Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30296.26ON35135115740.0
ACR001C6.26ON3463468901e-118
Kpol_1037.306.26ON3672536891e-87
KLTH0C11110g6.26ON2802246706e-86
SAKL0E01408g6.26ON3072266718e-86
KLLA0D01287g6.26ON3452276696e-85
Kwal_56.224436.26ON2802276592e-84
TDEL0G044306.26ON3472216392e-80
Suva_15.1746.26ON2952356203e-78
Skud_15.1616.26ON2932306186e-78
ZYRO0C07634g6.26ON3822296231e-77
YOL001W (PHO80)6.26ON2932306124e-77
CAGL0E02541g6.26ON3422336104e-76
KNAG0I017506.26ON3241866007e-75
Smik_15.1696.26ON2912305977e-75
TPHA0J003806.26ON3562445871e-72
TBLA0A071606.26ON2681795662e-70
NCAS0D021506.26ON3692244576e-53
NDAI0C026406.26ON4272114415e-50
Skud_9.1197.240ON2851241927e-16
Smik_9.1407.240ON2851241874e-15
YIL050W (PCL7)7.240ON2851241856e-15
Suva_9.1497.240ON2861241849e-15
NCAS0E032207.240ON3411421832e-14
ADL075W7.240ON2071421738e-14
KNAG0D016307.240ON4381331799e-14
Ecym_43367.240ON3851181781e-13
SAKL0F08602g7.240ON4741291753e-13
KLTH0A04268g7.240ON5801241754e-13
NCAS0A134807.240ON4481421745e-13
Kwal_23.58077.240ON4651241736e-13
KAFR0L008807.240ON3131281663e-12
KAFR0I018407.240ON3251151637e-12
CAGL0M12342g7.240ON4571271648e-12
TPHA0C010907.240ON3851491631e-11
KNAG0L014707.240ON3541421593e-11
NDAI0A025607.240ON5031271586e-11
KLLA0C08305g7.240ON4091451567e-11
Kpol_1033.137.240ON250681422e-09
TDEL0H020207.240ON3631441416e-09
TBLA0D040707.240ON661601426e-09
ZYRO0C08118g7.240ON405601408e-09
Suva_5.1677.240ON424601353e-08
Smik_5.1897.240ON415601354e-08
Kpol_2000.147.289ON3101091334e-08
YER059W (PCL6)7.240ON420601335e-08
Skud_5.1737.240ON420601335e-08
TBLA0C048507.289ON3681041256e-07
NDAI0E047707.240ON303571149e-06
NCAS0A137707.289ON3121161131e-05
Smik_4.1107.289ON3081331112e-05
ZYRO0C09284g7.289ON3111121094e-05
SAKL0F09856g7.289ON3351101095e-05
Suva_14.503.70ON2791901076e-05
CAGL0E02233g3.70ON266991068e-05
Suva_4.687.289ON3051071061e-04
AFR159C7.289ON3081101061e-04
YDL127W (PCL2)7.289ON3081331061e-04
CAGL0J09328g7.289ON2971231051e-04
Suva_4.1187.289ON3091231051e-04
Ecym_80387.289ON3141111042e-04
Kpol_1020.87.289ON2961211032e-04
KNAG0A014903.70ON2621161014e-04
KLTH0A05346g7.289ON3011091014e-04
Kwal_56.241516.236ON4801181024e-04
TPHA0P008107.289ON2471051004e-04
YDL179W (PCL9)7.289ON3041031014e-04
NCAS0D040706.236ON4731101015e-04
TDEL0H015507.289ON3091121005e-04
TBLA0A078903.70ON361106999e-04
Skud_4.1287.289ON308123989e-04
Suva_16.876.236ON501122999e-04
NDAI0A022707.289ON330114970.001
Skud_16.606.236ON500122980.001
YPL219W (PCL8)6.236ON492122970.002
Kwal_23.60067.289ON304109960.002
Smik_14.423.70ON279104950.002
KNAG0B029307.289ON312102950.002
Skud_14.483.70ON279104950.002
TPHA0A005803.70ON289113950.002
YNL289W (PCL1)3.70ON279104940.003
KAFR0A082803.70ON241127930.003
Skud_4.797.289ON30998940.004
Smik_6.4246.236ON492122940.004
TBLA0J006507.289ON363101930.004
Kpol_1020.163.70ON282105920.006
KLLA0F05654g7.289ON311119910.008
Skud_7.1396.236ON434107900.011
Smik_4.607.289ON305103880.016
ZYRO0C02068g3.70ON330104880.016
Smik_7.1386.236ON437106890.017
NDAI0I008606.236ON543123880.022
KNAG0F018706.236ON48394880.022
KLLA0E13223g3.70ON282148870.022
SAKL0C12100g3.70ON314126860.030
Suva_7.1306.236ON442105850.050
TDEL0E007903.70ON25497830.065
NDAI0C019805.347ON226149820.066
ZYRO0E07326g6.236ON428109840.067
NCAS0A098703.70ON29496820.097
Kpol_228.16.236ON560115800.20
TPHA0A032507.289ON28987790.21
KAFR0C015603.70ON26793790.21
NDAI0A060503.70ON28697790.23
AEL195W3.70ON237129770.33
NDAI0F014806.236ON490101770.49
NDAI0C043005.347ON240107750.62
TDEL0E028005.347ON19979740.68
CAGL0J06336g7.289ON314102731.1
KAFR0K022805.347ON23193721.4
CAGL0E05918g6.236ON481101721.9
CAGL0J10846g5.347ON229120684.4
Kpol_1005.175.347ON319144677.4
Suva_12.1767.460ON97064678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3029
         (351 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   610   0.0  
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   347   e-118
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   270   1e-87
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   262   6e-86
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   263   8e-86
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   262   6e-85
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   258   2e-84
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   250   2e-80
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   243   3e-78
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   242   6e-78
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   244   1e-77
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   240   4e-77
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   239   4e-76
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   235   7e-75
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   234   7e-75
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   230   1e-72
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   222   2e-70
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     180   6e-53
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   174   5e-50
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    79   7e-16
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    77   4e-15
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    76   6e-15
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    75   9e-15
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    75   2e-14
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    71   8e-14
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    74   9e-14
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    73   1e-13
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    72   3e-13
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    72   4e-13
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    72   5e-13
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    71   6e-13
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    69   3e-12
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    67   7e-12
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    68   8e-12
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    67   1e-11
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    66   3e-11
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    65   6e-11
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    65   7e-11
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    59   2e-09
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    59   6e-09
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    59   6e-09
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    59   8e-09
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    57   3e-08
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    57   4e-08
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    56   4e-08
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    56   5e-08
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    56   5e-08
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    53   6e-07
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    49   9e-06
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    48   1e-05
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    47   2e-05
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    47   4e-05
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    47   5e-05
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    46   6e-05
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    45   8e-05
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    45   1e-04
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    45   1e-04
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    45   1e-04
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    45   1e-04
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    45   1e-04
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    45   2e-04
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    44   2e-04
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    44   4e-04
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    44   4e-04
Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {...    44   4e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    43   4e-04
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    44   4e-04
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     44   5e-04
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    43   5e-04
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    43   9e-04
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    42   9e-04
Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W...    43   9e-04
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      42   0.001
Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W...    42   0.001
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    42   0.002
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    42   0.002
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    41   0.002
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    41   0.002
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    41   0.002
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    41   0.002
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    41   0.003
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    40   0.003
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    41   0.004
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    41   0.004
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    40   0.004
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    40   0.006
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    40   0.008
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    39   0.011
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    39   0.016
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    39   0.016
Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W ...    39   0.017
NDAI0I00860 Chr9 complement(197860..199491) [1632 bp, 543 aa] {O...    39   0.022
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    39   0.022
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    38   0.022
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    38   0.030
Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W ...    37   0.050
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    37   0.065
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    36   0.066
ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {...    37   0.067
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    36   0.097
Kpol_228.1 s228 (611..2293) [1683 bp, 560 aa] {ON} (611..2293) [...    35   0.20 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    35   0.21 
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    35   0.21 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    35   0.23 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    34   0.33 
NDAI0F01480 Chr6 (365467..366939) [1473 bp, 490 aa] {ON} Anc_6.2...    34   0.49 
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                33   0.62 
TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON...    33   0.68 
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    33   1.1  
KAFR0K02280 Chr11 (465010..465705) [696 bp, 231 aa] {ON} Anc_5.3...    32   1.4  
CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {...    32   1.9  
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    31   4.4  
Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON} (29070.....    30   7.4  
Suva_12.176 Chr12 (265904..268816) [2913 bp, 970 aa] {ON} YJR089...    30   8.5  

