+ GYV+ETNSF+    SL Y+
Sbjct: 24  DDNVSIKHTKKTTTI-----RKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYI 78

Query: 86  HNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYH 145
           HNE+ N+Y+HL+PGV FF  +  +KY I  F+TTT+ DY II+ FF+GAF CL++S T+H
Sbjct: 79  HNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFH 138

Query: 146 CLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTV 205
           C KSHS  ++  GN+LDY+GIV+LI TSM S+L+YGFY++   FYGFS +TL  G+ C +
Sbjct: 139 CFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAI 198

Query: 206 VTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYI 265
           V+L  +FRSR WRPYRA +FVAFG            YYG  ETW  +QL W++LEGV YI
Sbjct: 199 VSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYI 258

Query: 266 FGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320
           FGAF+YGIRFPE    G+FDIWGHSHQ+FH+LVV+AA CH KA+  SYELVH  L
Sbjct: 259 FGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  365 bits (937), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 165/295 (55%), Positives = 214/295 (72%)

Query: 26  ETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL 85
             +++ E+     TI  K   +L+SW EIP+WQ+DNEHI  GYV+ETNSF     SL Y+
Sbjct: 14  RANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYM 73

Query: 86  HNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYH 145
           HNESVNIYTHL+PG+CFF V+  +K  I  F TTT+ DY ++D FF+GAF CL++S T+H
Sbjct: 74  HNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFH 133

Query: 146 CLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTV 205
           CLK+HS  ++I+GN+LDY+GIV LI +SM S++YYGF++S K FYGFS +TL+ G  C +
Sbjct: 134 CLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAI 193

Query: 206 VTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYI 265
            +L   FRSR WRPYRA++FVAFG             YG +ETW  VQ+ W++L GV YI
Sbjct: 194 ASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYI 253

Query: 266 FGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320
            GA +Y +R PE ++PG FDIWGHSHQ+FH+LVVIAALCH KAV  SYELVH +L
Sbjct: 254 IGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKL 308

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/272 (61%), Positives = 202/272 (74%)

Query: 46  SKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCV 105
           S L SW ++P+WQ+DNEHIL GYV+ETNS+++T  SL YLHNESVNIY+HLIPG+CF  +
Sbjct: 50  SSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFI 109

Query: 106 LFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIG 165
              NKYV++ + TTTWKDY +ID F +GA  CL +SG YHC+KSHS  VS+ GN+LDYIG
Sbjct: 110 ALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIG 169

Query: 166 IVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIF 225
           IV LIS SM S +YYGFY+S+ MF  FS VTL L   C VV+L   FRSR WR YRA+IF
Sbjct: 170 IVALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIF 229

Query: 226 VAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFD 285
            AFG            YYG  E ++ +QL W+ LEGVLYI GA +YG+RFPE + PGSFD
Sbjct: 230 TAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFD 289

Query: 286 IWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
           IWGHSHQLFHVLVVIAALCH +A+   Y+ VH
Sbjct: 290 IWGHSHQLFHVLVVIAALCHLRALLSCYKNVH 321

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  361 bits (926), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 165/273 (60%), Positives = 204/273 (74%)

Query: 47  KLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVL 106
           KL++W EIPEWQ+DNEHI  GYV+ET+S  E + SL YLHNE+VNIY+HLIP + FF  +
Sbjct: 37  KLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTI 96

Query: 107 FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGI 166
           F NKYV+  + TTT  DY IID FF+GAF+CL++S T+HCLKSHS  V++ GN+LDY+GI
Sbjct: 97  FFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGI 156

Query: 167 VILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFV 226
           V LI  SM S+LYYGF+ +   F  FS +T+  G  C VV+L   FRSR WRPYRA++FV
Sbjct: 157 VFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFV 216

Query: 227 AFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDI 286
            FG             YG  ETW  +QL W+ILEGV YIFGAF+YGIRFPE M+PGSFD+
Sbjct: 217 IFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDL 276

Query: 287 WGHSHQLFHVLVVIAALCHFKAVTQSYELVHFR 319
           WGHSHQ+FH+LVV+AALCH KA+  SY LVH+R
Sbjct: 277 WGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 215/300 (71%), Gaps = 4/300 (1%)

Query: 22  NRTLETSVIFEDL---NQATTI-PLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKE 77
            R +     F+D+   N+  TI  L+   +L++W+EIP+WQ+DNEHI+ GYVKETNSF  
Sbjct: 10  TRKVTIDTAFQDVVEQNKGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFS 69

Query: 78  TLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFAC 137
            + SL YLHNESVN+Y+HLIP VCF     LNK ++ +F+TTT  DY  ID FF+GAF C
Sbjct: 70  CIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTC 129

Query: 138 LVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTL 197
           L++S T+HC KSHS  ++  GN+LDY+GIV+LISTSM SLLYYGFY++  +FY F+ +TL
Sbjct: 130 LILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITL 189

Query: 198 LLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWI 257
             G  C  V+L  +FRSR  R YRA++FV FG            +YG   TW+ +QL W+
Sbjct: 190 SFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWV 249

Query: 258 ILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
           +LEGV YIFGAF+YGIRFPE   PG +DIWGHSHQLFH+LVVIAALCHFKA+  SYE VH
Sbjct: 250 LLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  358 bits (919), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 213/294 (72%)

Query: 32  EDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVN 91
           +D  +++   +K   +L +W  +P+WQ+DNEHIL GYVKETNS K  LHSLL++HNESVN
Sbjct: 25  KDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVN 84

Query: 92  IYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHS 151
           I++HL+P  CF   +  +KYV+ R+ TTT KDY ++D F  GAF CL+MS  +HCLK+HS
Sbjct: 85  IFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHS 144

Query: 152 YPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSR 211
             VS  GN+LDY+GIV+LI +SM S+LYYGFY++S +++ FS +T   G  C VV+L  R
Sbjct: 145 PYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGER 204

Query: 212 FRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIY 271
           FR+R WRPYRA++FVAFG            YYG +ET   VQL W++LEGV YIFGA +Y
Sbjct: 205 FRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLY 264

Query: 272 GIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAVQ 325
           G+RFPE + PG FDIWGHSHQLFH+LVV+AALCH + +  SY +VH RL+   Q
Sbjct: 265 GVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ 318

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  357 bits (916), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 208/289 (71%)

Query: 32  EDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVN 91
           ++ +    +  K   KL+ W EIPEWQ+DNEHI+ GYV+ETNSFK  LHSL Y+HNES N
Sbjct: 25  DNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGN 84

Query: 92  IYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHS 151
           +Y+HL+PGV FF  + LNKY I+ + TT+  DY +ID FF GAF CL++S  +HC KSHS
Sbjct: 85  VYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHS 144

Query: 152 YPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSR 211
             V+ +GN+LDY+GIVILI TSM S++Y+GF+++   FY FS +T L G  C  V+L   
Sbjct: 145 LKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYFFSSLTFLFGGACATVSLKDH 204

Query: 212 FRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIY 271
           FRSR WRPYRA +FVAFG            YYG EET+  +QL WIILEG  YIFGAF+Y
Sbjct: 205 FRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLY 264

Query: 272 GIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320
           G+RFPE   PGSFDIWGHSHQ+FH+LVV+AA CH + +  SYE+VH RL
Sbjct: 265 GVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  357 bits (915), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 172/300 (57%), Positives = 218/300 (72%), Gaps = 2/300 (0%)

Query: 24  TLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLL 83
           T ET++I E      T+ +    +++SW EIP+WQ+DNEHIL GYV+ET S+KE  HSL 
Sbjct: 10  TEETALIEETPGTKKTVRVY-ERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLF 68

Query: 84  YLHNESVNIYTHLIPGVC-FFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSG 142
           YLHNESVNIYTHLIP V  FF +LF   +VI+ + TT+  DY +I+ FF G   CL MS 
Sbjct: 69  YLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSS 128

Query: 143 TYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTI 202
            +H +K HS P++  GN+LDY+GIV+LISTSM S+L+YGF++SS +FY F+G+T L G I
Sbjct: 129 MFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLI 188

Query: 203 CTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGV 262
           C  ++L  +FRSR WRPYRA++FV FG             YG +ETW  VQL W+I EGV
Sbjct: 189 CGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGV 248

Query: 263 LYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNE 322
           LYIFGAF+YG+RFPE +APG FDIWGHSHQLFHVLVV+AALCH KA+  SY LVH  L++
Sbjct: 249 LYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVHQALSQ 308

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 164/292 (56%), Positives = 210/292 (71%), Gaps = 4/292 (1%)

Query: 26  ETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL 85
           E S + +D N    +  +   +L++W EIPEWQRDNEHI+GGY+ ET S  E L SLLYL
Sbjct: 23  ENSSLLKDSN----LKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYL 78

Query: 86  HNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYH 145
           HNESVNIYTHL+PG CF  V   N+ VI +F+TT   DY +ID FF+G F CL+MS  +H
Sbjct: 79  HNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFH 138

Query: 146 CLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTV 205
           C K HS PV+I+GN+LDY+GIV L+ TS+ S+L+YGF++    F+ FSG+T+  G  C  
Sbjct: 139 CFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACAT 198

Query: 206 VTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYI 265
           V+L ++FRSR WRPYRAS+FVAFG            +YG +ETW  +QL W++L GV YI
Sbjct: 199 VSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYI 258

Query: 266 FGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
            GA +YGIRFPE MAPG FDIWGHSHQLFH+LVV+AALCH +A+  +Y+L H
Sbjct: 259 LGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  350 bits (898), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 159/284 (55%), Positives = 205/284 (72%)

Query: 34  LNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIY 93
           L   + I  +   +L+ W EIPEWQ+DNEHIL GY+ ET S    L SLLYLHNESVNIY
Sbjct: 27  LLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIY 86

