Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30306.25ON74774737870.0
ACL001C6.25ON74572620380.0
SAKL0E01452g6.25ON73775619800.0
KLLA0D01309g6.25ON74473118810.0
Kpol_1037.296.25ON74676717710.0
Suva_15.1766.25ON74575017370.0
Kwal_56.224476.25ON73574817340.0
KNAG0M012306.25ON73875117210.0
KAFR0G026606.25ON73575017180.0
NCAS0H008606.25ON75576317200.0
CAGL0E02585g6.25ON73775617060.0
ZYRO0C07678g6.25ON74175717010.0
TPHA0J003706.25ON74377616890.0
Smik_15.1706.25ON77375116920.0
YOR001W (RRP6)6.25ON73375416860.0
KLTH0C11066g6.25ON73574216790.0
Skud_15.1626.25ON73476516520.0
TDEL0G044406.25ON73562616150.0
NDAI0D008506.25ON79073815970.0
TBLA0A071706.25ON77175415760.0
CAGL0L11726g8.225ON82599771.5
TBLA0B087003.30ON31670724.7
Ecym_70388.544ON80032726.1
ZYRO0E07260g6.233ON114942716.7
YPR108W (RPN7)3.423ON429176716.8
Skud_16.3933.423ON429176716.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3030
         (747 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...  1463   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   789   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   767   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   729   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   686   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   673   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   672   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   667   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   666   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   667   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   661   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   659   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   655   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   656   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   654   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   651   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   640   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   626   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   619   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   611   0.0  
CAGL0L11726g Chr12 complement(1252182..1254659) [2478 bp, 825 aa...    34   1.5  
TBLA0B08700 Chr2 (2074485..2075435) [951 bp, 316 aa] {ON} Anc_3....    32   4.7  
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    32   6.1  
ZYRO0E07260g Chr5 complement(551290..554739) [3450 bp, 1149 aa] ...    32   6.7  
YPR108W Chr16 (742454..743743) [1290 bp, 429 aa] {ON}  RPN7Essen...    32   6.8  
Skud_16.393 Chr16 (706811..708100) [1290 bp, 429 aa] {ON} YPR108...    32   6.9  

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score = 1463 bits (3787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/747 (95%), Positives = 715/747 (95%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
           SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDH                 TNMQYLNVD
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
           KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540
           DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 541 VSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRE 600
           VSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRE
Sbjct: 541 VSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRE 600

Query: 601 LLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXXXXXXXDDLK 660
           LLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTT               DDLK
Sbjct: 601 LLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTSNVESPSKEESKNNSDDLK 660

Query: 661 EDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKRKF 720
           EDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKRKF
Sbjct: 661 EDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKRKF 720

Query: 721 HSDLQGSIGAAAIKKPRSKGKTVSYKK 747
           HSDLQGSIGAAAIKKPRSKGKTVSYKK
Sbjct: 721 HSDLQGSIGAAAIKKPRSKGKTVSYKK 747

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/726 (56%), Positives = 509/726 (70%), Gaps = 15/726 (2%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           M+S ++D L  +I+ T+RAA++L+AQDIDF R L  SVG+ LD+TS  +VSL+NE++LS 
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + NN+L+ G+DN E +WK+LSN++DN+FEKSDH                  NMQYL   
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEG--VNMQYLADS 118

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           S  D   S+RI KPQL FK PVDN+E HPFKPLLK KPHALKPLEE   L  E E VPAH
Sbjct: 119 SHDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAH 178

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YPHPYEYEID QPY+DSVL ++E I+P  W+  EPIWVDN+ +L+ ML+ LK VKE+AVD
Sbjct: 179 YPHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVD 238

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQIS+R  DWLVDTIALR DL VLN I  DP+++KVFHGAFMD+I
Sbjct: 239 LEHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMI 298

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFA FKTSKKYQLADWR+RPL KP+
Sbjct: 299 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPL 358

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
           + YAR+DTHFLL+IYD LRN+L+K  KL+ VL+ASRNVAKRRFEYTSFRP++    V+SP
Sbjct: 359 RDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSP 418

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IE  +PWR LM QYN+P  KEPL++KLY+WRD VAR+DDESVRYVMPNQLLVSLV+L+PS
Sbjct: 419 IESTEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPS 478

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540
           + +G+L+V +Y+ D+VR+NAR L N+I +T+E IK+G+    S+   +++  +  +P  +
Sbjct: 479 ETAGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGT---ASVAEFSSSERALSNPAAT 535

Query: 541 VSL--IKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVND 598
           +SL  I+ +D HF+ LL E Q  +    S    SLLF   L   P AV Y +  K ++ D
Sbjct: 536 LSLHMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGD 595

Query: 599 RELLDRKSDLSQKFSK--VFKAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXXXXXXX 656
             L  RK  L QKF+   V     I   SH +  S N ++  D +               
Sbjct: 596 NVLQTRKHALLQKFTSQPVEPVTDIEAPSH-QSSSENPQVSEDISPSEPQESQNEVQKDE 654

Query: 657 DDLKEDKHEIIVL-KRKRDYGSNTKSTSKQPKKEHVDYNNVNSILD-NTSQQDKPNSGRH 714
            D   +K EI+VL K+K+ +    K TS  P  E VDY+N   +L   TS   K      
Sbjct: 655 PDF--EKSEIVVLRKKKKAHAQKPKGTSSSP-TETVDYSNAKEVLGKGTSSTAKRGDKDR 711

Query: 715 VDKRKF 720
             KRKF
Sbjct: 712 PRKRKF 717

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/756 (51%), Positives = 531/756 (70%), Gaps = 30/756 (3%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           MSSD  D LL+ ++GTVRAAS+L+AQD+DF + LD+ + + ++ +S  +++L+NEV+LS 
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + N+ +E GKDN + +WKD+ +I+DNLFEKSDH                 +N+QYL+  
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGN---SNVQYLDDS 117

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           S+ +   S+RI KPQL FK P+DN+E HPFKPLL+ KPHAL+PL E+   T ETE +P+H
Sbjct: 118 SRSNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSH 177

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YPHPY YEID Q Y++S+L I++PI    W++ +P+WVD   +L  +LN L++ KEIAVD
Sbjct: 178 YPHPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVD 237

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQISTRE DWLVDTIALR++L VLNEIFTDPS+LKVFHGAFMDII
Sbjct: 238 LEHHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDII 297

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLG+YVVSLFDTYHASR+LG P+HSLAYLLE FA FKTSKKYQLADWRIRPL+KPM
Sbjct: 298 WLQRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPM 357

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
           + YARADTHFLLNIYD+LRNSLI+++KL+ VLH SRNVAKRRFEYTSFRPK++S  VFSP
Sbjct: 358 RAYARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSP 417

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEKD+PWR LM QYN+P  +EPLMRKLY+WRD +AR+DDES RYVMPNQLLVSLV +AP+
Sbjct: 418 IEKDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPT 477

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPE-- 538
           DP+G+L+V ++I D+VR+N+++L N+I KT+E +K+G     S  N  ++ +  +D    
Sbjct: 478 DPAGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNG---DVSTNNAGSSQLEEKDLSQV 534

Query: 539 MSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKG-FLFDKPKAVAYNSVGKRLVN 597
           +S+S I+ M   F  L  +V+      +S+ + S+LF G  +F   +AV Y+   K +++
Sbjct: 535 LSISQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVID 594