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/351 (86%), Positives = 304/351 (86%)

Query: 1   MSDTGNNSNVEVENRKAQPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTESNT 60
           MSDTGNNSNVEVENRKAQPVPEFRLPRKFLDCSRTH               NDAYTESNT
Sbjct: 1   MSDTGNNSNVEVENRKAQPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTESNT 60

Query: 61  LQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHR 120
           LQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHR
Sbjct: 61  LQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHR 120

Query: 121 FLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCS 180
           FLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCS
Sbjct: 121 FLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCS 180

Query: 181 REHQEGTFSFANIPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLE 240
           REHQEGTFSFANIPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLE
Sbjct: 181 REHQEGTFSFANIPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLE 240

Query: 241 EPELVIDPITFTLNKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRLTLDTKDRNP 300
           EPELVIDPITFTLNKA                                KRLTLDTKDRNP
Sbjct: 241 EPELVIDPITFTLNKANDNNNSSYYSNNYSNNTDNGGNIRNINNDNDDKRLTLDTKDRNP 300

Query: 301 AISEADISPQTSKKRNYSDSNPNCIGLCNQIPITKKRSNGQTKHPSPSEIV 351
           AISEADISPQTSKKRNYSDSNPNCIGLCNQIPITKKRSNGQTKHPSPSEIV
Sbjct: 301 AISEADISPQTSKKRNYSDSNPNCIGLCNQIPITKKRSNGQTKHPSPSEIV 351

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  347 bits (890), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/346 (54%), Positives = 229/346 (66%), Gaps = 4/346 (1%)

Query: 9   NVEVENRKAQPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTE-SNTLQLTRFH 67
           +V+  +  ++ V E  LPR+FL CSRT+               NDA  + S  ++LTRFH
Sbjct: 2   SVQTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFH 61

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATT 127
           SRVPP+ISVY+YLIRLTKYSSLEHCVLLASVYYIDLL++V+PEFRLDSLTVHRFLLTATT
Sbjct: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATT 121

Query: 128 VASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGT 187
           VASKGLCDSFCTNTHYAKVGGVQC+ELNVLENEFL RVNYRILPRD+NI+RCS E QE  
Sbjct: 122 VASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERI 181