Query: 94  THLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYP 153
           THLIPG CF  +   N+  I R++TT   DY +ID FF+G F CL+MS T+HC K HS P
Sbjct: 87  THLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLP 146

Query: 154 VSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFR 213
           V+++GN+LDY+GIV L+ TSM S+L+YGF++++  FY FSG+T++ G  CT+V+L  +FR
Sbjct: 147 VAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFR 206

Query: 214 SRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGI 273
           SR WRPYRA++FVAFG            +YG + TW  +QL W+ LEGV YI GA +YG+
Sbjct: 207 SRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGV 266

Query: 274 RFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
           RFPE +APG+FDIWG SHQLFHVLVVIAA CH +A+  +Y+ VH
Sbjct: 267 RFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVH 310

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  345 bits (886), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 163/316 (51%), Positives = 215/316 (68%), Gaps = 9/316 (2%)

Query: 9   RKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGY 68
           + +Q+     AGK     TS    ++ +A     K   +L+SW EIPEWQRDN+ IL GY
Sbjct: 19  KSVQELKKRAAGK-----TSANPAEVAEAK----KVLKRLYSWDEIPEWQRDNDFILHGY 69

Query: 69  VKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIID 128
           V+ET+SF ET  SL YLHNESVNIY+HL+P + FF VL L+K  I  F+TTTWKD+ +ID
Sbjct: 70  VRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVID 129

Query: 129 TFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKM 188
            F+ GAFACL++S ++HCLKSHS  ++ +GN+LDY+GI ILI TSM S+L+YG+Y    +
Sbjct: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSL 189

Query: 189 FYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEET 248
           F  F+ +T+  G  C++V+L  +FR R WRPYRA +FV FG             Y   E 
Sbjct: 190 FCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEI 249

Query: 249 WNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKA 308
           W  +QL W++L GVLYI GA +YG+RFPE + PG FDIWGHSHQLFH LVVIA+LCH + 
Sbjct: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRG 309

Query: 309 VTQSYELVHFRLNEAV 324
           +  SYELVH ++   +
Sbjct: 310 LLNSYELVHIKMESGI 325

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  345 bits (884), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 211/321 (65%), Gaps = 8/321 (2%)

Query: 5   QVFQRKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHI 64
           +V +RK+  +T             +++ D  Q          +L++W EIP WQ DNE+I
Sbjct: 4   EVQRRKLTSSTEE--------GVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYI 55

Query: 65  LGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDY 124
             GYV+ETNS KE+  SL Y+HNESVNIYTHLIP  CF  +L  N Y +    TTT+ DY
Sbjct: 56  YTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDY 115

Query: 125 AIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYN 184
             ID FF+GAF CL +S T+HC KSHS  +S+ GN+LDY+GIVILISTS+ S+LY+G+++
Sbjct: 116 VAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHD 175

Query: 185 SSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYG 244
              +FY FSG+TL  G  C + +L  +FR+R WRPYRA++FV FG             YG
Sbjct: 176 DPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYG 235

Query: 245 SEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALC 304
             E +  VQL WII EGVLYIFGAF+YG RFPE   PG  DIWG SHQ+FHVLVVIAALC
Sbjct: 236 IREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALC 295

Query: 305 HFKAVTQSYELVHFRLNEAVQ 325
           H + +  SYELVH +L+  +Q
Sbjct: 296 HLRGLIGSYELVHQKLDAQLQ 316

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  345 bits (884), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/311 (52%), Positives = 211/311 (67%), Gaps = 11/311 (3%)

Query: 25  LETSVIFEDLNQ--ATTIPLKPAS---------KLFSWHEIPEWQRDNEHILGGYVKETN 73
           LE +   ++L +  A   P  PA          +L+SW EIPEWQRDN++IL GYV+ET 
Sbjct: 15  LERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGYVRETC 74

Query: 74  SFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVG 133
           SF ET  SL Y+HNESVNIY+HLIP + FF VL L+K  I  F+TTTWKD+ IID F+ G
Sbjct: 75  SFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSG 134

Query: 134 AFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFS 193
           AFACL++S ++HCLKSHS  ++ +GN+LDY+GI ILI TSM S+LYYG+Y    +F  F+
Sbjct: 135 AFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFCLFA 194

Query: 194 GVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQ 253
            +T+  G  C++VTL  +FR R WRPYRA +FV FG             Y   E W  +Q
Sbjct: 195 LITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQ 254

Query: 254 LGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSY 313
           L W++L GVLYI GA +YG+RFPE + PG FDIWGHSHQLFH LVVIA+ CH + +  SY
Sbjct: 255 LFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSY 314

Query: 314 ELVHFRLNEAV 324
           ELVH ++   +
Sbjct: 315 ELVHLKMEGKI 325

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  344 bits (882), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 213/316 (67%), Gaps = 9/316 (2%)

Query: 9   RKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGY 68
           + +Q+     AGK     TS    ++ +A     K   +L+SW EIPEWQRDN+ IL GY
Sbjct: 9   KSVQELKKRAAGK-----TSANPAEVAKAK----KVLRRLYSWDEIPEWQRDNDFILHGY 59

Query: 69  VKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIID 128
           VKET+SF ET  SL YLHNESVNIY+HLIP + FF VL L+K  I  F TTTW D+ +ID
Sbjct: 60  VKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVID 119

Query: 129 TFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKM 188
            F+ GAFACL++S ++HCLKSHS  ++ +GN+LDY+GI ILI TSM S+LYYG++    +
Sbjct: 120 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSL 179

Query: 189 FYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEET 248
           F  F+ +T+  G  C++V+L  +FR R WRPYRA +FV FG             Y   E 
Sbjct: 180 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEI 239

Query: 249 WNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKA 308
           W  +QL W++L GVLYI GA +YG+RFPE + PG FDIWGHSHQLFH LVVIAALCH + 
Sbjct: 240 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRG 299

Query: 309 VTQSYELVHFRLNEAV 324
           +  SYELVH ++   +
Sbjct: 300 LLNSYELVHIKMENGI 315

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  334 bits (856), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 202/282 (71%)

Query: 43  KPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCF 102
           K   +++SW EIPEWQRDN++IL GYVKET+SF +T  SL Y+HNESVNIY+HLIP V F
Sbjct: 44  KVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGF 103

Query: 103 FCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLD 162
             VL L+K  I+ F+TTTW D+ +ID FF GAFACL++S ++HC KSHS  ++ +GN+LD
Sbjct: 104 LTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLD 163

Query: 163 YIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRA 222
           Y+GI ILI TSM S+LYYG+Y+    F  F+ +T+  G  C++V+L  +FR R WRPYRA
Sbjct: 164 YLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRA 223

Query: 223 SIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPG 282
            +FV FG            YY   E WN +QL W++L G LYI GA +YG+RFPE + PG
Sbjct: 224 GLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPG 283

Query: 283 SFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAV 324
            FDIWGHSHQLFH LVVIA+LCH + V  SYELVH ++   +
Sbjct: 284 RFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQNGI 325

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  331 bits (849), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 153/289 (52%), Positives = 199/289 (68%)

Query: 35  NQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYT 94
            Q T    K   KL++W EIP WQRDNEHIL GYV ET S  +   SL YLHNESVNIYT
Sbjct: 32  GQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYT 91

Query: 95  HLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPV 154
           HL+PG+ F  VL  +K+ +++F+TTT  DY +ID F + +F CL +S  +HCLK+HS  V
Sbjct: 92  HLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSV 151

Query: 155 SIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRS 214
           +  GN+LDY+GIV+L+ TSM S++YYGF+ +  +FY FS +T   G  C VV+L   FR+
Sbjct: 152 ATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRT 211

Query: 215 RLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIR 274
           R WRPYRA++FVAFG            YYG  E +  +Q+ W++L G+ YI GA +YG+R
Sbjct: 212 REWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVR 271

Query: 275 FPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEA 323
           FPE  APG +DIWGHSHQLFHVLVV+AALCH   + +SY LVH ++  A
Sbjct: 272 FPEKYAPGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYNLVHLKMAIA 320

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  322 bits (826), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 146/267 (54%), Positives = 193/267 (72%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNK 110
           W ++P+WQ+DNEHI  GYVKETNSF     SL +LHNESVNIY+H++PG+C   +L ++ 
Sbjct: 56  WDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDI 115

Query: 111 YVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILI 170
            +I +F TTT+ DY +ID F  GAF+CL++S  +H LKSHS  V+I GN+LDY+GIVILI
Sbjct: 116 NIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILI 175

Query: 171 STSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGX 230
            TSM S+LYYGFY++   F+ FS +T+L G  C  V+L ++FRSR WRPYRA++FV FG 
Sbjct: 176 VTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGL 235

Query: 231 XXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHS 290
                      YYG E+T+  +QL WI+ EG  YIFGAF+Y +R+PE + PG+FD+WGHS
Sbjct: 236 SAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHS 295

Query: 291 HQLFHVLVVIAALCHFKAVTQSYELVH 317
           HQ+FHV VVIAA  HF  +  +YE  H
Sbjct: 296 HQIFHVFVVIAAYSHFHGLLSAYEYAH 322

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  270 bits (690), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 187/290 (64%), Gaps = 2/290 (0%)

Query: 34  LNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIY 93
           L ++T I    + KL+S+HE+PEWQ+DNE I+ GYV+ETNS+ +  HSL Y HNES+NIY
Sbjct: 31  LLESTEIVETYSKKLYSFHELPEWQKDNELIIQGYVRETNSWFKCFHSLSYFHNESINIY 90

Query: 94  THLIPGVCFFCVL--FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHS 151
           THLIPG+ +F +L  + +  V+  F +TT  DY +ID + +GAF CLV S  +HCLK HS
Sbjct: 91  THLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFYLLGAFICLVGSSCFHCLKQHS 150