Query: 598 DRELLDRKSDLSQKFSKV----FKAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXXXX 653
           + +L +RK ++S+K  +V    F+          +++S +     D              
Sbjct: 595 ENQLQERKLEVSEKLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVN----------RA 644

Query: 654 XXXDDLKEDKHEIIVL-KRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSG 712
              D L+ +K EIIVL K+KR    + K        E +DY N   +L N+ +     S 
Sbjct: 645 SETDPLETNKDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNSKKS----SK 700

Query: 713 RHVDKRKFHSDLQGSIGAAAIKKPR--SKGKTVSYK 746
           +   KR+F      ++G  + KK +  + GK +S+K
Sbjct: 701 QKTTKRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/731 (50%), Positives = 500/731 (68%), Gaps = 27/731 (3%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           MSS++KD LL+ ++ TVR++S+LAAQDIDF + LD+++   L++TS  I+SL+N+++LS 
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
              N+ ++ GKD+   +WK +SNI+DNLFEKSDH                  +++YLN D
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGG--PSLKYLNDD 118

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
            + + K S+RI KPQL FK PVDN+E HPFKPLL+ KPH+L+P E    +  E E +P+H
Sbjct: 119 DRSNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSH 178

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YPHPYEYEID+Q Y+DS+L   EPI   +WDE E IWVD +  LN M + L    E+A+D
Sbjct: 179 YPHPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAID 238

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQIS RE DW+VDTIALR++L +LN+IFTDP++ KV HGAFMDII
Sbjct: 239 LEHHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDII 298

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLY+V LFDTYHASR LGFPKHSLAYLLE FANFKTSKKYQLADWRIRPL+KPM
Sbjct: 299 WLQRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPM 358

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNI+DKLRNSL++++K+S VLH SR VAKRRFEY+SFRPKV S  VFSP
Sbjct: 359 LAYARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSP 418

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEKD+PW+ +M QYN+P  KE L+R+LY+WRD +AR+DDES RYVMPNQLLVSLV  AP+
Sbjct: 419 IEKDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPT 478

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEG-----QSIENVTTTYVSAQ 535
           +P  +L+V SY+ +H+R N++V+ N+I +T+E++K  S+       +S E+  T   +  
Sbjct: 479 EPINVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANI- 537

Query: 536 DPEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFL-FDKPKAVAYNSVGKR 594
              ++ S IK++   F  L  E+ S  +      E S+LF G    D   AV Y    + 
Sbjct: 538 ---ITTSQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRT 594

Query: 595 LVNDRELLDRKSDLSQKFSKVF---KAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXX 651
           L+   ELL R+ ++++   + +   +A  I + S+        E P   +          
Sbjct: 595 LIPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSN------EDEAPTQVSNDENRNEVIT 648

Query: 652 XXXXXDDLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEH--VDYNNVNSILDNTSQQDKP 709
                ++++E+K E+I L RKR   SN K  +  P   H  +DY   + +L++T  ++  
Sbjct: 649 SDPSQEEIEENKDEVITL-RKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNST--KNNT 705

Query: 710 NSGRHVDKRKF 720
           NS +H  KR+F
Sbjct: 706 NSQKH-KKRRF 715

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/767 (48%), Positives = 504/767 (65%), Gaps = 41/767 (5%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           MS D    LL+ ++ TVRAASSLAAQD+DF R+LD  +   L+E+S+ I +++N ++LS 
Sbjct: 1   MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
           ++ N +LE GK+ LE  WKD SN++DNLFEKSD                  +  QYL+  
Sbjct: 61  NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNK--SEFQYLSDS 118

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           +Q D   S+R+ KPQLQF  PVDNSE  PF PLL  KPH++K   +   +  E+E +P+H
Sbjct: 119 AQSDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSH 178

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           Y HPYE EID Q Y+ SVL + EP++   W+ +E  WVD   AL  ML+ LK   EIAVD
Sbjct: 179 YAHPYEVEIDKQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVD 237

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQISTR+ D+LVDT+ALR +L +LNE+F DP+ILKV HGAFMDII
Sbjct: 238 LEHHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDII 297

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLYVVSLFDTYHASRALGFP+HSLAYLLE +ANFKTSKKYQLADWR+RPLSKPM
Sbjct: 298 WLQRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPM 357

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNIYD++RN LI+E+KL+ VL  SRNVAKRRFEY+ FRPKV SP VF+P
Sbjct: 358 HAYARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTP 417

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEK++PWRTL+ QYNVP  K  L++++++WRDM+AR+DDES RY+MPNQL++SLV   P 
Sbjct: 418 IEKEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPI 477

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKS---GSHEG-QSIE-NVTTTYVSAQ 535
           DP+G+++V + + DHVR+N++V+ N+I K++E++KS   G+    Q+I+  +   + S +
Sbjct: 478 DPAGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDK 537

Query: 536 DPEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCE------DSLLFKGFLFDKPKAVAYN 589
              +++S I+ M   FK +       A  PS + +      D +LF      K + V Y+
Sbjct: 538 ---LTISQIQNMTALFKEI-------ASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYD 587

Query: 590 SVGKRLVNDRELLDRKSDLSQKFSKVFKAAGIAIG------SHIEKLSSNSELPADTTXX 643
              + +V + +L  R  ++ + F        +AI        H+E+  +  +   +    
Sbjct: 588 HDKRHVVTNEQLAGRAEEV-EGFMNEANNTTLAINIESSAEMHVEEPEAKEK---NALFS 643

Query: 644 XXXXXXXXXXXXXDDLKEDKHEIIVLK--RKRDYGSNTKSTSKQPKKEHVDYNNVNSILD 701
                         D  ED ++IIVLK  +KR    + K     P KE +DY+ +++IL 
Sbjct: 644 PPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTIL- 702

Query: 702 NTSQQDKPNS-GRHVDKRKFHSDLQGSIGAAAIKKPRSKGKTVSYKK 747
             S++ + NS  R  D     + L+G   AA  +K  ++GK VS+K+
Sbjct: 703 --SKEKRENSKKRKGDPFGEENGLEGP-KAAKKRKQINRGKNVSFKR 746

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/750 (47%), Positives = 482/750 (64%), Gaps = 26/750 (3%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           M+S+N D LL+K++  +RAASSLAAQD+DF R+LD    ++L   S  +  ++N ++LS 
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + ++ LE+ ++ +   WKD  NI+DNL EKSDH                  ++QYL   
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSA--ADLQYLGDF 136

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           S +D + ++R+ KPQL+FK P+DNSE HPF PLLK KP+ALKPL +   +    E  P H
Sbjct: 137 SGKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGH 196

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YPHPYEYEID+Q Y+ ++L IK  I    WD +EPIW+++   L  ML  LKN  EIAVD
Sbjct: 197 YPHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVD 256

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQ+STRE D+LVDT+ LR+DL +LNE+FT+PSI+KVFHGAFMDII
Sbjct: 257 LEHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDII 316

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FANFKTSKKYQLADWRIRPLSKPM
Sbjct: 317 WLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPM 376

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNIYD+LRN LI+ +KL+GVL+ SRNVAKRRFEY+ +RP   S  V+SP
Sbjct: 377 TAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSP 436

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
            EK++PWR LM QYN+   +E L++ LY+WRD++AR+DDES R++MPNQLL +LV   P 
Sbjct: 437 TEKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPI 496

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540
           D  G++++ + + DHVR NA++L N+I   +  +K    E  S E V++ + SA    ++
Sbjct: 497 DVIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKE--SAEIVSSKFKSASLEAIT 554