Query: 188 FSFANIPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTL-EEPELVI 246
           FS++NIP D +   +   N F VLE YYHRMIHLIG+ + SPDKS +L+FTL E P   I
Sbjct: 182 FSYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNSI 241

Query: 247 DPITFTLNKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRLTLDTKDRNPAISEAD 306
                  N                                  +  +L +   +   S  +
Sbjct: 242 QKTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGSECQLASKEESRSLRSAHMDNNSSVNN 301

Query: 307 ISPQT-SKKRNYSDSNPNCIGLCNQIPITKKRSNGQTKHPSPSEIV 351
            SPQ+ S+KRNYSDS+ N +G+C Q+ ++KK SN Q  H SP EIV
Sbjct: 302 SSPQSFSRKRNYSDSSINHLGMCTQLILSKKHSNSQNSH-SPREIV 346

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  270 bits (689), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 178/253 (70%), Gaps = 15/253 (5%)

Query: 2   SDTGNNSNVEVENR-KAQPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXND---AYTE 57
            +  N+ NV  EN+ + + +    LP KF+DCSR+                ND   A T 
Sbjct: 24  GENNNSKNVSNENKIEIENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTN 83

Query: 58  --------SNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFP 109
                    + + LTRFHSRVPP+ISVY+YLIRLTKYSSLEHCVLL++VYYIDLLSSV+P
Sbjct: 84  YLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYP 143

Query: 110 EFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRI 169
           EF+++SLTVHRFLLTATT+ASKGLCDSFCTN+HY+KVGGV C+ELN+LE EFL RVNYRI
Sbjct: 144 EFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRI 203

Query: 170 LPRDENIKRCSREHQEGTFS--FANIPADAEQDQKSEENR-FDVLENYYHRMIHLIGNLD 226
           +PRD+NIK C  EHQ+  F+  F+++       Q + +N  F++L+ YYH+++ L+G+  
Sbjct: 204 IPRDDNIKLCKIEHQQNKFTMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFS 263

Query: 227 ASPDKSYDLNFTL 239
           AS DKS   N+TL
Sbjct: 264 ASSDKSRKANYTL 276

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  262 bits (670), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 127/224 (56%), Positives = 161/224 (71%), Gaps = 4/224 (1%)

Query: 19  PVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTESNTLQLTRFHSRVPPSISVYD 78
           PVPE  LP  F  C RT                ND+  + N+ +LTRFHSRVPP ISVYD
Sbjct: 28  PVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYD 87

Query: 79  YLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFC 138
           YL+RLT+YSSLE  VL+ASVYYIDLLS+++  F L+SLTVHRFLLTATTV SKGLCDSFC
Sbjct: 88  YLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFC 147

Query: 139 TNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADAE 198
           TN+HYAKVGGVQC+EL+VLE+EFL RVNYRILPRD+NI  C  E +EG F    + A   
Sbjct: 148 TNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLF----VTATYA 203

Query: 199 QDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLEEP 242
           ++ +   N F+VL+ YY ++I ++G+ D+SPDK+   ++ ++ P
Sbjct: 204 KENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVMKTP 247

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  263 bits (671), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 157/226 (69%), Gaps = 4/226 (1%)

Query: 18  QPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTESNTLQLTRFHSRVPPSISVY 77
           Q   +  LP +FL CSRT                ND+  +   L+LTRFHSRVPP ISVY
Sbjct: 42  QTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVY 101

Query: 78  DYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSF 137
           +YLIRL KYSSLE  VL+A+VYYIDLLSSV+P F L+SLTVHRFLLTATTVASKGL DSF
Sbjct: 102 NYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSF 161

Query: 138 CTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADA 197
           CTN HYAKVGGVQC+ELNVLE EFL RVNYRI+PRD+NI  C  E+Q+G F    I    
Sbjct: 162 CTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVF----ITFPL 217

Query: 198 EQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLEEPE 243
               K   N F+VL+ YY +MI L+G  ++SPDK+  +++ LE  E
Sbjct: 218 ADKIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSE 263

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  262 bits (669), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 131/227 (57%), Positives = 163/227 (71%), Gaps = 7/227 (3%)

Query: 17  AQPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTESN-TLQLTRFHSRVPPSIS 75
            Q +P   LP ++L CSRTH               NDA    N T++LTRFHS+  PSI+
Sbjct: 16  GQIIP---LPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSIT 72

Query: 76  VYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCD 135
           VY YLIRLTKYSSLEH VLL++VYYIDLLS+V+PEF L+SLTVHRFLLTATT+ASKGLCD
Sbjct: 73  VYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCD 132

Query: 136 SFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPA 195
           SFCTNTHY+KVGGVQC+ELN+LENEFL RV YRI+PRD+NI+ C  E + G+     IP 
Sbjct: 133 SFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML--IPM 190

Query: 196 DAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLEEP 242
                Q+  +N F+VL+NYY +++ L+GN   SPDK+    F + +P
Sbjct: 191 -KNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDP 236

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  258 bits (659), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 160/227 (70%), Gaps = 4/227 (1%)

Query: 13  ENRKAQPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTESNTLQLTRFHSRVPP 72
           E  +  PVPE  LP  F  CSRT                ND+  + +  +LTRFHSRVPP
Sbjct: 22  ERLEEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPKDDAKELTRFHSRVPP 81

Query: 73  SISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKG 132
            ISVYDY++RLT+YSSLE  VL+ASVYYIDLLS+++P F L+SLTVHRFLLTATTVASKG
Sbjct: 82  QISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKG 141

Query: 133 LCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFAN 192
           LCDSFCTN+HYAKVGGVQC+EL+VLE+EFL +VNYRILPRD+NI  C  E + G F    
Sbjct: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLF---- 197

Query: 193 IPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239
           +     +  +   N F+VL+ YY ++I ++G+ D+SPDK+   ++ +
Sbjct: 198 VTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  250 bits (639), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 155/221 (70%), Gaps = 6/221 (2%)

Query: 25  LPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTES---NTLQLTRFHSRVPPSISVYDYLI 81
           LPRKF  CSRT                ND+   S   N   LTRFHSRVPP ISVY+YLI
Sbjct: 35  LPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNYLI 94

Query: 82  RLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNT 141
           RLTKYSSLEHCVLL +VYYIDLLSSV+P F L SLTVHRFLLTATTVASKGLCDSFCTNT
Sbjct: 95  RLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCTNT 154

Query: 142 HYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADAE--Q 199
           HYAKVGGV  +ELN+LE EFL RVNYRILPRD+NI  C  E +   F+    P   +  +
Sbjct: 155 HYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSR 214

Query: 200 DQKSEENR-FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239
            Q S +N  ++VL+ Y+ +++ L+G+  +SPDKS  +N+ L
Sbjct: 215 PQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVL 255

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  243 bits (620), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 119/235 (50%), Positives = 161/235 (68%), Gaps = 8/235 (3%)

Query: 13  ENRKAQPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTES---NTLQLTRFHSR 69
           + ++ Q +P+  LP +F  CSRT                N+  +     + + LTR+HS+
Sbjct: 11  DTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSK 70

Query: 70  VPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVA 129
           +PP+IS+++Y IRLTK+SSLEHCVL+ S+YYIDLL + +P+F L+SLT HRFLLTATTVA
Sbjct: 71  IPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVA 130

Query: 130 SKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFS 189
           +KGLCDSF TN HY+KVGGV+C+ELN+LEN+FL RVNYRILPRD NI  CS E ++ TF 
Sbjct: 131 AKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFV 190

Query: 190 F-ANIPADAEQDQKSEENR----FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239
              N     +    S  NR    ++VL+ YY R++ L+G+ DASPDKS  +N+ L
Sbjct: 191 IDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL 245

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  242 bits (618), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 119/230 (51%), Positives = 160/230 (69%), Gaps = 8/230 (3%)

Query: 18  QPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTES---NTLQLTRFHSRVPPSI 74
           Q +P+  LP +F  CSRT                N+  T     + + LTR+HS+VPP+I
Sbjct: 16  QGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNI 75

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLC 134
           S+++Y IRLTK+SSLEHCVL+ S+YYIDLL + +P+F L+SLT HRFLLTATTVA+KGLC
Sbjct: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLC 135

Query: 135 DSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTF-SFANI 193
           DSF TN HYAKVGGV+C+ELN+LEN+FL RVNYRI+PRD NI  CS E ++  F +  N 
Sbjct: 136 DSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNA 195

Query: 194 PADAEQDQKSEENR----FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239
           P   + D  S  +R    ++VL+ YY R++ L+G+ +ASPDKS  +++ L
Sbjct: 196 PGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL 245

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  244 bits (623), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 158/229 (68%), Gaps = 9/229 (3%)

Query: 20  VPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTES---NTLQLTRFHSRVPPSISV 76
           VP   LP++F +CSRT                ND+ + S   +   LT+FHS+VPP ISV
Sbjct: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101

Query: 77  YDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDS 136
           Y+YL+RLTKYSSL+HCVL+A+VYYIDL+SSV+P F L+SLTVHRFLLTATTVASKGLCDS
Sbjct: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161

Query: 137 FCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPAD 196
           FCTNTHYAKVGGV C+ELNVLE E L R+NYRI+PRD+NI  C+ E Q   F       D
Sbjct: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221

Query: 197 ------AEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239
                 +        + ++VL+ YY++++ L+G+L ++ DKS  +N+T 
Sbjct: 222 DWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTF 270

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  240 bits (612), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 157/230 (68%), Gaps = 8/230 (3%)

Query: 18  QPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXND---AYTESNTLQLTRFHSRVPPSI 74
           Q +P+  LP  F  CSRT                N+        + + LTR+HS++PP+I
Sbjct: 16  QGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNI 75

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLC 134
           S+++Y IRLTK+SSLEHCVL+ S+YYIDLL +V+P+F L+SLT HRFLLTATTVA+KGLC
Sbjct: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLC 135

Query: 135 DSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSF-ANI 193
           DSF TN HYAKVGGV+C+ELN+LEN+FL RVNYRI+PRD NI  CS E ++  F    N 
Sbjct: 136 DSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNA 195

Query: 194 PADAEQDQKSEENR----FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239
               + D  S  NR    ++VL+ YY R++ L+G+ +ASPDKS  +++ L
Sbjct: 196 LGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVL 245

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  239 bits (610), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 157/233 (67%), Gaps = 8/233 (3%)

Query: 18  QPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTESNTLQ--LTRFHSRVPPSIS 75
           + +P  +LPR FL C +                 ND+  + N  +  LTRFHS++ P+IS
Sbjct: 12  EEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPNIS 71