Query: 152 YPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSR 211
              S   +++DY+GI+ LIS S+ SLLYYG+++    F  F+ +TL+L TICTV  LD R
Sbjct: 151 EDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYFKVFTLITLILATICTVCVLDER 210

Query: 212 FRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIY 271
           F ++ +RP RA  FV F              +   E  N +QL ++  E   Y+ GA +Y
Sbjct: 211 FNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVINRIQLRFVGWETFFYVVGALLY 270

Query: 272 GIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLN 321
           G R PE  APG FD+ G SHQ+FHV+VVI +L H KAV  SYE +H  LN
Sbjct: 271 GYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVIGSYEFMHKSLN 320

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  268 bits (684), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 186/281 (66%), Gaps = 2/281 (0%)

Query: 43  KPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCF 102
           K   +L ++ E+P+WQ+DNE IL GYV+ET S  E   SLLY HNE+VNIYTHL+PGV +
Sbjct: 26  KGRKRLCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNETVNIYTHLVPGVTY 85

Query: 103 FCVL-FLNKYV-ISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQ 160
             +L FL  ++ I +F ++T  DY II+ F +GAF CL+ S  +HCLK HS   S + ++
Sbjct: 86  LLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSK 145

Query: 161 LDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPY 220
           +DY+GI++LIS SM S+LYYGF++    F  F+ VT++LG+ C    L+ RF S+ +R +
Sbjct: 146 VDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAFVLNDRFNSKNFRVF 205

Query: 221 RASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMA 280
           RAS FV+FG             +G  E+ + VQL ++ LE V YI GA  YG R PE+  
Sbjct: 206 RASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIGGAVFYGFRIPENFG 265

Query: 281 PGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLN 321
           PG FD+ GHSHQ+FHV+VV+ +LCH +AV  SY  +H  +N
Sbjct: 266 PGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHTGVN 306

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  266 bits (679), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 193/306 (63%), Gaps = 2/306 (0%)

Query: 14  ATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETN 73
           AT     +N   +TS   +     + + L+    L  +HE+P+WQRDN+ IL GYV+ET 
Sbjct: 5   ATRRRNQENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETL 64

Query: 74  SFKETLHSLLYLHNESVNIYTHLIPGVCFFC--VLFLNKYVISRFKTTTWKDYAIIDTFF 131
           S+K+ L+SL Y +NE+VNIYTHL+P + +F   V   N ++I  F +TTW DY +I+ F 
Sbjct: 65  SWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFL 124

Query: 132 VGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYG 191
           +GAF CL+ S  +HC+K HS   S   ++LDY+GI+ LIS SM  ++Y+G+++ +  F  
Sbjct: 125 MGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSL 184

Query: 192 FSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNS 251
           F+ VTL+L T CT+  L  +F +  +RP+RA  F+ FG             +G +   N 
Sbjct: 185 FTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNR 244

Query: 252 VQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQ 311
           +++ ++  E + YI GA IYG R PE++APG FD +G SHQ+FH++VV+ ++CH KA+  
Sbjct: 245 IRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIID 304

Query: 312 SYELVH 317
           SY+L+H
Sbjct: 305 SYKLMH 310

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  263 bits (672), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 184/296 (62%), Gaps = 4/296 (1%)

Query: 35  NQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYT 94
               T P K  + L  + E+P+WQRDN+ IL GYV+ETNS K+   SL Y HNE+VNIYT
Sbjct: 23  TSGATAPGK--NGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYT 80

Query: 95  HLIPGVCFFCVL--FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSY 152
           HLIP   +  +L  F + ++I +F TTT  DY +I+ F +GAF CL+ S  +HCLK HS 
Sbjct: 81  HLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSE 140

Query: 153 PVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRF 212
             S + +++DY+GI++LIS S  SLLYYGFY+    F  F+   ++LG+ C    L+ RF
Sbjct: 141 AQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRF 200

Query: 213 RSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYG 272
            ++ WR  RA  FV FG             +G  E+   VQL +++LE + YI GA IYG
Sbjct: 201 NAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYG 260

Query: 273 IRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAVQLKL 328
            R PE++ PG FD  GHSHQ+FH+LVV+ +LCHF+A+  SY  +H  ++    L L
Sbjct: 261 FRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTGISSPGLLNL 316

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  260 bits (664), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 195/319 (61%), Gaps = 12/319 (3%)

Query: 1   MAQQQVFQRKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRD 60
           M+     +++  K+     G+N          D +       K    L+ ++E+PEWQ+D
Sbjct: 1   MSATTTLRKRASKSVGESGGRN----------DGSIHAHGEEKSEKLLWHFNELPEWQKD 50

Query: 61  NEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCV-LFL-NKYVISRFKT 118
           N+ IL GYV+ETNSFK  L SLLYL+NESVNIYTHLIP V +  + L+L N ++I  + +
Sbjct: 51  NDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPS 110

Query: 119 TTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLL 178
           T+  DY II+ FF+GAF CL+ S  +HC+K HS     V ++LDY+GI+ LIS S   ++
Sbjct: 111 TSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMI 170

Query: 179 YYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXX 238
           YYG+++    F  F+G+TLLL   C+V  L  +F +  +RP RAS F  FG         
Sbjct: 171 YYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGA 230

Query: 239 XXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLV 298
               +G+E     + L +I LE + YI GA IYG RFPE++APG FD +G SHQ+FH++V
Sbjct: 231 GFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMV 290

Query: 299 VIAALCHFKAVTQSYELVH 317
           V+ ++CH  A+ +SY L+H
Sbjct: 291 VLGSICHLFAMVESYHLIH 309

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  259 bits (661), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 128/285 (44%), Positives = 180/285 (63%), Gaps = 2/285 (0%)

Query: 46  SKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCV 105
           S L  + E+PEWQRDNE IL GYV+ET S ++ L SL Y HNE++NIYTHLIP   +  +
Sbjct: 33  SALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLNIYTHLIPSGTYLVL 92

Query: 106 L--FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDY 163
           L  F + ++I  F +TT  DY +I+ + +GAF CL+ S  +HCLK HS   S + +++DY
Sbjct: 93  LMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQHSEAQSNIWSKVDY 152

Query: 164 IGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRAS 223
           +GI++LIS S  SLLYYGF++    F  F+   ++LG+ C    L+ RF ++ WR  RA 
Sbjct: 153 MGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAG 212

Query: 224 IFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGS 283
            FV FG             +G  E+   VQL +++LE   YI GA IYG R PE++ PG 
Sbjct: 213 FFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAIIYGFRIPETLIPGK 272

Query: 284 FDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAVQLKL 328
           FD  GHSHQ+FH+LVV+ +LCHF+A+  SY  +H  ++ +  L L
Sbjct: 273 FDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHTGISSSSLLNL 317

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  258 bits (658), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 179/272 (65%), Gaps = 2/272 (0%)

Query: 48  LFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFF--CV 105
           L ++ E+PEWQ+DN+ IL GYV+ET S+K+ L SL Y +NE+VNIYTHL+P + +F   +
Sbjct: 40  LHNFDELPEWQKDNDKILTGYVRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAI 99

Query: 106 LFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIG 165
              N ++I  F +T+W DY +I+ F +GAF+CL+ S  +HCLK HS   S   ++LDY+G
Sbjct: 100 TLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLG 159

Query: 166 IVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIF 225
           I+ LIS SM  ++Y+G+++    F  F+ VTL+L T CTV  L  +F +  +RP+RA  F
Sbjct: 160 IISLISCSMIPIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFF 219

Query: 226 VAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFD 285
           + FG             +G +   N +++ ++  E + YI GA IYG R PE++APG FD
Sbjct: 220 ILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFD 279

Query: 286 IWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
             G SHQ+FH++VV+ +LCH KA+  SY+L+H
Sbjct: 280 FLGSSHQIFHIMVVLGSLCHLKAIIDSYKLMH 311

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  256 bits (655), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 181/272 (66%), Gaps = 2/272 (0%)

Query: 48  LFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFF--CV 105
           L ++ E+PEWQ+DN+ IL GYV+ET S+K+ L+SL Y +NE+VNIYTHL+P + +F   +
Sbjct: 40  LHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAI 99

Query: 106 LFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIG 165
              N ++I  F +T+W DY +I+ F +GAF+CL+ S  +HC+K HS   S   ++LDY+G
Sbjct: 100 TLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLG 159

Query: 166 IVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIF 225
           I+ LIS SM  ++Y+G+++    F  F+ VTL+L T CTV  L  +F +  +RP+RA  F
Sbjct: 160 IISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFF 219

Query: 226 VAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFD 285
           + FG             +G +   N +++ ++  E + YI GA IYG R PE++APG FD
Sbjct: 220 ILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFD 279

Query: 286 IWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
            +G SHQ+FH++VV+ ++CH KA+  SY+L+H
Sbjct: 280 FFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMH 311

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  255 bits (651), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 119/272 (43%), Positives = 180/272 (66%), Gaps = 2/272 (0%)

Query: 48  LFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFF--CV 105
           L ++ E+PEWQ+DN+ IL GYV+ET S+K+ L+SL Y +NE+VNIYTHL+P V +F   +
Sbjct: 40  LHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAI 99

Query: 106 LFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIG 165
              N ++I  F +T+W DY +I+ F +GAF+CL+ S  +HC+K HS   S   ++LDY+G
Sbjct: 100 TLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLG 159

Query: 166 IVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIF 225
           I+ LIS SM  ++Y+G+++    F  F+ VTL+L T CTV  L  +F +  +RP+RA  F
Sbjct: 160 IISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFF 219

Query: 226 VAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFD 285
           + FG             +G +   N +++ ++  E + YI GA IYG R PE++APG FD
Sbjct: 220 ILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFD 279

Query: 286 IWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
             G SHQ+FH++VV+ ++CH KA+  SY+L+H
Sbjct: 280 FLGSSHQIFHIMVVLGSICHLKAIIGSYKLMH 311