Query: 541 VSLIK-TMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDR 599
           VS I+  MDR   F  + V       S+    S+LF   L  +   + Y   G  L +  
Sbjct: 555 VSQIRDIMDRFSVFSSNSVTEDRSMDSTAS--SILFGKILPYEEGDIVYEDSG--LPHKV 610

Query: 600 ELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXXXXXXXDDL 659
           ++ D + D +Q+F+         +G  +E +    E P +                    
Sbjct: 611 KVEDMR-DRAQRFNSAL------VG--LEDIKFEVEKPVNVEKSEMVKIETTPEPPTK-- 659

Query: 660 KEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKRK 719
            ED  E++VLK+KR +       S    +E VDY+ + ++L +   Q+     +   KR+
Sbjct: 660 IEDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQN----NKQQRKRR 715

Query: 720 FHSDLQGSIGAAAIKK--PRSKGKTVSYKK 747
           F      S G  A KK  P ++GK VS+K+
Sbjct: 716 FDPSFNDSEGPRAPKKKRPTTRGKNVSFKR 745

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/748 (47%), Positives = 483/748 (64%), Gaps = 24/748 (3%)

Query: 4   DNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKA 63
           D + ++LT+++GT+RA+S+++AQD+DF + LD+++ E LDETS  ++SL+N+V++S    
Sbjct: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDN 66

Query: 64  NNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVDSQ- 122
           N+ +E G+  LE +W ++  ++D LFEKS+H                  N+QYL+ DSQ 
Sbjct: 67  NDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIG---NNLQYLD-DSQP 122

Query: 123 -RDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHY 181
             D  L+ +I KPQ  F  PVDN+E HPFKPLL  KP+AL+PL++V  LTVE E +PAHY
Sbjct: 123 LTDTTLT-KITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHY 181

Query: 182 PHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDL 241
           PHPYEYEID+Q YD+SVL I+ PI    W+E +  WVDN+  LNDM+  L   KE+A+DL
Sbjct: 182 PHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDL 241

Query: 242 EHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIW 301
           EHHDYR+YYG+ CLMQISTRE+DWLVDTIALR  L VLNEIFT+P ++KVFHGAFMD+IW
Sbjct: 242 EHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIW 301

Query: 302 LQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMK 361
           LQRDLGLY+VSLFDT+HASR LGFPKHSLAYLLE +A+FKTSKKYQLADWRIRPLSKP+K
Sbjct: 302 LQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLK 361

Query: 362 TYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPI 421
            YARADTHFLLNIYD++RNSLI++ KL+  LH SR VAKRRFEYT FRP V++  V+SP+
Sbjct: 362 AYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPV 421

Query: 422 EKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSD 481
           E++DPWR+L+  YN+P  K  L+++LY+WRD +AR+DDES RYVMPNQLLV+LV  AP+D
Sbjct: 422 EREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTD 481

Query: 482 PSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMSV 541
             GLL+V S++ +HVR+NA+ L  +I KT+    S         N   +  S  D ++S 
Sbjct: 482 TYGLLSVTSFVTEHVRSNAKSLSQLIKKTL---ASPQDLFTDQINHMDSNKSMVDSKLSP 538

Query: 542 SLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDREL 601
             +K   ++F     + +   +   +V     LF G        V+Y       +    L
Sbjct: 539 GDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVL 598

Query: 602 LDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXXXXXXXDDLKE 661
            DR+  ++Q  +         +   ++     +  P  +                  LKE
Sbjct: 599 DDRRELVAQNITTTAN-----VTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKE 653

Query: 662 DKHEIIVLKRKR---DYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKR 718
           DK EI+VLKR++      S  K+    P KE +D+ N   I+  T+     +  R   KR
Sbjct: 654 DKDEIVVLKRRKALPQSSSPPKNAEGNP-KEILDFKNNKKIMTATA-----SVPRKSTKR 707

Query: 719 KFHSDLQGSIGAAAIKKPRSKGKTVSYK 746
                +Q S      ++ +++G   S+K
Sbjct: 708 FDPYAIQASGPDGVKRRKKTRGIQKSFK 735

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/751 (47%), Positives = 481/751 (64%), Gaps = 17/751 (2%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           M S+ +  LL+K +GTVRA+SSL  QD+ F  +LDA+V   + E    ++ ++N+++ S 
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + +       + +  +W+D +N+ DNLFEKSD                  + +QYL+  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAG-SEVQYLDDL 119

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
              D    +RI KPQL F  PVDNSE  PFKPLL  KP+ALKPL+E   +   TE +P+H
Sbjct: 120 VGNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSH 179

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YP+PY+YEI NQ Y++ +L  + PI  + W E+EP+WVD+   L  +L  LK  KE+A+D
Sbjct: 180 YPNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAID 239

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQISTR++D+LVDTIALR +L +LN++FTDP + KVFHGAFMDII
Sbjct: 240 LEHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDII 299

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLY+VSLFDT+HAS+ALGFPKHSLAYLLET ANFKTSKKYQLADWRIRPLSKPM
Sbjct: 300 WLQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPM 359

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNI+D++RN LIK++KL+GVL  SR VAKRRFEY+ FRPK+  P VF+P
Sbjct: 360 SVYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTP 419

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEK+ PWRTLM QYNV   KE L++ LY+WRD +AR+DDES RY+MPNQLL+SL    P+
Sbjct: 420 IEKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPT 479

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQS--IENVTTTYVSAQDPE 538
           DP  L++V SY+ D VR+N++VL N+I   +E  K G     +   EN +T +V      
Sbjct: 480 DPVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPFV------ 533

Query: 539 MSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVND 598
           +++S IK +   F  L +  QS + +  S  + S  F G L      V+YN      V+ 
Sbjct: 534 LTLSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFF-GDLSKGKVTVSYNDAKTTPVS- 591

Query: 599 RELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXXXXXXXDD 658
           + +L+ +S    ++ K F      I S +E +  +  +P+ TT                +
Sbjct: 592 QSVLESRSKQFNEYMKAFGDIEYKIPSIVEPV-MDLPIPSGTTSTESADSKTVEKPPK-N 649

Query: 659 LKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKR 718
           +KED  EI+VLK+ +      K   +  ++E VDY+  + +L    +Q       + +K+
Sbjct: 650 IKEDMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVL--VQRQFDKKKKNNNNKK 707

Query: 719 KFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747
           +F      S G  A KK +  +KGK  S+K+
Sbjct: 708 RFDPFSAISEGPKAPKKRKAVTKGKNASFKR 738

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/750 (47%), Positives = 482/750 (64%), Gaps = 35/750 (4%)

Query: 9   LLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANNDLE 68
           LL+ ++ TVRA+S+LAAQD+DF R LD+ V   ++E +  +  ++N +ILS  +    L+
Sbjct: 9   LLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLD 68

Query: 69  VGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTN--MQYLNVDSQRDGK 126
            GK+ L  +WK LSNI+DNLFEKSD                  TN   +Y    +  +  
Sbjct: 69  EGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKP----TNPPFEYFENATTTENI 124

Query: 127 LSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPHPYE 186
             +RI KPQL+F  P+DNSE HPF PLLK KP+ALK ++E + L    E VP HY HPYE
Sbjct: 125 PQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYE 184

Query: 187 YEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEHHDY 246
           YEIDNQPY+DS+L ++EPI   +W E E +WVDN+ +LN MLN +K   EIA+DLEHHDY
Sbjct: 185 YEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDY 244