Query: 76  VYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCD 135
           V++Y  RLTKYS LEH VLL++VYYIDLLS+V+P F L+SLT HRFLLTATT+ASKGLCD
Sbjct: 72  VFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGLCD 131

Query: 136 SFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSF----- 190
           SFCTNTHY+KVGGVQCNELNVLENEFL +VNYRI+PRD NI  C  E Q+  F       
Sbjct: 132 SFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPESIE 191

Query: 191 ANIPADAEQDQKSEENR-FDVLENYYHRMIHLIGNLDASPDKSYDLNFTLEEP 242
           +++     Q   S  N  ++VL  YY+++I ++G   +SPDK+  +N+ ++ P
Sbjct: 192 SDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDIDMP 244

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  235 bits (600), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 113/186 (60%), Positives = 140/186 (75%), Gaps = 3/186 (1%)

Query: 58  SNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLT 117
           S+  +LTRFHS VPP ISVY+YLIRLTKYS+LE  VLL S+YYIDLLSSV+P F ++SLT
Sbjct: 80  SSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLT 139

Query: 118 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIK 177
           VHRFLLTATTVASKGLCDSFCTN HYAKVGGVQ +ELN+LE+EFL ++NYR+LPRD+NI 
Sbjct: 140 VHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNIT 199

Query: 178 RCSREHQEGTFSFANIPADAEQDQKSEENR---FDVLENYYHRMIHLIGNLDASPDKSYD 234
            C  EH+   F+  N  A     + +   R   ++VL+ YYH++I L+G   +S DKS  
Sbjct: 200 WCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKK 259

Query: 235 LNFTLE 240
            N+  E
Sbjct: 260 ANYVFE 265

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  234 bits (597), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 156/230 (67%), Gaps = 8/230 (3%)

Query: 18  QPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXND---AYTESNTLQLTRFHSRVPPSI 74
           Q + +  LP  F  CSRT                N+   +    N + LTR+HS++PP+I
Sbjct: 16  QGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKIPPNI 75

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLC 134
           S+++Y IRLTK+SSLEHCVL+ S+YYIDLL + +P+F L+SLT HRFLLTATT+A+KGLC
Sbjct: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLC 135

Query: 135 DSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSF-ANI 193
           DSF TN HYAKVGGV+C+ELN+LEN+FL RVNYRI+PRD NI  CS E ++  F    N 
Sbjct: 136 DSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNA 195

Query: 194 PADAEQDQKSEENR----FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239
               + D  S  +R    ++VL+ YY R++ L+G+ +ASPDKS  +++ L
Sbjct: 196 LGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL 245

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  230 bits (587), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 159/244 (65%), Gaps = 23/244 (9%)

Query: 20  VPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXND---AYTESNTLQ-------------- 62
           +    LP  FL CSR+                ND     TE+N+                
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 63  ---LTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVH 119
              LTRFHSRVPP+ISV +YLIRLTKY+SLEH VLL+S+YYIDLLSSV+PEF+++SLTVH
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 120 RFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
           RFLL ATTVASKGL DSFCTN+HYAKVGGV+C+ELN+LE +FL R+NYRI+PRD+NIK C
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 180 SREHQEGTFS--FANIPADAEQDQKSEENR-FDVLENYYHRMIHLIGNLDASPDKSYDLN 236
             E +   F+    ++ A   Q + +  N  ++VL  YY +M+ ++G L  S DKS  +N
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271

Query: 237 FTLE 240
           + ++
Sbjct: 272 YIIQ 275

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  222 bits (566), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 138/179 (77%), Gaps = 2/179 (1%)

Query: 61  LQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHR 120
           L LTRFHS+VPP+IS++DYLIRLTKYSSLE  VL+ SVYYIDLLS+V+PEF L+SLTVHR
Sbjct: 58  LFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHR 117

Query: 121 FLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCS 180
           +LLTATT+ASKGLCDSFCTN+HYAKVGG++CNELNVLE EFL RV YR++PRD  IK C 
Sbjct: 118 YLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCK 177

Query: 181 REHQEGTFSFANIPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239
            E++       +I  D     + + + ++VL  YY++M+ L+GN  +S +   ++N+  
Sbjct: 178 LEYKYS--PIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  180 bits (457), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 129/224 (57%), Gaps = 15/224 (6%)

Query: 13  ENRKAQPVPEFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTESNT------LQLTRF 66
           E+     +    +P +++ CSR+                ND  + ++       + LTRF
Sbjct: 19  ESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMHLTRF 78

Query: 67  HSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTAT 126
           HSR+PP+IS+++YL RLTKY  +EHCVLL+ +YYIDL ++ +P F  +SLT HRFLLTA 
Sbjct: 79  HSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAI 138

Query: 127 TVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEG 186
           TVA KGLCDSFCT   YAK+GGVQ  ELN+LE  FL  VNYRI+PR  N+     E    
Sbjct: 139 TVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQ 198

Query: 187 TFSFANIPADAEQDQKS-------EENRFDVLENYYHRMIHLIG 223
            F+  ++  D +  + S        +N + VL  YY  ++ + G
Sbjct: 199 VFTLDHL--DMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  174 bits (441), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 97/211 (45%), Positives = 123/211 (58%), Gaps = 11/211 (5%)

Query: 22  EFRLPRKFLDCSRTHXXXXXXXXXXXXXXXNDAYTESNTL---QLTRFHSRVPPSISVYD 78
           +  LP KF++C R                 ND     N L     TRFHSRV P IS+ +
Sbjct: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGN 115