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  252 bits (643), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 124/276 (44%), Positives = 176/276 (63%), Gaps = 2/276 (0%)

Query: 48  LFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLF 107
           L+ +HE+PEWQ+DN+ IL GY++ET S  + + SL   +NE+VNIYTHL+  V +F ++ 
Sbjct: 32  LYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFLLML 91

Query: 108 --LNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIG 165
              +  ++  F T+T+ DY++I+ + +GAF CL+ S  +H  K HS P S   +++DY+G
Sbjct: 92  GITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMG 151

Query: 166 IVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIF 225
           I++LI+ SM SL+YYGF++  + F  F+ +TL L T CTV  L  +F  + +RP RA  F
Sbjct: 152 IIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRAGFF 211

Query: 226 VAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFD 285
           +AFG             +G +     VQL ++ LE + YI GA IYG R PE+M PG FD
Sbjct: 212 IAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPGRFD 271

Query: 286 IWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLN 321
            WGHSHQ+FHVLVVIA+  H KAV  SY   H  LN
Sbjct: 272 FWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHLN 307

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  246 bits (629), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 120/273 (43%), Positives = 175/273 (64%), Gaps = 2/273 (0%)

Query: 47  KLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVL 106
           KL  +HE+P+WQ+DNE IL GYV+ETNS K+ L SL   +NES+NIY+HLI  + +F VL
Sbjct: 40  KLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVL 99

Query: 107 --FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYI 164
             + +   I  F +TT+ DY +ID + +GAF CL+ S  +HC+K HS   S + +++DYI
Sbjct: 100 LFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYI 159

Query: 165 GIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASI 224
           GI+ LI+ S+ SLLYYG+ +    F  F+ +TL+L TICT+  LD RF S+ +RP RA  
Sbjct: 160 GIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGF 219

Query: 225 FVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSF 284
           F+ F              +G  E    +QL ++  E   Y+ GA +YG R PE++ PG+F
Sbjct: 220 FILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNF 279

Query: 285 DIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
           D+ G SHQ+FH++V++ ++ H KAV  SY  +H
Sbjct: 280 DLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMH 312

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  242 bits (617), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 174/286 (60%), Gaps = 2/286 (0%)

Query: 45  ASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFC 104
             KL+ ++E+PEWQ+DN+ IL GYV+ET S    L SL Y +NESVNIYTHL+  V +F 
Sbjct: 29  GKKLYHFNELPEWQQDNDKILTGYVRETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFV 88

Query: 105 VL--FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLD 162
           +L  F +  +I  F +TT  DY II+ + +GAF CL+ S  +HC K HS   S   +++D
Sbjct: 89  LLLFFTDILLIPSFPSTTMTDYIIINFYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVD 148

Query: 163 YIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRA 222
           Y+GI+ LIS S+ SLLYYG+++    F  FS +T++L   C+V  L  RF +   RP RA
Sbjct: 149 YMGIIGLISCSVISLLYYGYFDHVFYFKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRA 208

Query: 223 SIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPG 282
           S F+ F              +G  E ++ VQL ++  E   Y+ GA +YG R PE++APG
Sbjct: 209 SFFITFAFSSVIPIATGMFKFGWTEVFHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPG 268

Query: 283 SFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAVQLKL 328
            FD  G SHQLFHVLVV+ + CH +AV  SY  +H  +N    L L
Sbjct: 269 KFDFIGSSHQLFHVLVVLGSFCHLRAVMGSYMFMHAHINAPNILAL 314

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  241 bits (616), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 122/289 (42%), Positives = 179/289 (61%), Gaps = 3/289 (1%)

Query: 28  SVIFEDLNQATTIPLKPA-SKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLH 86
           S + +++   T+  LK    KL+++ E+P WQ+DNE IL GYV+ETNS KE L ++ Y +
Sbjct: 13  SEMAQEMAHTTSEGLKKRIRKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFN 72

Query: 87  NESVNIYTHLIPGVCFFCV--LFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTY 144
           NES+NIYTHLIPGV +  +  +F +  +          ++ ++  + +GAF CL  S  +
Sbjct: 73  NESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCF 132

Query: 145 HCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICT 204
           HCLK HS P S + +++DY+GI+  I+ S  SLLYYG+++    F  FS +T+ L + C 
Sbjct: 133 HCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACA 192

Query: 205 VVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLY 264
           V+ L+  F +  +RP RA +F+AFG             +G  E    +QL +++ E V Y
Sbjct: 193 VLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFY 252

Query: 265 IFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSY 313
           I GA +YG R PE  APG FD+ GHSHQ+FH+LVV+  LCHF+AVT SY
Sbjct: 253 ITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSY 301

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  239 bits (611), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 121/291 (41%), Positives = 184/291 (63%), Gaps = 3/291 (1%)

Query: 30  IFEDLNQATTIPLKPA-SKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNE 88
           I E L Q T + +     +L+ + E+PEWQ+DN+ I+ GY++ET S KE + SL   HNE
Sbjct: 13  ISEKLEQLTPVAISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLFHNE 72

Query: 89  SVNIYTHLIPGVCFFCVL--FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHC 146
           S+NIY+HL+P + +  +L    + +++ +F  +T     +I  F +G+  CL  S  +HC
Sbjct: 73  SINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSFFHC 132

Query: 147 LKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVV 206
           LK HS     + +++DY+GI+I+I+ S+ SLLYYGF++    F  F+  T++LGTICTV 
Sbjct: 133 LKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTICTVF 192

Query: 207 TLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIF 266
            L  +F S+ +RP+RA  +V FG             +G+ E    VQL +++LE + YI 
Sbjct: 193 ALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMFYIA 252

Query: 267 GAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
           GA IYG RFPE +APG FD  GHSHQ+FH++VV+ ++CHF+A+  SY  +H
Sbjct: 253 GAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMH 303

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  239 bits (611), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 172/278 (61%), Gaps = 6/278 (2%)

Query: 48  LFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLF 107
           L+ +HE+P WQ+DN+ ILGGYV+ETNSF + + SL YL+NES+NIY+HLIP + +  +  
Sbjct: 39  LYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNESINIYSHLIPSLIYLTIAV 98

Query: 108 LNKYVISRF------KTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQL 161
           +    I +F       TTT  D+  I+ F VGAF CL+ SG +H LK HS       +++
Sbjct: 99  MLLIEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRI 158

Query: 162 DYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYR 221
           DY+GI++LIS SM  +LYYGF++   +FY F  +TL   ++C+++ +   F    +R  R
Sbjct: 159 DYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSIIVMSETFNLSKYRLLR 218

Query: 222 ASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAP 281
           A +F AFG             +G    +  + L +I  E V Y+ GA +YG R PES+ P
Sbjct: 219 ACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLVGATLYGFRIPESILP 278

Query: 282 GSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFR 319
           G FD++G SHQLFH  VVI ++ HFKAV +SY L+H R
Sbjct: 279 GKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMHSR 316

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  234 bits (597), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 121/269 (44%), Positives = 170/269 (63%), Gaps = 2/269 (0%)

Query: 47  KLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVL 106
           +L+S+ E+PEWQ+DNE I  GYV+ETNSF E L S+ Y +NESVNIYTHL+P V +F +L
Sbjct: 21  RLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFILL 80

Query: 107 FLNKYVI--SRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYI 164
            L   ++    F  TT ++Y +ID +  G F CL+ S  +HCLK HS   + + +++DYI
Sbjct: 81  LLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVDYI 140

Query: 165 GIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASI 224
           GI++ I++S+ S+LYYGFY+        S +TL LG  C    L+ RF +  +R  RA  
Sbjct: 141 GIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRAIF 200

Query: 225 FVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSF 284
           F  FG             +G  E    +QL +++   + YIFGA IYG R PE++APG F
Sbjct: 201 FTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPGKF 260

Query: 285 DIWGHSHQLFHVLVVIAALCHFKAVTQSY 313
           D  GHSHQ+FH+LVV+ ++CHF+AV  SY
Sbjct: 261 DFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  231 bits (589), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 123/324 (37%), Positives = 193/324 (59%), Gaps = 12/324 (3%)

Query: 10  KIQKATSSLAGKNRTLETSVIFE----DLNQATTIPLKPASK----LFSWHEIPEWQRDN 61
            +   T++   ++R+     IFE    + N  +  P     K    L  + E+PEWQ+DN
Sbjct: 7   NLDNLTTTCLLRSRSNSVGGIFETNHLEDNDTSQKPKTNRRKRKIHLSKFDELPEWQKDN 66

Query: 62  EHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCV----LFLNKYVISRFK 117
           + IL GYV+ETNSF     SL YL+NE++NIYTHLIP + +  V    +F+N   I +F 
Sbjct: 67  DKILTGYVRETNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFP 126

Query: 118 TTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSL 177
           TT+  DY +I+ F +GAF CL++S  +HCLK HS+    + ++LDYIGI+ILIS S+  +
Sbjct: 127 TTSVIDYIVINIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPI 186

Query: 178 LYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXX 237
           LY+G+++    F  F+ +T     +C+++ L+ +F    +RP RA +F+ F         
Sbjct: 187 LYFGYFDRLSYFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMI 246

Query: 238 XXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVL 297
                +G +     + L +++LE + YI G  +YG R PE+  PG+FD++G SHQ+FH+ 
Sbjct: 247 TGFYIFGYKGVMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIF 306

Query: 298 VVIAALCHFKAVTQSYELVHFRLN 321
           VV+ ++CHF AV +SY L+H  +N
Sbjct: 307 VVLGSICHFGAVIKSYCLMHHLIN 330

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  230 bits (586), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 176/277 (63%), Gaps = 2/277 (0%)

Query: 47  KLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFC-- 104
           +LF+++E+PEWQRDN+ IL GYV+ET SFK+ L SLLY +NE++NIYTHLIP + +    
Sbjct: 38  RLFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTIS 97