Query: 247 RSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQRDL 306
           R+YYG+VCLMQISTRE+D+LVDTIALR DL+VLNE+FTDPS++KV HGAFMDIIWLQRDL
Sbjct: 245 RTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDL 304

Query: 307 GLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYARA 366
           GLY+VSLFDT+HASRALGFP+HSLAYLLE FANFKTSKKYQLADWR+RPLSK M  YARA
Sbjct: 305 GLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARA 364

Query: 367 DTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPIEKDDP 426
           DTHFLLNIYD+LRN L++ +KL GVL+ SRNVAKRRFEY+ FRP+V SP V+S +EK+DP
Sbjct: 365 DTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDP 424

Query: 427 WRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPSGLL 486
           WRTLM QYN+P  +E L++ L++WRDM+AR+DDES RY+MPNQL+V+LV   P+DP+G++
Sbjct: 425 WRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVI 484

Query: 487 TVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMSVSLIKT 546
           +    + D+VR+N++++ N+I   +   K  + + Q + +  T        +M+VS IK 
Sbjct: 485 SASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQIKE 544

Query: 547 MDRHFKFLL--------DEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVND 598
               F  +         D+ QS +   S+       + G L  K   + Y +  K  V  
Sbjct: 545 TASVFIQIAEKLGTCNNDQQQSKSFARSN-------YFGSLSKKLDIIEYKNGEKHSVKQ 597

Query: 599 RELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXXXXXXXDD 658
           ++L+ R +  +++ +++       +  H E      +L  D                  +
Sbjct: 598 QQLVSRFNTYTKQVNELTNVR-YELPVHKEP----PQLQKDDVEEVKKTIIADSIPAKPE 652

Query: 659 LKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKR 718
           +  D  E++VLK+     + TK   +  K + +DY+    IL    Q+ K    R   KR
Sbjct: 653 I--DLDEVVVLKKVNRQPNKTK-LEENEKIDFIDYSKSEKILKGDKQRKK----RESKKR 705

Query: 719 KFHSDLQGSIGAAAIKKPRS--KGKTVSYK 746
           +F      + G  A +K +S  +G+ +SYK
Sbjct: 706 QFDPFAASNEGPKAARKRKSGTRGRNLSYK 735

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/763 (45%), Positives = 486/763 (63%), Gaps = 29/763 (3%)

Query: 2   SSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTS 61
           S + +  LL K++ TVRAAS+LAAQD+DF R +D  +   L+++S  I  ++N V+LS  
Sbjct: 5   SQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSID 64

Query: 62  KANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVDS 121
           + +  ++  K+NLE  WKD  N++DNLFEKSD                  + MQY++  S
Sbjct: 65  ENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQ--SGMQYIDEFS 122

Query: 122 QRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHY 181
            RD    ++I+KPQL+F  P+DN+E HPF PLLK KP ALKPLEE   +  E E  P HY
Sbjct: 123 GRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHY 182

Query: 182 PHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDL 241
           P PYEYEID+Q Y+D +L  K+PI  ++W +NEPIWVD ++ L  ++  L+   EIAVDL
Sbjct: 183 PQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDL 242

Query: 242 EHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIW 301
           EHHDYR+YYG+ CLMQISTR++D+L+DT+ALR+DLQ+LN +F +P I KVFHGAFMDIIW
Sbjct: 243 EHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIW 302

Query: 302 LQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMK 361
           LQRDLGLYVV LFDT+HASRA+G PKHSLAYLLE FA FKTSKKYQLADWRIRPLSK M 
Sbjct: 303 LQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMH 362

Query: 362 TYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPT--VFS 419
            YARADTHFLLNI+D++RNSLI+++KL+GVL  SRNVAKRRFEY+SFRPKVL     V+S
Sbjct: 363 AYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYS 422

Query: 420 PIEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAP 479
           PIEKDDPW+T+M QYN+P  KEPL+++LY+WRD +AR+DDES R+VMPNQLLVSLV   P
Sbjct: 423 PIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTP 482

Query: 480 SDPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSI--ENVTTTYVSAQD- 536
            D  G+++V + + D+VR+N+++L N+I   + ++K       ++  E ++    +  D 
Sbjct: 483 IDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDL 542

Query: 537 -PEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRL 595
             ++++  ++ +   F+ L D+  +      S  +   LF G  F     + Y + GK  
Sbjct: 543 SQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQ 602

Query: 596 VNDRELLDRKSDLSQKFSKVFKAA-----GIAIGSHIEKLSSNSELPADTTXXXXXXXXX 650
               +  +R    S++F    K        I +    ++      +P  T          
Sbjct: 603 TTAEQYKER----SEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVN 658

Query: 651 XXXXXXDDLKEDKHEIIVLKRKRDYGS--NTKSTSKQPKKEHVDYNNVNSIL--DNTSQQ 706
                 +DL     E+IVL++     S  N     ++P+ E +DY     +L  D  S+ 
Sbjct: 659 EMIEKPEDL----DEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRG 714

Query: 707 DKPNSGRHVDKRKFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747
            + N+G    +++F      + G AA KK +  ++GK VS+K+
Sbjct: 715 GRNNNGNK--RKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/756 (47%), Positives = 485/756 (64%), Gaps = 28/756 (3%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           MSSD+ D +L K++ TVRA+++LA+QD++F + +D SV   L+++ + + S++N ++LS 
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
              N  L+   +NLE   K+ SN++D LFEK+D                   NMQ+L+  
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKK--NMQFLDDV 118

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           +  +   S+RI KPQL FK PVDNSE HPFKPLL  KP+ALK +EE + L + TE +P H
Sbjct: 119 NVAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEH 178

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           +  PYEYEI NQ Y++ +L  KEPI  ++W +   IWVDNI +L DM+  LK   EIAVD
Sbjct: 179 FQQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVD 238

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHD+RSYYGLVCLMQISTR  D++VDTIALR DL++LNE+FT+P I KVFHGAFMDII
Sbjct: 239 LEHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDII 298

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLY+VSLFDT+HAS+ALG PKHSLAYLLE +ANFKTSKKYQLADWR RPLSK M
Sbjct: 299 WLQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAM 358

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNI+D++RN LI   KL+GVL  SRNVA RRFEY+ ++PK+    +F+P
Sbjct: 359 MAYARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTP 418

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           +EK+ PWRTLM QYN+P  KEPL+R+LY+WRDM+AR+DDES RYVMPNQLLVSLV   P 
Sbjct: 419 VEKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPV 478

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540
           DP  +++V S + DHVR N++ L N+I K +EEIK G  E +SI N   + +     E+ 
Sbjct: 479 DPISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLG--EVKSINNRLPSSLDVSQDELQ 536

Query: 541 V---SLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVN 597
                 I+ M   FK + +++ + A +       S++    L     AV Y++     V 
Sbjct: 537 FLPSHKIELMTGAFKEIENQL-TQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVE 595

Query: 598 DRELLDRKSDLSQKFSKVFKAAGIAIGSHIEKL--SSNSELPADTTXXXXXXXXXXXXXX 655
           + EL DR       +    KA  +A   +I  +  +SNS  P +T               
Sbjct: 596 ESELKDR-------YLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIP 648

Query: 656 XDDLKEDKHEIIVLKRKRDYGSNTKSTSKQPK--KEHVDYNNVNSILDNTSQQDKPNSGR 713
             + +ED  EI+VLK+K+ + ++ K+        +E VDY+  N +  +  +  K +   
Sbjct: 649 --EKQEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDK-- 704