Query: 79  YLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFC 138
           YL+RLTK+  L+  VLL +VYYIDLLS+VFP F  +SLT HRF+LTA  VASK LCDS  
Sbjct: 116 YLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCL 175

Query: 139 TNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADAE 198
           + THYAK GGVQ NEL +LE  FL  + YR+LPRD+N   CS E+   TF+  +     +
Sbjct: 176 SITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALND--GQIK 233

Query: 199 QDQKSEENR------FDVLENYYHRMIHLIG 223
           +   S   R      ++VL  YY R+I +IG
Sbjct: 234 ESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 78.6 bits (192), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 67/124 (54%), Gaps = 11/124 (8%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFR-----------LD 114
           F+ +  P ISV  YL R+ KY    + + L+ + Y D +S  +  F            +D
Sbjct: 150 FYGKSVPEISVVQYLERIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMD 209

Query: 115 SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDE 174
           S  +HR L+T  T+ +K L D F +N+ YAKVGG+   ELN LE +FL   ++++L   E
Sbjct: 210 SGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLLVSVE 269

Query: 175 NIKR 178
            +++
Sbjct: 270 EMQK 273

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 76.6 bits (187), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 68/124 (54%), Gaps = 11/124 (8%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVF---PE--------FRLD 114
           F+ +  P I V  YL R+ KY    + + L+ + Y D +S  +   PE        F +D
Sbjct: 150 FYGKNVPEIDVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMD 209

Query: 115 SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDE 174
           S  +HR L+T  T+ +K L D F +N+ YAKVGG+   ELN LE +FL   ++++L   E
Sbjct: 210 SGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLLVSVE 269

Query: 175 NIKR 178
            +++
Sbjct: 270 EMQK 273

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 75.9 bits (185), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 67/124 (54%), Gaps = 11/124 (8%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE-----------FRLD 114
           F+ +  P I+V  YL R+ KY    + + L+ + Y D +S  +             F +D
Sbjct: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMD 209

Query: 115 SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDE 174
           S  +HR L+T  T+ +K L D F +N+ YAKVGG+   ELN LE +FL   ++++L   E
Sbjct: 210 SGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVE 269

Query: 175 NIKR 178
            +++
Sbjct: 270 EMQK 273

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 75.5 bits (184), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 67/124 (54%), Gaps = 11/124 (8%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE-----------FRLD 114
           F+ +  P I+V  YL R+ KY    + + L+ + Y D +S  +             F +D
Sbjct: 151 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMD 210

Query: 115 SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDE 174
           S  +HR L+T  T+ +K + D F +N+ YAKVGG+   ELN LE +FL   ++++L   E
Sbjct: 211 SGNIHRLLITGITICTKFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLLVSRE 270

Query: 175 NIKR 178
            +++
Sbjct: 271 EMQK 274

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 68/142 (47%), Gaps = 27/142 (19%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVF----------------- 108
           F  +  P I +  Y  R+ KY    + VLLA + Y D +S V                  
Sbjct: 184 FRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHH 243

Query: 109 ----------PEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLE 158
                      +F LDS  +HR +++A TV++K   D F +N+ YAKVGG+  +E+N LE
Sbjct: 244 LLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLE 303

Query: 159 NEFLTRVNYRILPRDENIKRCS 180
            +FL   N+ ++   E I+R S
Sbjct: 304 LQFLLISNFDLIISSEEIQRYS 325

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 71.2 bits (173), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 77/142 (54%), Gaps = 13/142 (9%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLS----SVFPE-FRLDSLTVHR 120
           F  +  P+I++ DY  R+ KY  + + V L+ + Y D ++    ++ P+ F +DS  +HR
Sbjct: 65  FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHR 124

Query: 121 FLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCS 180
            ++ A TV++K   D F +N+ YA+VGG+   ELN LE +F    ++ ++   + ++R +
Sbjct: 125 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQELQRYA 184

Query: 181 --------REHQEGTFSFANIP 194
                   REH     + A +P
Sbjct: 185 DLLYKFWHREHLAKASTNAAVP 206

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 67/133 (50%), Gaps = 21/133 (15%)

Query: 63  LTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVF-------------- 108
           +T F+ +  P I++  YL+R+ KY    + + L+ + + D +S  F              
Sbjct: 283 ITSFYGKHVPQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDS 342

Query: 109 ------PEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFL 162
                   F +DS  +HR L+   TV++K   D F +N  YA+VGG+   E+N LE +FL
Sbjct: 343 DEQAPHQTFVMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFL 402

Query: 163 TRVNYRIL-PRDE 174
              ++++L P DE
Sbjct: 403 ILCDFKLLIPIDE 415

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 70/118 (59%), Gaps = 5/118 (4%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLS----SVFPE-FRLDSLTVHR 120
           F  +  P+I++ DY  R+ KY  + + V L+ + Y D ++    ++ P+ F +DS  +HR
Sbjct: 234 FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHR 293

Query: 121 FLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKR 178
            ++ A TV++K   D F +N+ YA+VGG+  +ELN LE +F    ++ ++   + ++R
Sbjct: 294 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELIVSVQELQR 351

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 70/129 (54%), Gaps = 10/129 (7%)

Query: 60  TLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLS---SVFPE------ 110
           T Q+  F  +  P+IS+  Y  R+ KY    + V L+ + Y D ++   ++  E      
Sbjct: 331 TSQVLSFRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQ 390