Query: 105 VLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYI 164
           V  +N  V+  F TT+  DY +I+ F +GAF CL++S  +HCLK HS     + ++LDY+
Sbjct: 98  VTLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYM 157

Query: 165 GIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASI 224
           GI+ILIS S+  ++Y+G+++       F  +T    T+C++  L+ +F    +RP+RA +
Sbjct: 158 GIIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIV 217

Query: 225 FVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSF 284
           F+ F              +G    +  V L ++  E + YI GA +YG R PE   PG F
Sbjct: 218 FMLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATLYGFRIPECFKPGDF 277

Query: 285 DIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLN 321
           D  G SHQ+FH+LVV+ ++CHF+AV +SY L+H  +N
Sbjct: 278 DFLGSSHQIFHILVVLGSICHFRAVIKSYILMHSSMN 314

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  228 bits (582), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 118/289 (40%), Positives = 167/289 (57%), Gaps = 8/289 (2%)

Query: 32  EDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVN 91
           ED+ Q  T  L     L+++ E+P WQ+DNE IL GY++ETNS+K  L SL + HNE++N
Sbjct: 32  EDVKQKITDTL-----LYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETIN 86

Query: 92  IYTHLIPGVCFFCVL---FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLK 148
           IY+H I    +  +L   F N   +  F TTT  DY ++D + +GA  CL +S  +HCLK
Sbjct: 87  IYSHGISAAIYLLLLVFFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLK 146

Query: 149 SHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTL 208
            HS   S + +++DYIGI+ LI+ S  SLLY+G+ +    F  F+  T +L   CTV   
Sbjct: 147 QHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTVFVT 206

Query: 209 DSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGA 268
             +F +R W+  RA  F+AF              +G  E W  VQL  + LE + Y+ GA
Sbjct: 207 MEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGA 266

Query: 269 FIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
            +YG R PE  APG FD  G+SHQ FH+ VV+ +L H +A+  SY  +H
Sbjct: 267 LLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMH 315

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  224 bits (571), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 184/316 (58%), Gaps = 10/316 (3%)

Query: 8   QRKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGG 67
           +  I+ AT S   + + L T         ++  P     +L  + E+P WQ+DN+ I  G
Sbjct: 14  ETAIETATVSRGSRGKLLVT-------GTSSGAPSGQRGRLCRYEELPAWQQDNDCIRTG 66

Query: 68  YVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFC--VLFLNKYVISRFKTTTWKDYA 125
           YV+ET S +  L SLLY +NESVN+Y+HL+P V +     L L+++ + RF TTTW DY 
Sbjct: 67  YVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTTTWSDYL 126

Query: 126 IIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNS 185
           II+TF VGA ACL+ S  +HCLK HS       +++DY+GI++LI+ S   ++Y+G+++ 
Sbjct: 127 IINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIYFGYFDY 186

Query: 186 SKMFYGFSGVTLLLGTICT-VVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYG 244
                 F+ VT+ LG  C+ VV  + +F S  ++  RA+ F+AF              +G
Sbjct: 187 MGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMATGFVKFG 246

Query: 245 SEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALC 304
                + + L ++  E V YI GA +YG R PE   PG  D+WG+SHQ+FHV+VV  +LC
Sbjct: 247 IPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMVVFGSLC 306

Query: 305 HFKAVTQSYELVHFRL 320
           H KAV +SY L+H  L
Sbjct: 307 HLKAVLESYSLMHRHL 322

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  131 bits (329), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 142/302 (47%), Gaps = 31/302 (10%)

Query: 43  KPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCF 102
           K + +L +++++P+WQ+DN  I+  YV+ETNS  ++L S+   H+ES+NI+THLIP    
Sbjct: 3   KHSLQLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA--- 59

Query: 103 FCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLD 162
              L   K+  +   T     Y I+  + +    C ++S  +H  K  S   +    +LD
Sbjct: 60  ---LLYAKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLD 115

Query: 163 YIGIVILISTSMFSLLYYGFYNS--SKMFYGFSGVTLLLGTICTVVTLDSRFRS------ 214
           Y+GI +LI+ ++ S+   GF  S  + M   F   T  L     ++ + S  +       
Sbjct: 116 YVGISLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDD 175

Query: 215 -------------RLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEG 261
                           +  RA +F + G             YG +  +  + +  +I   
Sbjct: 176 NDGTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASV 235

Query: 262 VLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLN 321
           + YI G  IY  + PE   PG FD+ G SHQLFH+ +V   +CH+ A+  +    +F LN
Sbjct: 236 LCYIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTAK---NFALN 292

Query: 322 EA 323
           +A
Sbjct: 293 QA 294

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  128 bits (321), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 149/274 (54%), Gaps = 7/274 (2%)

Query: 53  EIPEWQRD--NEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFL-- 108
           E+PEWQR+  +  ++ G++KETNSFK+ L S +Y HN S+NI  + I    +F +LF   
Sbjct: 38  ELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIAATVYFMLLFFFT 97

Query: 109 NKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVI 168
           + Y+I  F +TT  DY +++ + + A    ++   ++ +KSHS   + +  +L+ IG++ 
Sbjct: 98  DCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAFLWYKLNNIGLIN 157

Query: 169 LISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAF 228
            I++S+ +LLYY +++    F  F+ VTLLL T+ T   +   F +++ R  +  + +A+
Sbjct: 158 HIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIISDSF-NKMTRIRKNFLLLAY 216

Query: 229 GXXXXXX-XXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIW 287
                          +G  +    + L  IILE  +Y FG  I   + PE     SFD  
Sbjct: 217 IILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQLPERFF-NSFDFL 275

Query: 288 GHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLN 321
           G+S  ++ + +++ +  HFK +  SY L+H  +N
Sbjct: 276 GNSENVYQLSIIVCSFIHFKILMNSYCLMHSGVN 309

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  127 bits (318), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 147/286 (51%), Gaps = 8/286 (2%)

Query: 37  ATTIPLKPASKLFSWHEIPEWQRD--NEHILGGYVKETNSFKETLHSLLYLHNESVNIYT 94
           + T P +P   L    E+P+WQ+   N  I+ GYV+ETNS  + LH++ Y +N++VNI  
Sbjct: 31  SVTFPRRPKV-LPILKELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIIL 89

Query: 95  HLIPGVCFFCVL--FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSY 152
           + +    +F +L  F + Y+I     TT  DY +++ +  GAF    ++  ++ L+SHS 
Sbjct: 90  NTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSL 149

Query: 153 PVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRF 212
               +  +L ++  +  ISTS+ + LYY F+++   F   +  TLL+ +I  + TL  +F
Sbjct: 150 AKCHLWFKLSHLAFINYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQF 209

Query: 213 RSRLWRPYRASIFVAFGXXXXXXXXXXXXY-YGSEETWNSVQLGWIILEGVLYIFGAFIY 271
             R  R  R  + + F             + + +      V+   I+LE  LY+F   + 
Sbjct: 210 L-RKNRSQRNMVSITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLK 268

Query: 272 GIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
            ++ PE  +   FD  G+S  ++H+ +++ +L HFK +  SY  +H
Sbjct: 269 AVQVPERFSEN-FDFIGNSENIYHICIILGSLLHFKMLLNSYFFMH 313

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 136/286 (47%), Gaps = 18/286 (6%)

Query: 46  SKLFSWHEIPEWQRD--NEHILGGYVKETN-SFKETLHSLLYLHNESVNIYTHLIPGVC- 101
           SK+ +  ++P W R   N  I  GY   TN ++   L  L+  +N+S++IY +L+ G+  
Sbjct: 8   SKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLVCGLIS 67

Query: 102 -FFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQ 160
               + + +  +I    +TT  DY II+ F +              LK HS     + NQ
Sbjct: 68  GVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQGKLWNQ 127

Query: 161 LDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPY 220
              + +V+L++ S+ +LLYY F++   +F  F   T LL +I ++V ++ +++    R  
Sbjct: 128 AKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK----RVQ 183

Query: 221 RASIFVAFGXXXXXX-XXXXXXYYGSEETWNSVQLGWIIL--EGVLYIFGAFIYGIRFPE 277
           + S  V FG              +G  +++   ++ + +L  E VLY   A +   R PE
Sbjct: 184 KLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQLTRLPE 243

Query: 278 ---SMAPGSF---DIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317
              S    SF   D  G+S Q+  ++ + A + HF  +  +YE+VH
Sbjct: 244 LTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 84.0 bits (206), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 132/292 (45%), Gaps = 30/292 (10%)

Query: 40  IPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPG 99
           +  K   K F +H++ +WQ+          K  +S  E+L +L+YL           +  
Sbjct: 34  VETKETKKGFPFHDLAKWQKQ--------YKNKSSRSESLVALIYL-----------LGS 74

Query: 100 VCFFCVL--FLNKYVISRFKTTT-WKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSI 156
           +  FC+L  F + Y+I  F TTT   DY + + + +  F   ++   YH +K+ S    I
Sbjct: 75  MSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKNISLQQHI 134

Query: 157 -VGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSR 215
            +  +  Y+  + L+ +S  ++LYY FY+    F  F+ +   +G     V L  +  S 
Sbjct: 135 EIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLNS- 193

Query: 216 LWRPYRASIF---VAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYG 272
            ++ +  ++F   V+              + G E   + ++L  I  E V  +  + IY 
Sbjct: 194 -YKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIYV 252

Query: 273 IRFPESMAPGSF--DIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNE 322
            RFPES+   +   + W HS   FH+L+   A  HF  + QSY L+H  LN+
Sbjct: 253 TRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQSYILMHSSLNQ 304

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 141/331 (42%), Gaps = 36/331 (10%)