Query: 714 HVDKRKFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747
              KR F        G  A KK R  +KGK +S+KK
Sbjct: 705 ---KRVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 737

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/757 (47%), Positives = 492/757 (64%), Gaps = 26/757 (3%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           M+ ++ + LL K++GTVRAA++LAAQD+DF R LD  V + LD+TS  +VS++N  +L  
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + +  LE GK+ LE + KD SN++DNLFEKSD                    + YL+  
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAA---LMYLDDA 117

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           ++ D   ++RI+KPQ++F+ P+DN+E HPFKPLL+ KPHAL+PL +   L    E +P H
Sbjct: 118 ARSDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEH 177

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YP PYEYEI+NQ Y++S+L I EPI    WD +EP+WVDN  +L+ ML  LK   EIAVD
Sbjct: 178 YPQPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVD 237

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQ+STR++D+LVDT+ALR DL VLNE+F +P I+KVFHGAFMDII
Sbjct: 238 LEHHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDII 297

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLY+VSLFDTYHASRALGFP+HSLAYLLETFA+FKTSKKYQLADWR+RPLSK M
Sbjct: 298 WLQRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAM 357

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNIYD+LRN LI E+KL+GVL  SRNVAKR F+Y+ +RPKV + +V+SP
Sbjct: 358 SAYARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSP 417

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           +++ D W+ LM+QYN+P  KE L++ LY+WRD +AR+DDES RYVMPNQLL  LV   P 
Sbjct: 418 VDRADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPL 477

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVT-------TTYVS 533
           DP+G+++V   + DHVR NA+ L N+I K++++I     + + +E+V        +  ++
Sbjct: 478 DPTGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIK-VESVQHKDQHDLSQVLT 536

Query: 534 AQDPEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGK 593
               E  VS    + + FK L           SS    S++F   L      V Y    K
Sbjct: 537 VGQIESQVSQFHDLSKAFKGLSQGTN------SSNSSSSIIFGNILHAPCGFVGYGRSLK 590

Query: 594 RLVNDRELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSEL---PADTTXXXXXXXXX 650
           + V D+++  RK +LS+     F  A  A  + I++    SEL   PAD           
Sbjct: 591 KPVTDKQIEKRKLELSEALE--FIDAETA--TTIQEEDRGSELTHEPADDKKVSENDESK 646

Query: 651 XXXXXXDDLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPN 710
                  + +EDK+EII LK+ +D G  +K +++   +E +DY     IL+   +     
Sbjct: 647 KEEAKETEPEEDKNEIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKILETEKKSKS-T 705

Query: 711 SGRHVDKRKFHSDLQGSIGAAAIKKPRSKGKTVSYKK 747
             R  D     +D  G+      K+  ++GK+ S+K+
Sbjct: 706 KKRAFDPYAASND-AGNAPKPKKKRRMARGKSASFKR 741

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/776 (45%), Positives = 485/776 (62%), Gaps = 67/776 (8%)

Query: 5   NKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKAN 64
           N D LL  ++ +VRAAS+LAAQD+DF R LD  +   L  TSQ +  ++N +I S  + +
Sbjct: 2   NADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENS 61

Query: 65  NDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVDSQRD 124
             L  GK+NL+ +WKD+ N++D+LFE +DH                   M+YLN     +
Sbjct: 62  EGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSND--PKMKYLNDSLNFE 119

Query: 125 GKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPHP 184
                R+ KPQL F +PVDNSE HPF+PLL  KP+A+ PL+EV  +   TE  P HYP P
Sbjct: 120 SDNVTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQP 179

Query: 185 YEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEHH 244
           YE EID Q Y++ VL   +PI    W+E E IWVDN  +L  MLN LK   E+AVDLEHH
Sbjct: 180 YETEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHH 239

Query: 245 DYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQR 304
           D+RSYYG+ CLMQISTR +D+LVDTIALR  LQVLN +FTDP I K+ HGAFMDIIWLQR
Sbjct: 240 DFRSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQR 299

Query: 305 DLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYA 364
           DLGLY+VSLFDTYHASRALGFP+HSLAYLLE FA+FKTSK+YQLADWR RPLSK M  YA
Sbjct: 300 DLGLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYA 359

Query: 365 RADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPIEKD 424
           RADTHFLLNI+D+LRN LI+EDKL+ +LH SR VAKRRFEY+ ++P + S  VFSP E D
Sbjct: 360 RADTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESD 419

Query: 425 DPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPSG 484
            PWR+++ QYN+P  K  L+++L++WRD +AR+DDES RY+MPNQL+ SLV   P++P+G
Sbjct: 420 MPWRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAG 479

Query: 485 LLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVS--AQDPE---- 538
           +++V   + D VR+NA+ + N+I  T+E++K+         N++TT VS  A+D E    
Sbjct: 480 VISVNRMMTDPVRSNAKAIANLIKSTLEDMKNN--------NISTTVVSTTAKDKETSSN 531

Query: 539 -MSVSLIKTMDRHFKFLLDEVQSHAVEPSSVC----EDSLLFKGFLFDKPKAVAYNSVGK 593
            +S S IK +   F+ +L++  S+    + V     +DSL+F      +   + Y+   K
Sbjct: 532 DLSTSQIKFIVSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTK 591

Query: 594 RLVNDRELLDRKSDLSQKFSKVFKAAGIAIGSHI---------------EKLSSNSELPA 638
            L+ +++L DR+ ++    + + +A  IA    +               E++ S S LPA
Sbjct: 592 HLITEQQLSDRQKEVD---AAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPA 648

Query: 639 DTTXXXXXXXXXXXXXXXDDLKEDKHEIIVLKRKRDYGSNT-KSTSKQPKKEH--VDYNN 695
                              + +ED  EIIVLK  +D  +   +   +    +H  +DY+ 
Sbjct: 649 ---------------FEDKEEQEDLDEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSK 693

Query: 696 VNSILDNTSQQDKPNSGRHVDKRKFH----SDLQGSIGAAAIKKPRSKGKTVSYKK 747
            + IL   +++  PN      KRK+      + + ++  A  ++P +K + VS+K+
Sbjct: 694 GDKILSQDNRRRTPN------KRKYDPFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/751 (46%), Positives = 478/751 (63%), Gaps = 22/751 (2%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           M+S N D LL+K++  +RAASSLA QD+DF ++LD   G++L   S  +  + NE+ILS 
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + +   E+  +++   W D  NI+DNL E SDH                  ++QYL   
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNG--ADLQYLGDF 158

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           S+++   ++R+ KPQL+FK P+DNSE HPF PLLK KP+ALKPL +   L  E +  P+H
Sbjct: 159 SEKNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSH 218

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YPHPYEYEID+Q Y  ++L I++ I   +W+++EPIW+D +  L  ML  LKNV+EIAVD
Sbjct: 219 YPHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVD 278

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQISTRE D+LVDT+ LR+ L +LNE+FTDPSI+KVFHGAFMDII
Sbjct: 279 LEHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDII 338

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FANFKTSKKYQLADWRIRPLSKPM
Sbjct: 339 WLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPM 398

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNIYD+LRN LI+ +KL+GVL+ SRNVAKRRFEY+ +RP++ S  V+SP
Sbjct: 399 IAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSP 458

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEK+ PWR LM QYN+   KE L++ LY+WRD++AR+DDES R+VMPNQLL +LV   P 
Sbjct: 459 IEKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPI 518