Query: 111 -FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRI 169
            F +DS  +HR ++ A TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ +
Sbjct: 391 LFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFEL 450

Query: 170 LPRDENIKR 178
           +   E ++R
Sbjct: 451 IISIEELQR 459

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 69/124 (55%), Gaps = 5/124 (4%)

Query: 62  QLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE-----FRLDSL 116
           ++  F  +  P+I+++ Y  R+ KY    + V L+ + Y D ++          F +DS 
Sbjct: 431 EILSFRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSY 490

Query: 117 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENI 176
            +HR +++A TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++   E +
Sbjct: 491 NIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELIISVEEL 550

Query: 177 KRCS 180
           ++ S
Sbjct: 551 QKYS 554

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 19/142 (13%)

Query: 52  NDAYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLS-----S 106
           N+AY  S    +  F  +  P IS++ Y  R+ KY    + V L+ + Y D +S     S
Sbjct: 273 NNAYVGS----ILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNS 328

Query: 107 VFPE----------FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNV 156
           V  +          F +DS  +HR ++   TV +K   D F +N+ YA+VGGV   ELN 
Sbjct: 329 VTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNH 388

Query: 157 LENEFLTRVNYRILPRDENIKR 178
           LE +FL   ++ ++   E ++R
Sbjct: 389 LELQFLVLCDFELMIPTEELQR 410

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 68/124 (54%), Gaps = 5/124 (4%)

Query: 62  QLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE-----FRLDSL 116
           ++  F  +  P+I++  Y  R+ KY    + V L+ + Y D ++          F +DS 
Sbjct: 320 EILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSY 379

Query: 117 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENI 176
            +HR +++A TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++   E +
Sbjct: 380 NIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELIISVEEL 439

Query: 177 KRCS 180
           ++ S
Sbjct: 440 QKYS 443

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 67/128 (52%), Gaps = 12/128 (9%)

Query: 63  LTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL----SSVF-------PE- 110
           +  F  +  P I++  Y  R+ KY    + V L+ + Y D +    +S F       P+ 
Sbjct: 172 MLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQI 231

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           F +DS  +HR ++   TV++K L D F +N+ YAKVGG+   ELN LE +FL   ++ +L
Sbjct: 232 FVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNLL 291

Query: 171 PRDENIKR 178
              E  +R
Sbjct: 292 ISIEEYER 299

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSS-----VFPE-----FRLDS 115
           FH +  P I++  Y  R+ KY    + V L  +   D ++       F       F +DS
Sbjct: 181 FHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFVMDS 240

Query: 116 LTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
             +HRF++   TV +K L D F +N+ YAKVGG+  +E+N LE +FL   +++++
Sbjct: 241 YNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSS-----------VFPE---F 111
           F  +  P I++Y Y  R+ KY    + V L+ + Y D +S              P    F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 112 RLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILP 171
            +DS  +HR ++   TV +K   D F +N+ YA+VGG+  +ELN LE +FL   ++ +L 
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLI 424

Query: 172 RDENIKR 178
             + ++R
Sbjct: 425 SVDKLQR 431

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 69/149 (46%), Gaps = 36/149 (24%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSS------------------- 106
           F  +  P IS+  Y  R+ KY  + + V L+ + Y D +S                    
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 107 ----------------VFPE-FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGV 149
                           V P+ F +DS  +HR ++TA TV++K   D F +N+ YA+VGG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 150 QCNELNVLENEFLTRVNYRILPRDENIKR 178
              ELN LE +FL   +++++   E ++R
Sbjct: 328 SLQELNHLELQFLILCDFQLMISVEELQR 356

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 53  DAYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLS---SVFP 109
           D Y ES    +  F  +  P I++  Y  R+ KY    + V L+ + Y D +S   +  P
Sbjct: 198 DGYYESAVNAILSFKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIP 257

Query: 110 E-------------FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNV 156
                         F ++S  +HR ++    V++K   D F +N  YAKVGG+   E+N 
Sbjct: 258 RGGDDDKVQDDTLLFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNY 317

Query: 157 LENEFLTRVNYRILPRDENIKR 178
           LE +FL   ++ +L   E ++R
Sbjct: 318 LELQFLVLCDFSLLISVEEMER 339

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLS---SVFPE-----------F 111
           F  +  P I+++ Y  R+ KY    + V L+ + Y D +S   +  P            F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 112 RLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILP 171
            +DS  +HR ++   TV +K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++ 
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELMI 471

Query: 172 RDENIKR 178
             E ++R
Sbjct: 472 PIEELQR 478

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 72/145 (49%), Gaps = 28/145 (19%)

Query: 62  QLTRFHSRVPPSISVYDYLIRLTKY---------SSLEH-------CVLLASVYYIDLLS 105
           ++  F  +  P I++  Y  R+ KY         S L H       C  +A  Y + ++S
Sbjct: 236 EILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVS 295

Query: 106 S-----------VFPE-FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNE 153
           +             P+ F +DS  +HR ++ A TV++K + D F +N+ YA+VGG+   E
Sbjct: 296 TPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQE 355

Query: 154 LNVLENEFLTRVNYRILPRDENIKR 178
           LN LE +FL   ++R++   E ++R
Sbjct: 356 LNHLELQFLILCDFRLIISVEELQR 380

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (61%)