Query: 1   MAQQQVFQRKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRD 60
           MA     ++   K  ++    N T ET+      N       K   K F +H++ +WQ+ 
Sbjct: 1   MASLTTVEQSPAKCKTTTEKGNGTGETT------NSNVDAETKEIKKGFPFHDLAKWQQQ 54

Query: 61  NEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVL--FLNKYVISRFKT 118
                    +  +S  E+L +L+YL           +  +  FC+L  F + Y+I  F T
Sbjct: 55  --------YRNKSSRNESLVALIYL-----------LGSMSSFCLLIFFTDFYLIPLFPT 95

Query: 119 TT-WKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVG-NQLDYIGIVILISTSMFS 176
           TT   DY + + + +  F   ++   YH +K+ S    +    +  Y+  + L+ +S  +
Sbjct: 96  TTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQIT 155

Query: 177 LLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIF---VAFGXXXX 233
           +LYY FY+    F  F+ +   +G +     L  +  S   + +  ++F   V+      
Sbjct: 156 ILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLNSS--KRFNKTVFFISVSVVCCSL 213

Query: 234 XXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESM--APGSFDIWGHSH 291
                   + G E     +++  I  E V  +  + IY  RFPES+       + W HS 
Sbjct: 214 PLLTAIITFDGLENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSE 273

Query: 292 QLFHVLVVIAALCHFKAVTQSYELVHFRLNE 322
            LFH+++   A  HF  + QSY L+H  LN+
Sbjct: 274 YLFHLVISGTAFYHFFILIQSYILMHSSLNQ 304

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 128/299 (42%), Gaps = 30/299 (10%)

Query: 33  DLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNI 92
           ++N       K   K F +H++ +WQ           K  +S            NESV  
Sbjct: 27  EINSTVGAKTKETKKGFPFHDLAKWQEQ--------YKNKSS-----------RNESVVA 67

Query: 93  YTHLIPGVCFFCVL--FLNKYVISRFKTTT-WKDYAIIDTFFVGAFACLVMSGTYHCLKS 149
             +L+  +  FC+L  F + Y+I  F TTT   DY + + + +  F   ++   YH +K+
Sbjct: 68  LIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFIKN 127

Query: 150 HSYPVSIVG-NQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTL 208
            S    +    +  Y+  + L+ +S  ++LYY FY+    F  F+ +   +G +     L
Sbjct: 128 ISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFIL 187

Query: 209 DSRFRSRLWRPYRASIF---VAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYI 265
             +  S   + +  ++F   V+              + G E     +++  I  E V  +
Sbjct: 188 TDKLISS--KRFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWELVALV 245

Query: 266 FGAFIYGIRFPESMAPGSF--DIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNE 322
             + IY  RFPE    G    + W HS  LFH+++  AA  HF  + QSY L+H  LN+
Sbjct: 246 AASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMHSSLNQ 304

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 127/289 (43%), Gaps = 30/289 (10%)

Query: 43  KPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCF 102
           K   K F +H++ + Q+          K  +S  E+L +L+YL           +  +  
Sbjct: 37  KETKKGFPFHDLAKLQKQ--------YKNKSSRNESLVALIYL-----------LGSMLS 77

Query: 103 FCVL--FLNKYVISRFKTTT-WKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVG- 158
           FC+L  F + Y+I  F TTT   DY + + + +  F   ++   YH +K+ S    +   
Sbjct: 78  FCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHW 137

Query: 159 NQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWR 218
            +  Y+  + L+ +S  ++LYY FY+    F  F+ +   +G +     L  +  S   +
Sbjct: 138 QKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISS--K 195

Query: 219 PYRASIF---VAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRF 275
            +  ++F   V+              + G E     +++  I  E V  +  + IY  RF
Sbjct: 196 RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRF 255

Query: 276 PESM--APGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNE 322
           PES+       + W HS  LFH+L+   A  HF  + QSY L+H  LN+
Sbjct: 256 PESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSLNQ 304

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 111/278 (39%), Gaps = 19/278 (6%)

Query: 52  HEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL--HNESVNIYTHLIPGVCFFCVLFLN 109
           +E+P   R+N +I+ GY    +  K  L  + +   HNE++NI++HL   V    +LF+ 
Sbjct: 302 YELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGWHNETLNIWSHLFGAVYLAYLLFIQ 361

Query: 110 KYVISRFKTTTWKDYA--IIDTFFVGAFACLVMSGTYHCLK-SHSYPVSIVGNQLDYIGI 166
                 F +     +   II  F +    CL+ S  +H L  +   P+      +DY GI
Sbjct: 362 LPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYTGI 421

Query: 167 VILISTSMFSLLYYGFYNSSKMFYGFS-----GVTLLLGTICTVVTLDSRFRSRLWRPYR 221
            +LI+ S+ S  +   YN +      S      ++L LG   + +    RF     RP+R
Sbjct: 422 TVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRPESRPFR 481

Query: 222 ASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAP 281
            + +V                 G + +    +  W     + Y+ G   YG   PE    
Sbjct: 482 IAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVW-NRSLIWYLIGVVFYGSFIPER--- 537

Query: 282 GSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFR 319
                W    +L + +   A LC    +   ++ VHFR
Sbjct: 538 -----WRTDVELDYTIPTDAELCSNLDILTKHKHVHFR 570

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 8/181 (4%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLF--L 108
           ++++P   R+N +I+  Y +  +S K++L S+  LHNE+ NI++HL+  + F  VLF  L
Sbjct: 195 YYQLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDL 253

Query: 109 NKYVI--SRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSY-PVSIVGNQLDYIG 165
              +I  S    TT K +  +  F   +  C++ S  YH     S   +      +DY G
Sbjct: 254 PNSIIVSSSMVPTTAKLFLYL--FVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSG 311

Query: 166 IVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIF 225
           I ILI++S+ S+ +   Y+   +   +   + +LG +   +     F S   RP R   F
Sbjct: 312 ISILITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFF 371

Query: 226 V 226
           +
Sbjct: 372 I 372

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 90/184 (48%), Gaps = 10/184 (5%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGVCFFCVL- 106
           ++E+P+  R+N +I+ G+ +  +S K++L S+L +   HNE++NI++H+   +    ++ 
Sbjct: 242 YYELPQPWRENPYIIYGH-RFYHSHKKSLLSILNVYGWHNETINIWSHIAGAIILLYIML 300

Query: 107 --FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSY-PVSIVGNQLDY 163
             F N  V +  +       AI   F +    C+V S  +H      + P+    + +DY
Sbjct: 301 RGFPNSDVFNSTQVPKVAKGAIY-VFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDY 359

Query: 164 IGIVILISTSMFSLLYYGFYN-SSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRA 222
            GI ILI+ S+ +   +  Y  + K  Y + G++L LG          RF     R +R 
Sbjct: 360 TGITILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRV 419

Query: 223 SIFV 226
           + +V
Sbjct: 420 AFYV 423

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 107/251 (42%), Gaps = 35/251 (13%)

Query: 7   FQRKIQKATSSLAGKNRTLETSVIFEDLNQATTIP---LKPAS----------------- 46
           F+      TS +  K  +LE  V F  L+Q   IP   LKP+                  
Sbjct: 153 FESSSSSPTSEVFEKAVSLEDRVKFL-LDQCKGIPKHMLKPSEEVEALITAYNHDVAFQE 211

Query: 47  ---KLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL--HNESVNIYTHLIPGVC 101
              KL  ++E+P   R+N +I+  Y    ++ K  L ++ +   HNE+ NI++H +    
Sbjct: 212 GREKLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHFL---G 268

Query: 102 FFCVLFLNKYVISR---FKTTTWKDYA--IIDTFFVGAFACLVMSGTYHCLKSHSY-PVS 155
           FF V++L  Y   +   F++      A  ++  F   A  CL+ S  +H     ++  + 
Sbjct: 269 FFYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMR 328

Query: 156 IVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSR 215
                +DY GI ILI+ S+ +  +    +   M   +  ++L LG I   +    +F + 
Sbjct: 329 RRFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTP 388

Query: 216 LWRPYRASIFV 226
             RP R   F+
Sbjct: 389 EARPLRIRFFM 399

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 115/297 (38%), Gaps = 50/297 (16%)

Query: 9   RKIQKATSSLAGKNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGY 68
           + I+K+  S+      +  S+ F +   A  +  +   +   ++E+P   R+N  I+ GY
Sbjct: 178 KAIEKSFQSIQNDAEAVAASIKFHNYEVALQLGQQ---RHLHYYELPFPWRENRFIIHGY 234

Query: 69  VKETNSFKETLHSLLYL---HNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYA 125
            +  NS+ ++L S+      HNE+VNI+THL  G  +F  L     +   F  TT     
Sbjct: 235 -RFYNSYSKSLLSIFNWYGWHNETVNIWTHLC-GALYFAFL-----IFKGFSQTTVYQSE 287

Query: 126 IIDT--------FFVGAFACLVMSGTYHC------LKSHSYPVSIVGNQLDYIGIVILIS 171
           ++ T        F      C + S  +H       LK  S    +     DY GI +L++
Sbjct: 288 LVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACV-----DYTGITVLVT 342

Query: 172 TSMFSLLYYGFYNSSKMFYG-----FSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIFV 226
            S+ +  +     SS   +      F+G +  LG +   +    +F     RP R + ++
Sbjct: 343 ASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLRIAFYL 402

Query: 227 ---AFGXXXXXXXXXXXXYYGSEETWNSV---QLGWIILEGVLYIFGAFIYGIRFPE 277
              +FG               S +    V    L W       YI G   YG   PE
Sbjct: 403 LLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAW-------YIIGVVFYGTFIPE 452

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 86/187 (45%), Gaps = 7/187 (3%)

Query: 46  SKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPG--V 100
           S+   ++++P   R+N +I+ GY +  N+  ++L S++     HNE+ NI++HL+    +
Sbjct: 212 SQHLHYYQLPFPWRENRYIIHGY-RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYI 270