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540
           D  G++++ + I +HVR NA+VL N+I  ++  IK    E   +    +         ++
Sbjct: 519 DVIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAIT 578

Query: 541 VSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRE 600
           +  I+ +   F  L +   S+    +     S+L    L  +   +AY + G  L N  +
Sbjct: 579 IPQIRDIMERFSVLSNSNVSNCRAKNGATP-SILLGRILPLEENDIAYKNNG--LPNRVK 635

Query: 601 LLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELP--ADTTXXXXXXXXXXXXXXXDD 658
             D ++  +Q F+           S++E      E P    T                  
Sbjct: 636 FEDIRAR-AQSFNSAL--------SNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSA 686

Query: 659 LKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKR 718
             E+  +I+VLK+K  + + + +      ++ +DY+ + ++L + S Q++    R   KR
Sbjct: 687 TIENPDDIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNR----RQQKKR 742

Query: 719 KFHSDLQGSIG--AAAIKKPRSKGKTVSYKK 747
           +       S G  AA  K+P ++G+ VS+K+
Sbjct: 743 RSDPLFNDSDGPRAAKKKRPATRGRNVSFKR 773

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/754 (46%), Positives = 475/754 (62%), Gaps = 28/754 (3%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           M+S+N D LL++++  VRAASSLA+QD+DF ++LD    + L   +  +  + NE+ILS 
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + +   E+ ++++   W +  NI+DNL E SDH                 +++QYL   
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRG--SDLQYLGEF 118

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           S ++   ++R+ KPQL+FK P+DNSE HPF PLLK KP+ALKPL E   L  + E  P+H
Sbjct: 119 SGKNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSH 178

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           YPHPYEYEID+Q Y   +L I+E I   +WD++ PIWVD  T L  ML  LKN KEIAVD
Sbjct: 179 YPHPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVD 238

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQISTRE D+LVDT+ LR++L +LNE+FT+PSI+KVFHGAFMDII
Sbjct: 239 LEHHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDII 298

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FANFKTSKKYQLADWRIRPLSKPM
Sbjct: 299 WLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPM 358

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNIYD+LRN LI+ +KL+GVL+ SRNVAKRRFEY+ +RP   S  V+SP
Sbjct: 359 TAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSP 418

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEK+ PW+ LM QYN+P  +E L+R+LY+WRD++AR+DDES R+VMPNQLL +LV   P+
Sbjct: 419 IEKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPT 478

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540
           D  G++++ + + +HVR NA++L N+I   +  IK+ + E   I +  T         +S
Sbjct: 479 DVIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETIS 538

Query: 541 VSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRE 600
           V  I+ +   F  L +   S +     V   S+L    L  +   +AY+  G  L N  +
Sbjct: 539 VPQIRDVMERFSVLCNSNISKS-RAKPVTNSSILLGKILPREEHDIAYSKDG--LPNKVK 595

Query: 601 LLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPA-----DTTXXXXXXXXXXXXXX 655
             D +       ++ FK+A   +   I ++     +P       T               
Sbjct: 596 TEDIRIR-----AQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDN 650

Query: 656 XDDLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHV 715
            DDL       +VLK+K              +K+ VDY+ + +IL N   Q+     R  
Sbjct: 651 LDDL-------VVLKKKNIQKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQN----NRQQ 699

Query: 716 DKRKFHSDLQGSIGAAAIKK--PRSKGKTVSYKK 747
            KR+F      S G  A KK  P +KGK +S+K+
Sbjct: 700 KKRRFDPSSSDSNGPRAAKKRRPAAKGKNLSFKR 733

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/742 (46%), Positives = 473/742 (63%), Gaps = 21/742 (2%)

Query: 8   ALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANNDL 67
           ++L +++ T+RA+S++ AQD+ F ++LD S+   ++  S  ++ L+N+++LS  + N+ +
Sbjct: 11  SVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDII 70

Query: 68  EVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVDSQRDGKL 127
           E G + LE+AW ++  ++D LFEKS+H                   +QYL+         
Sbjct: 71  EQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSK---TVQYLDDSPSLHDGA 127

Query: 128 SQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPHPYEY 187
            ++I+KPQL FK P+DNSE HPFKPLLK KPHAL+ L+E   LT E E VPAHYP PYEY
Sbjct: 128 PKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEY 187

Query: 188 EIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEHHDYR 247
           EID+Q Y++SVL I EP+    WDE E  WVDN  AL  MLN L    EIA+DLEHHDYR
Sbjct: 188 EIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYR 247

Query: 248 SYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQRDLG 307
           +YYG+ CLMQISTRE DWL+DTIALR DL +LNE+FTDP I KV HGAFMDIIWLQRDLG
Sbjct: 248 TYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLG 307

Query: 308 LYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYARAD 367
           LY+VSLFDTYHASR LG PKHSLAYLLE +A+FKTSKKYQL+DWR+RPL K +K YARAD
Sbjct: 308 LYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARAD 367

Query: 368 THFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPIEKDDPW 427
           THFLLNIYD +RNSLI+++KLS VLH SRNVAKRRFE+T+FRPK+++  VFSPIE++DPW
Sbjct: 368 THFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPW 427

Query: 428 RTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPSGLLT 487
           RTLM QYN+P  K  L+R+LY+WRDMVAR+DDES RYV+PNQLLVSL   AP+ P+ ++ 
Sbjct: 428 RTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMA 487

Query: 488 VKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMSVSLIKTM 547
             +++ +H+R NA+ L  +I K++E   S S+E   + N   T  ++   +MS   I+  
Sbjct: 488 TSTFVTEHIRQNAKSLALLIKKSLE---SSSNEFGQLLNSANTVQNSSPTKMSSEDIEKN 544

Query: 548 DRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRELLDRKSD 607
            R F+  L++          +   S LF+       + V+Y      LV+   L +R+  
Sbjct: 545 SRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQ 604

Query: 608 LSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTXXXXXXXXXXXXXXXDDLKEDKHEII 667
           +S+K+      A   +  HI   SS++    +                    KE+  E+I
Sbjct: 605 VSKKYEAERDIARPQV--HIRAASSHAVCDKEAGAEDNESAEEENKAR----KEEMDEVI 658

Query: 668 VLKRKRDYGSNTKST--SKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKRKFHSDLQ 725
           VLK+++      +       P  E +D  +   IL      + P++     K++F     
Sbjct: 659 VLKQRKTLADKEQRAVDKATPSIEPLDLQSARKIL------EAPSNNVRRPKKRFDPYAT 712

Query: 726 GSIGAAAIKK-PRSKGKTVSYK 746
            + G  ++KK  ++KG   S++
Sbjct: 713 LAAGPPSVKKRKKTKGLQKSFR 734

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/765 (46%), Positives = 469/765 (61%), Gaps = 49/765 (6%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           M S+N D L +KI+  VRAASSLA+QD+DF ++L+     +L   S  +  ++NE+ILS 
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + +   E+ +D +   WKD  NI+DNL E SDH                   +QYL   
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSG--AELQYLGDF 118

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           S +D   ++R+ KPQL+FK  +DNSE HPF PLLK KP+ALKPL E   L    E  P+H
Sbjct: 119 SGKDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSH 178

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           Y HPY YEID+Q Y   VL IK+ I   +WD++EPIW+D  T L  ML  LKN  EIAVD
Sbjct: 179 YLHPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVD 238

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQ+STRE D+LVDTI LR  L +LNE+FTDP I+KVFHGAFMDII
Sbjct: 239 LEHHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDII 298

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FANFKTSKKYQLADWR RPLSKPM
Sbjct: 299 WLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPM 358

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNIYD+LRN LI+ +KL+GVL+ SRNVAKRRFEY+  RP+  S  V+SP
Sbjct: 359 TAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSP 418

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEK++PWR LM QYN+   KE L++ LY WRD +AR+DDES R+VMPNQLL +LV  AP 
Sbjct: 419 IEKENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPI 478

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540
           D  G++++ + + +HVR NA+VL N+I   +  IK  + +  SI +  +         ++
Sbjct: 479 DVIGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISLEVIT 538

Query: 541 VSLIKTMDRHFKFLLDE-VQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDR 599
           +S I+ +   F  L +  V ++  +        LL K   F++   ++Y   GK+   ++
Sbjct: 539 ISQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEEC-GISY---GKKGTPNK 594

Query: 600 ELLDRKSDLSQKFSKVFKA---------------AGIAIGSHIEKLSSNSELPADTTXXX 644
             ++     +QKF+                    A +  G  +E + S  ELP+      
Sbjct: 595 VKVEDIKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVE-IESAPELPSKA---- 649

Query: 645 XXXXXXXXXXXXDDLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTS 704
                           E   +IIVLK+K+ +            KE VDY+ + S+L +  
Sbjct: 650 ----------------ESFDDIIVLKKKKMHKKQPAKGKDMTVKEAVDYSKMPSVLSSKP 693

Query: 705 QQDKPNSGRHVDKRKFHSDLQGSIG--AAAIKKPRSKGKTVSYKK 747
            Q++    +   KR+F      S G  AA  K+P  +GK +S+K+
Sbjct: 694 GQNR----KQQRKRRFDPSSNDSEGPRAAKKKRPAPRGKNMSFKR 734

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/626 (51%), Positives = 417/626 (66%), Gaps = 20/626 (3%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           M    +D LL K++ T+RA+S+LAAQD+DF R L   +G+ LDETS  +VSL+N ++ S 
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            + +  L  GK+ L   WKD SN++DNLFE SD                    +++L+  
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSD--CSADILTRAPGSRKDGEKLKFLDNS 118

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           S  D   S+RI KPQL FK PV+N+E  PF PLLK KP AL+PL  +S +    + VP H
Sbjct: 119 SSNDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPL--ISDIVPGNDAVPEH 176

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           Y  PYEYEI++Q Y +SV+   EPI    W+  E +WVDNI  L  M++ LK+V EIAVD
Sbjct: 177 YAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVD 236

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHDYRSYYG+VCLMQISTRE D+L+DTIALR DLQ+LNE+F +P ILKVFHGAFMDII
Sbjct: 237 LEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDII 296

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLYVVSLFDT+HASRA+G P+HSLAYLLE FANFKTSKKYQLADWR+RPLSK M
Sbjct: 297 WLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAM 356

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YARADTHFLLNIYD+LRN+LI+++KL+GVL  SRNVAKRRFEY+ FRP   SPTV+ P
Sbjct: 357 NAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCP 416

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           I+K DPW+ LM QY++   +E L++KLY WRD +AR+DDES RYVMPNQLLV L   AP+
Sbjct: 417 IDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPT 476

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTM----EEIKSGSHEGQSIENVTTTYVSAQD 536
           +P  +++V S + DHVR+N+ VL ++I  T+    +E   G+ E  +      + ++   
Sbjct: 477 EPINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVPQ 536

Query: 537 PEMSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRL- 595
            +   +    + R F  L +E +            S +F   L  +  AV Y  VG  + 
Sbjct: 537 IQKLAACFAGVSRAFTILQNEYKD--------GRSSSIFTDILTSEDDAVNY--VGNNMD 586

Query: 596 -VNDRELLDRKSDLSQKFSKVFKAAG 620
            +  +EL  R +   Q   +  +A  
Sbjct: 587 HITKKELGKRAAKALQSMEQFDEATS 612

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/738 (46%), Positives = 460/738 (62%), Gaps = 59/738 (7%)

Query: 6   KDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANN 65
           KD LL +++ TVRA+ +LAAQD+DF R +D +  + L ET+  +  ++N V+L+  + + 
Sbjct: 25  KDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSE 84

Query: 66  DLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVDSQRDG 125
            L+  K+NLE  WKD SN++DNL EKSD                  +NMQYL+  S RD 
Sbjct: 85  TLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNN--SNMQYLDEYSGRDD 142

Query: 126 KLSQR--IVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPH 183
             S+R  I KPQL+F +PVDN+E HPF PLLK KP+ALK L+E   L    E VP HY  
Sbjct: 143 TSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQ 202

Query: 184 PYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEH 243
           PYEYEIDNQPY+D +L + +PI    W E   IWVD   +L  M+  L N  E AVDLEH
Sbjct: 203 PYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEH 262

Query: 244 HDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQ 303
           HDYR+YYG+VCLMQISTR  D++VDT+ LR  LQ LNE FT+P I KV HGAFMDIIWLQ
Sbjct: 263 HDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQ 322

Query: 304 RDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTY 363
           RDLGLY+VSLFDT+HASRALGFPK+SLAYLLE F+NFKTSKKYQ+ADWRIRPLSK M +Y
Sbjct: 323 RDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSY 382

Query: 364 ARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPIEK 423
           AR+DTHFLLNI+D++RN L+++ KL+GVL  SRNVAKRRFEY  +RP + S  V+SPIEK
Sbjct: 383 ARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEK 442

Query: 424 DDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPS 483
            DPW+TLM QYN+P  KE L+++LY+WRD +AR+DDES RY+MPNQLLVSLV  AP +P+
Sbjct: 443 IDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPA 502

Query: 484 GLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGS---------HEGQSIENVTTTYVSA 534
           G+++V + + DHVR+N+++L N+I   + +IK  +          + Q   + TTT V  
Sbjct: 503 GVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDL 562

Query: 535 QDPEMSVSLIKTMDRHFKFLLDEVQ---------SHAVEPSS--VCEDSLLFKGFLFDKP 583
            + ++S+  + T+   F  L  +V           +A + +S  +C D + F     D  
Sbjct: 563 SE-QLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFND--EDGK 619

Query: 584 KAVAYNSVG---KRLVNDRELLDRKSDLSQKFSKVFKAA-GIAIGSH----IEKLSSNSE 635
             + Y SV    K  +   ELL R+    Q   ++ +    I I  +    +E       
Sbjct: 620 NFIKY-SVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPS 678

Query: 636 LPADTTXXXXXXXXXXXXXXXDDLKEDKHEIIVLKRKRDYGSNTKSTSKQPKK------- 688
           +PA                     KED  EIIVLK+     +N     K+ +K       
Sbjct: 679 IPAANAEITTAVASRK--------KEDLDEIIVLKK-----TNRNKGKKRERKHSDDDDE 725

Query: 689 ---EHVDYNNVNSILDNT 703
              E +DY+ +  +LDN+
Sbjct: 726 GEIEVIDYSKMEKVLDNS 743

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/754 (44%), Positives = 458/754 (60%), Gaps = 15/754 (1%)

Query: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60
           MS DN + LL  I+G VRA+++LAAQD+DF + LD  V + L++T+   + + N ++LS 
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHXXXXXXXXXXXXXXXXXTNMQYLNVD 120
            +  + LE GKD +   W   SNI+DNL EKSDH                 T   +L+ +
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETT--FLDNN 143