Query: 101 CFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSY-PVSIVGN 159
            +  +    +  + R      +   I+  F   A  C++ S  +H     S+  +     
Sbjct: 271 IYLAIYDFPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFA 330

Query: 160 QLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRP 219
            +DY GI ILI+ S+ +  +   Y+       + G++L LG I   +    RF     RP
Sbjct: 331 CVDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARP 390

Query: 220 YRASIFV 226
            R   F+
Sbjct: 391 LRIRFFI 397

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 91/205 (44%), Gaps = 15/205 (7%)

Query: 35  NQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL--HNESVNI 92
           N  T   L  ++    ++++P   R+N +I+ GY    ++ K  L  + Y   HNE++NI
Sbjct: 100 NWQTAYNLGRSNNTLHYYQLPFPWRENRYIIKGYRFYDSNVKCLLSVVNYYGWHNETLNI 159

Query: 93  YTHLIPGVCFFCVLFLNKYVI-------SRFKTTTWKDYAIIDTFFVGAFACLVMSGTYH 145
           ++HL     F  +L++  +V        S    TT K   ++  F +    C++ S  +H
Sbjct: 160 WSHL---GGFLTLLYIAVFVYPNTEVYQSELIPTTAK--MLLFVFLIAGMKCMLASVFWH 214

Query: 146 CLK-SHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICT 204
               + SY +      +DY GI ILI+ S+ +  Y    ++    + +  ++L LGT   
Sbjct: 215 TFDGTCSYTLRPKFCCVDYTGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGV 274

Query: 205 VVTLDSRFRSRLWRPYRASIFVAFG 229
            +    +F     RP R   FV   
Sbjct: 275 YINWSPKFDGPEARPLRIKFFVTLS 299

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/342 (22%), Positives = 130/342 (38%), Gaps = 62/342 (18%)

Query: 32  EDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNE 88
           + L+ A +     A  L  W E+P   R+N +I+ G+ +  +S +++L S+L     HNE
Sbjct: 89  QPLHWAESRARGLARHLHYW-ELPYAWRENRYIIYGH-RFYHSHRKSLLSVLNAYGWHNE 146

Query: 89  SVNIYTHLIPGVC---FFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYH 145
           ++NI++HL+         C  +    V    +      +A I  F      C+  S  +H
Sbjct: 147 TINIWSHLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKWA-IGAFLACGVKCMASSVAWH 205

Query: 146 C------LKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSK-MFYGFSGVTLL 198
                  LK  S  V +     DY GI +L++ S+ + +    Y  S+ + Y +   ++ 
Sbjct: 206 TFNGTCHLKLRSRFVCV-----DYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIG 260

Query: 199 LGTICTVVTLDSRFRSRLWRPYRASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWII 258
           LGT   V+     F     RP R +++V               +   +  W S  L   +
Sbjct: 261 LGTAAGVMNWSPHFDRPEARPLRIAVYVGLA----ALGLVSFVHVWMQVRWASAHLMAPL 316

Query: 259 LEG--VLYIFGAFIYGIRFPE------------------------SMAPGS--------- 283
           +    V Y  G   Y    PE                         + P +         
Sbjct: 317 VYKSLVWYGIGVVFYATLVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSL 376

Query: 284 --FDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEA 323
              D + HSH L+HV VV+  + H++AV Q   +V      A
Sbjct: 377 WWVDYFCHSHFLWHVFVVLGVVGHYRAVLQMSRIVWLDAGRA 418

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 17/192 (8%)

Query: 46  SKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGVCF 102
           SK   ++++P   R+N +I+ GY +  N+  ++L S+      HNE+ NI++HL+ G  +
Sbjct: 212 SKHLHYYQLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLL-GAMY 269

Query: 103 FCVLFLNKYVISRFKTTTWKDYA-------IIDTFFVGAFACLVMSGTYHCLKSHSY-PV 154
              L +  +     ++  WK+         I+  F   A  C++ S  +H     S+  +
Sbjct: 270 LIYLAIYDFP----QSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKL 325

Query: 155 SIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRS 214
                 +DY GI ILI+ S+ +  +   Y+       + G++L LG     +    RF  
Sbjct: 326 RSKFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDR 385

Query: 215 RLWRPYRASIFV 226
              RP R   F+
Sbjct: 386 PEARPLRIRFFI 397

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 7/182 (3%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGV--CFFCV 105
           ++++P   R+N +I+ GY +  N+  ++L S+      HNE+ NI++HL+  +   +  +
Sbjct: 218 YYQLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAI 276

Query: 106 LFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSY-PVSIVGNQLDYI 164
               +  + R      +   I+  F   A  C++ S  +H     S+  +      +DY 
Sbjct: 277 YDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYS 336

Query: 165 GIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASI 224
           GI ILI+ S+ +  +   Y+     Y +  ++L LG     +    RF     RP R   
Sbjct: 337 GITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRF 396

Query: 225 FV 226
           F+
Sbjct: 397 FI 398

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 81/190 (42%), Gaps = 25/190 (13%)

Query: 52  HEIPEWQRDNEHILGGYVKETNSFKETLHSLLY--LHNESVNIYTHLIPGVCFFCVLFLN 109
           +++P   R+N  I+ GY    + +K  L  + +   HNE+ NI+THL  G   + VL+L 
Sbjct: 135 YQLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYGWHNETANIWTHL--GGALY-VLWLA 191

Query: 110 KYVISRFKTTTWKD-------YAIIDTFFVGAFACLVMSGTYH------CLKSHSYPVSI 156
            Y   R  T+ W+          I+  F   A  C++ S   H      CL   S    +
Sbjct: 192 VYDFPR--TSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACV 249

Query: 157 VGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRL 216
                DY GI +LI+ S+ +  +   YN       +  V+ +LG    ++    +F    
Sbjct: 250 -----DYSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPE 304

Query: 217 WRPYRASIFV 226
            RP R   F+
Sbjct: 305 ARPLRIKFFI 314

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 84/187 (44%), Gaps = 7/187 (3%)

Query: 46  SKLFSWHEIPEWQRDNEHILGGY--VKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFF 103
            K   ++++P   R+N +I+ GY    + +    ++ +    HNE+ NI++HL+  + F 
Sbjct: 248 DKHLHYYQLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFA 307

Query: 104 CVL---FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLK-SHSYPVSIVGN 159
            ++   F   +++   +      Y I+  F +    C++ S  +H    + S  +     
Sbjct: 308 YIVLFEFPKSFIVQSPEVPPSAKY-IVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYC 366

Query: 160 QLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRP 219
            +DY GI ILI+ S+ +  +   Y+   +   +  ++LL G     +    +F S   RP
Sbjct: 367 CVDYSGITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARP 426

Query: 220 YRASIFV 226
            R   F+
Sbjct: 427 LRIKFFI 433

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 88/189 (46%), Gaps = 17/189 (8%)

Query: 49  FSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGVCFFCV 105
            +++++P   R+N +I+  Y +  +S K++L S+      HNE+ NI+THLI G+    +
Sbjct: 216 LNYYQLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLY---L 271

Query: 106 LFLNKYVISRFK-------TTTWKDYAIIDTFFVGAFACLVMSGTYHCLK-SHSYPVSIV 157
           +++  Y   R +        TT K   I+  F   A  CL  S  +H    + +  +   
Sbjct: 272 IYMAVYDFPRSEIFLSDKIPTTAK--LIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSK 329

Query: 158 GNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLW 217
              +DY GI ILI+ S+ +  +   Y+S +    +  ++L LG     +    +F     
Sbjct: 330 FACVDYSGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEA 389

Query: 218 RPYRASIFV 226
           RP R   FV
Sbjct: 390 RPLRIKFFV 398

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 90/218 (41%), Gaps = 10/218 (4%)

Query: 105 VLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYI 164
           V F + Y++ R  +TT  DY +++ F   AF C       H ++  +   +  G+ L  I
Sbjct: 111 VFFTDVYLVPRHVSTTMTDYVLLNVFLATAFQC----AACHMVQCFT---TTAGSVLSTI 163

Query: 165 GIVILISTSMFSLLYYGFYNSS---KMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYR 221
            ++   + S  +LLYY +Y++    K+   F+    L+    TV +  S    R W   R
Sbjct: 164 TMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKRQWWSRR 223

Query: 222 ASIFVAFGXXXXXXXXXXXXYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAP 281
             + V                +G+ +    +    ++ E  +Y+     YG    +++  
Sbjct: 224 TLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGTEKDTLPK 283

Query: 282 GSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFR 319
             F +  H+  L H+ +++ A    +A T    LV F+
Sbjct: 284 LPFYVAFHTASLIHLQLLLNAFHLMRAGTNKPTLVSFK 321

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 81/190 (42%), Gaps = 23/190 (12%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL--HNESVNIYTHLIPGVCFFCVLFL 108
           ++++P   R+N +I+ GY      +K  L  + +   HNE+ NI+THL+ G  +   L +
Sbjct: 217 YYQLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLL-GAMYIVYLAV 275

Query: 109 NKYVISRFKTTTWKDYA-------IIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQ- 160
             +  S      W++         I+  F   A  C++ S  +H         S +G + 
Sbjct: 276 YDFPHSE----VWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNG----TSFLGLRS 327

Query: 161 ----LDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRL 216
               +DY GI ILI+ S+ +  +   Y+       +  ++L LG     +    RF    
Sbjct: 328 KFACVDYSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPE 387

Query: 217 WRPYRASIFV 226
            RP R   F+
Sbjct: 388 ARPLRIRFFI 397

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 83/184 (45%), Gaps = 11/184 (5%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGVCFFCVL- 106
           ++++P   R+N +I+  Y +  +S K++L S+      HNES NI+THL+ G  +   L 
Sbjct: 252 YYQLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLL-GAIYLIYLS 309