Query: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180
           S+ +   S+RI KPQL F  PVDN++  PFKPLL  KP+ALKPL++   L  E+  VP H
Sbjct: 144 SRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTH 203

Query: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240
           Y  PYEYEIDNQ Y++ V+ I++P     W+    IW+D   +L D+L  L+   EIAVD
Sbjct: 204 YLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVD 263

Query: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300
           LEHHD RSYYG+ CLMQISTRE D++VDTI+LR DL VLNEIFT+P+I KVFHGA MDII
Sbjct: 264 LEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDII 323

Query: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360
           WLQRDLGLY+VSLFDT+HAS+ALG  +HSLAYLLE +A+FKTSKKYQLADWR RPL+  M
Sbjct: 324 WLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNM 383

Query: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420
             YAR+DTHFLLNI+D+LRN+LIK++KL+GVLH SRNVAKRRFEY  FRP V  P +++ 
Sbjct: 384 LAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTL 443

Query: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480
           IEK+ PW++L+ QYN+ D KE L++KL++WRDM+AR+DDES RY+MP Q+L+SL++  P+
Sbjct: 444 IEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPT 503

Query: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEM- 539
           D SG+++V + + +HVR+N+  L N+I K +E  KS  +   S      +        + 
Sbjct: 504 DSSGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLI 563

Query: 540 SVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDR 599
           S++ I  +   F  L     +     S +   SLLF   +   PK   Y+          
Sbjct: 564 SITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSE 623

Query: 600 ELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSS---NSELPADTTXXXXXXXXXXXXXXX 656
           +++ R   LS+    +           +E + S    +E P  T                
Sbjct: 624 DMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTK---- 679

Query: 657 DDLKEDKHEIIVLKR-KRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHV 715
            ++ ED  EIIVLK+  R Y    K   K      VDY+    I     +    NS +  
Sbjct: 680 -EINEDNEEIIVLKKVNRKYQKGKKDADKD-STVVVDYSKAKKIFQKKDETINGNSKKRK 737

Query: 716 DKRKFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747
               +++D        A+KK +  ++GK +SYK+
Sbjct: 738 SFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>CAGL0L11726g Chr12 complement(1252182..1254659) [2478 bp, 825 aa]
           {ON} similar to uniprot|P14736 Saccharomyces cerevisiae
           YER162c RAD4 excision repair protein
          Length = 825

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 7/99 (7%)

Query: 307 GLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYARA 366
           G+    +FD  H  +    P  S   LL+     K + +     WRI    K +  Y R 
Sbjct: 187 GMIPEKVFDMLHPEKDEELPLRSTRKLLD---GLKKAMEIWQKHWRIMQRYKGVNCYMRY 243

Query: 367 DTHFLLNIYDKLRNSLIKEDKLSGVLH--ASRNVAKRRF 403
                L I DK R +L K D + G+L     R+VA + F
Sbjct: 244 WDE--LQICDKSRKTLTKNDFIKGILKGVGDRDVATQGF 280

>TBLA0B08700 Chr2 (2074485..2075435) [951 bp, 316 aa] {ON} Anc_3.30
           YNL315C
          Length = 316

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 418 FSPIEKDDPWRTLMSQYNVPDIKEPLMRKL-YKWRDMVARKDDESVRYVMPNQLLVSLVT 476
           F P  K +P++TL S   +  IKE   ++  Y WR   ++ +D S+  V+P+ +   ++T
Sbjct: 108 FDPSIKQEPFKTLDSYVKLDKIKELSRQECEYLWRTRWSKIED-SLHAVIPSDVFERMIT 166

Query: 477 LAPSDPSGLL 486
           +A  +P  +L
Sbjct: 167 IAKQNPMFVL 176

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 214 EPIWVDNITALNDMLNGLKNVKEIAVDLEHHD 245
           EP  VDNIT+   + +G+K++   A+D+E H+
Sbjct: 256 EPNAVDNITSQETLTDGIKDISAGAIDVESHN 287

>ZYRO0E07260g Chr5 complement(551290..554739) [3450 bp, 1149 aa] {ON}
            similar to uniprot|P53125 Saccharomyces cerevisiae
            YGL133W ITC1 Component of the ATP-dependent Isw2p-Itc1p
            chromatin remodeling complex required for repression of
            a- specific genes repression of early meiotic genes
            during mitotic growth and repression of INO1
          Length = 1149

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 6    KDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQ 47
            K+ L TKILGT    ++   Q I     +DA + E++D+TS+
Sbjct: 1100 KNQLSTKILGTALRKNASGKQKIKIVETVDAKLKEIMDQTSR 1141

>YPR108W Chr16 (742454..743743) [1290 bp, 429 aa] {ON}
           RPN7Essential, non-ATPase regulatory subunit of the 26S
           proteasome, similar to another S. cerevisiae regulatory
           subunit, Rpn5p, as well as to mammalian proteasome
           subunits
          Length = 429

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 81/176 (46%), Gaps = 40/176 (22%)

Query: 213 NEPIWV-DNITALNDMLNGLKNVKEIAVDLEHHD-YRSYYGLVCLMQISTRE-SDWLVDT 269
           N+ ++V + + A+N M+       E   D E  + Y++YYG+ CL   + +E +  LVD+
Sbjct: 182 NDQLYVKEKLEAVNSMI-------EKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDS 234

Query: 270 IALRQDLQVLN--EIFTDPSILKVFHGAFMDI----------------IWLQRDLGLYVV 311
           +A    +++ +   I T  S+  +F     D+                    + +    +
Sbjct: 235 LATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTI 294

Query: 312 SLFDTYHASRALGFPKHSLAYLLETFANFKTSKKY--QLADWRIRPLSKPMKTYAR 365
           SL+ + +AS    FP     YLLET+AN     KY  + AD+ +R + +  K YA+
Sbjct: 295 SLYASDYASY---FP-----YLLETYANVLIPCKYLNRHADFFVREMRR--KVYAQ 340

>Skud_16.393 Chr16 (706811..708100) [1290 bp, 429 aa] {ON} YPR108W
           (REAL)
          Length = 429

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 81/176 (46%), Gaps = 40/176 (22%)

Query: 213 NEPIWV-DNITALNDMLNGLKNVKEIAVDLEHHD-YRSYYGLVCLMQISTRE-SDWLVDT 269
           N+ ++V + + A+N M+       E   D E  + Y++YYG+ CL   + +E +  LVD+
Sbjct: 182 NDQLYVKEKLEAVNSMI-------EKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDS 234

Query: 270 IALRQDLQVLN--EIFTDPSILKVFHGAFMDI----------------IWLQRDLGLYVV 311
           +A    +++ +   I T  SI  +F     D+                    + +    +
Sbjct: 235 LATFTSIELTSYENIATYASITGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTI 294

Query: 312 SLFDTYHASRALGFPKHSLAYLLETFANFKTSKKY--QLADWRIRPLSKPMKTYAR 365
           SL+ + +AS    FP     YLLET+AN     KY  + AD+ +R + +  K YA+
Sbjct: 295 SLYASDYASY---FP-----YLLETYANALIPCKYLNKHADFFVREMRR--KVYAQ 340

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,613,149
Number of extensions: 3596239
Number of successful extensions: 12427
Number of sequences better than 10.0: 43
Number of HSP's gapped: 12819
Number of HSP's successfully gapped: 46
Length of query: 747
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 630
Effective length of database: 40,065,477
Effective search space: 25241250510
Effective search space used: 25241250510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)