Query: 107 ---FLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSY-PVSIVGNQLD 162
              F N  +    K  T     I+  F   A  CL+ S  +H     S+  +      +D
Sbjct: 310 IYDFPNSEIFQSEKVPTTAK-LIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVD 368

Query: 163 YIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRA 222
           Y GI ILI+ S+ +  +   Y+S      +  ++L LG     +    +F     RP R 
Sbjct: 369 YSGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRI 428

Query: 223 SIFV 226
             F+
Sbjct: 429 KFFI 432

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 93/240 (38%), Gaps = 21/240 (8%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLY-------LHNESVNIYTHLIPG---V 100
           ++E+P   R+N++I+ GY      F +  + L+        +HNE+ NI+TH++     +
Sbjct: 246 YYELPFPWRENKYIIHGY-----RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLI 300

Query: 101 CFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLK-SHSYPVSIVGN 159
               V F   +++   +        II  F      C+  S  +H    + S  +     
Sbjct: 301 YLLTVDFQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFC 360

Query: 160 QLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRP 219
            +DY GI +LIS S+ S  Y   Y+  K    +  ++ +       +    +F S   RP
Sbjct: 361 CVDYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARP 420

Query: 220 YRASIFVAFGXXXXXXXXXXXXYYG-SEETWNSVQLGWIILEGVL-YIFGAFIYGIRFPE 277
            R   FV                 G S   W       +  + V+ YI G F YG   PE
Sbjct: 421 LRIKFFVLLAAVGGLSFVNLVCLEGLSRAIW---LFSPVTNKSVIYYIIGVFFYGSFIPE 477

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 99/248 (39%), Gaps = 33/248 (13%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGVCFFCVLF 107
           ++E+P   R+N  I+ GY +  NS+K++L S+      HNE+VNI+THL  G  +   L 
Sbjct: 237 YYELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHL-GGALYLAYLL 294

Query: 108 LNKYV-----ISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKS--HSYPVSIVGNQ 160
              +       S    T  K  A +  F +    C + S  +H      H    S     
Sbjct: 295 FRGFSQTAVYQSELVPTAAKCMAFV--FLLSGLECFLFSVVWHTFNGICHLQQRSNCAC- 351

Query: 161 LDYIGIVILISTSMFSLLYYGFYNSSKMFYG-----FSGVTLLLGTICTVVTLDSRFRSR 215
           +DY GI IL++ S+ +  +     +++  +      F+  + +LG I   +    +F   
Sbjct: 352 VDYTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRP 411

Query: 216 LWRPYRASIFV---AFGXXXXXXXXXXXXYYGSEETWNSV---QLGWIILEGVLYIFGAF 269
             RP R + ++   +FG               S E    V    L W       Y+ G  
Sbjct: 412 ESRPLRIAFYLLLASFGFFSYLHSRIFHTSISSSELIKPVLSKSLAW-------YLIGVV 464

Query: 270 IYGIRFPE 277
            YG   PE
Sbjct: 465 FYGTFIPE 472

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 80/182 (43%), Gaps = 7/182 (3%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGVCFFCVLF 107
           ++E+P   R+N  I+ GY +  NS K++L S++     HNE+ NI+THL+ G+    ++F
Sbjct: 216 YYELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMF 274

Query: 108 LNKYVISRFKTTTWKDYAIIDT--FFVGAFACLVMSGTYHCLKSHSY-PVSIVGNQLDYI 164
                   F +      A + T  F + A  CL  S  +H     S   +      +DY 
Sbjct: 275 YQFPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYS 334

Query: 165 GIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASI 224
           GI ILI+ S+ +  +   Y        +  ++  LG     +    +F     RP R   
Sbjct: 335 GISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKF 394

Query: 225 FV 226
           F+
Sbjct: 395 FI 396

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 83/185 (44%), Gaps = 13/185 (7%)

Query: 51  WHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGV-----CF 102
           ++++P   R+N++I+ GY +   S K++  S++     HNE+ NI+THL+ G+      F
Sbjct: 207 YYQLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAF 265

Query: 103 FCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLK-SHSYPVSIVGNQL 161
           +     N ++  R          I+  F   A  C+  S  +H    +H   +      +
Sbjct: 266 YHFPHSNIWLSDRVPKPA---KCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACV 322

Query: 162 DYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYR 221
           DY GI ILI+ S+ ++ +   Y+       +   +L LG I   +    +F     RP R
Sbjct: 323 DYTGITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLR 382

Query: 222 ASIFV 226
              F+
Sbjct: 383 IKFFI 387

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 86/197 (43%), Gaps = 19/197 (9%)

Query: 46  SKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL---HNESVNIYTHLIPGVCF 102
           S+   ++E+P   R+N  I+ GY +  +S  ++L S+L     HNE+ NI+THL   +  
Sbjct: 229 SRHLHYYELPFPWRENRFIIHGY-RFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYI 287

Query: 103 FCVLFLNKYVISRFKTTTWKDYA--IIDTFFVGAFACLVMSGTYHCLK-SHSYPVSIVGN 159
             + F      S + +     +A  ++  F    F CLV S T+H    +    +     
Sbjct: 288 AYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFA 347

Query: 160 QLDYIGIVILISTSMFSLLYYGFYNS----------SKMFYGFSGVTLLLGTICTVVTLD 209
            +DY GI +LI+ S+ +  +   Y +          S +FY    V+ +L      +   
Sbjct: 348 CMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFY--MAVSSVLCCFGVFMNWS 405

Query: 210 SRFRSRLWRPYRASIFV 226
            RF     RP R + ++
Sbjct: 406 PRFDRPESRPLRIAFYL 422

>Skud_4.373 Chr4 (651175..651735) [561 bp, 186 aa] {ON} YDR112W
           (REAL)
          Length = 186

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 127 IDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLD-YIGIVILISTSMFSLLYYGFYNS 185
           I+T F   +  +VM   Y+ L    Y V++V   LD YI     I++      Y+G Y  
Sbjct: 61  INTLFKSCWCVIVMCSYYYVLPLCKYKVTVVAFSLDSYIFFAFTINSPRGERKYWGIYEM 120

Query: 186 SKMFY 190
           +K +Y
Sbjct: 121 AKGYY 125

>Kpol_397.6 s397 (19242..20999) [1758 bp, 585 aa] {ON}
           (19242..20999) [1758 nt, 586 aa]
          Length = 585

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query: 92  IYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHS 151
           IY  + P +  +C++F+  Y+++RFK        I+ T      + +V++    CL  + 
Sbjct: 9   IYIAIKPILKIYCIIFVG-YLLARFK--------IVTTEIARGISNMVVNAILPCLTFNK 59

Query: 152 YPVSIVGNQLDYIGIVILISTSMFSL 177
              +I    +  IG+++L +  +FS+
Sbjct: 60  IVSNISWRDIKEIGVILLSAVILFSV 85

>TDEL0H00800 Chr8 (135222..136631) [1410 bp, 469 aa] {ON} Anc_1.200
           YKR063C
          Length = 469

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 13  KATSSLAGKNRTLETSVIFEDL---NQATTIPLKPASKLFSWHEIPEWQ 58
           K T S   KN    TS I +DL    Q  T P  PA ++  W+  P+W+
Sbjct: 414 KTTVSHTPKNPNDGTSDILDDLAKLRQRLTKPKTPAQEIKLWNRYPQWE 462

>TBLA0B04300 Chr2 complement(994891..998943) [4053 bp, 1350 aa]
          {ON} Anc_8.599 YPL110C
          Length = 1350

 Score = 30.4 bits (67), Expect = 7.8,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 8/49 (16%)

Query: 46 SKLFSWHEIPEWQRDNEHILG--GY---VKETNSFKETLHSLLYLHNES 89
          +KLFS ++IPEW    EH L   G+   +KE N  ++TL    Y +N++
Sbjct: 4  AKLFSCYQIPEWY---EHYLDYRGFKKLIKEINIIQDTLFYEKYYNNQN 49

>KAFR0E02440 Chr5 complement(494552..497515) [2964 bp, 987 aa] {ON}
           Anc_7.50 YAL035W
          Length = 987

 Score = 30.4 bits (67), Expect = 8.0,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 40/94 (42%), Gaps = 21/94 (22%)

Query: 21  KNRTLETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKET-- 78
           + +T+E+  +  D      + L    +L+ W EIP     N +    Y ++  + ++   
Sbjct: 493 EQQTIESIKLLRDRKAPFIVALNKIDRLYDWKEIP-----NNNFRDSYAQQARAVQDEFQ 547

Query: 79  --------------LHSLLYLHNESVNIYTHLIP 98
                         L+S LY +N++++ Y  ++P
Sbjct: 548 TRLSNIQLALSEQGLNSELYFNNKNMSKYVSIVP 581

>KAFR0C01460 Chr3 (300109..300768) [660 bp, 219 aa] {ON} Anc_3.90
           YOL101C
          Length = 219

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 17/99 (17%)

Query: 102 FFCVLFLNKYVISRFKTT-TWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQ 160
           F  V F + Y+ISR+K+  T  DY II+ +      CL  S   + LK     +  + N 
Sbjct: 50  FLLVFFTDVYLISRYKSVMTMTDYIIINVYIA---ICLKFS-ILNLLKKEKKIMKNLNN- 104

Query: 161 LDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLL 199
           L  I IV        SLLYY +Y++  +FY F  ++LL+
Sbjct: 105 LQIISIV--------SLLYYIYYDN--IFY-FKVLSLLI 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,277,078
Number of extensions: 1331016
Number of successful extensions: 4612
Number of sequences better than 10.0: 89
Number of HSP's gapped: 4658
Number of HSP's successfully gapped: 91
Length of query: 328
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 218
Effective length of database: 40,868,139
Effective search space: 8909254302
Effective search space used: 8909254302
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)