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           F +DS  +HR ++   TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ +L
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

Query: 171 PRDENIKR 178
              E ++R
Sbjct: 223 ISVEELQR 230

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 61/144 (42%), Gaps = 31/144 (21%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSS------------------- 106
           F  +  P IS+  Y  R+ KY    + V L+ + Y D +S                    
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 107 ------------VFPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNEL 154
                           F +DS  +HR L+   TV++K   D F +N+ YA+VGG+   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 155 NVLENEFLTRVNYRILPRDENIKR 178
           N LE +FL   ++ +L     ++R
Sbjct: 316 NHLELQFLVLCDFELLISVNELQR 339

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           F +DS  +HR ++   TVA+K   D F +N  YAKVGG+   ELN LE +FL   ++++L
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 39/60 (65%)

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           F +DS  +HR ++  TTV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ +L
Sbjct: 320 FVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGISLQELNYLELQFLILCDFELL 379

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 60/109 (55%), Gaps = 5/109 (4%)

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVASKG 132
           S+++++  L K+S+++   L+AS  Y+  L S+ P   + ++S T HR  L    +A+K 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 133 LCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
           L DS   N H+ K   G +   ++N +E E L  +N+  + + E++  C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTA 125
           S +PP   +Y ++  L  +S+++   L+ +V Y+  L ++ P   + +++ T HR  L  
Sbjct: 48  SNIPP---LYTFIKNLVAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIET-TRHRMFLGC 103

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNY 167
             +A+K L DS   N H+AK   G +Q  E+N +E E LT   +
Sbjct: 104 LIIAAKTLNDSSPLNKHWAKYTNGLLQLREVNTIEREILTYFKW 147

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 113 LDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRI 169
           ++S TVHR +L   TV+SK L D   +N  YA+  G+   ELN LE +FL   N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 64/116 (55%), Gaps = 7/116 (6%)

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFP--EFRLDSLTVHRFLLTA 125
           + + P++S  +++  L K+S+++   L+A+  Y+  L S+ P   + +++ T HR  L  
Sbjct: 44  AHIIPTLS--NFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIET-TRHRIFLGC 100

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
             +A+K L DS   N H+A+   G +Q  E+N +E E L   ++ +  + +++  C
Sbjct: 101 LILAAKTLNDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 71/133 (53%), Gaps = 8/133 (6%)

Query: 54  AYTESNTLQLTRFHSRVP---PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE 110
           A T ++ +++ + +S +    P+  + +++ RL K+S+++   L+A+  Y+  L S+ P 
Sbjct: 24  ASTTASVIKIKKTNSMIDIALPAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPS 83

Query: 111 --FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVN 166
             + +++ T HR  L    +A+K L DS   N H+A+   G +   E+N +E E L   +
Sbjct: 84  KVYGIET-TRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFD 142

Query: 167 YRILPRDENIKRC 179
           + +    E++  C
Sbjct: 143 WDVTISTEDLITC 155

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 72  PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVA 129
           P+  +  ++  L  YS+++   L+A+  Y+  L S+ P   F +++ T HR  L    +A
Sbjct: 43  PAPPLMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGCLILA 101

Query: 130 SKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
           +K L DS   N H+A    G +   E+N +E E L   ++ +    E +  C
Sbjct: 102 AKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 74  ISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVASK 131
           +S+ D++  L  +S+++   L+++V Y+  L S+ P   + +++ T HR  L    +A+K
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIET-TRHRIFLGCLILAAK 100

Query: 132 GLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
            L DS   N H+++   G +   E+N +E E L   ++++    +++  C
Sbjct: 101 NLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITC 150

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 86/190 (45%), Gaps = 28/190 (14%)

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTA 125
           +R+P   S+  ++ RL +Y+++    LL +V Y++ L  + P+    L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRIL------------- 170
             +++K   DS   N H+AK   G     ++N++E + L  +N+ +              
Sbjct: 106 LILSAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNWDLRVDTEDLILDLQPL 165

Query: 171 --PRDENIKRCSREHQE-GTFSFANIPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDA 227
             P  +++ R S + +  G     N  A A     +  NRF + E    R + +  +L +
Sbjct: 166 LEPIKQDLVRSSDQRKRVGMMMAMNKRASAGTSPVASNNRFKLYEK--QRNVSIASDLSS 223

Query: 228 SP--DKSYDL 235
           +   D S DL
Sbjct: 224 ATLVDSSNDL 233

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 54/99 (54%), Gaps = 5/99 (5%)

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVASKG 132
           S+  ++ RL +Y+++    LLA+V Y++ L  + P+    L S T+HR  L    ++SK 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPS-TIHRLFLACLILSSKC 112

Query: 133 LCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
             DS   N H+A+   G     ++N++E + L  +N+ I
Sbjct: 113 HNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDI 151

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 57/107 (53%), Gaps = 7/107 (6%)

Query: 67  HSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLT 124
           H   PP +S++  + ++   S+++   L+A+  Y++ L S+ P+  + +++ T HR  L 
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIET-TRHRIFLG 97

Query: 125 ATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
              +A+K L DS   N H+     G ++  E+N +E E L   N+ +
Sbjct: 98  CLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 74  ISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVASK 131
           +S+ D++  L K S+++   L+++V Y+  L S+ P   + +++ + HR  L    +A+K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 132 GLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
            L DS   N H+ +   G +   E+N +E E L   N+ +   ++++  C
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 70/133 (52%), Gaps = 8/133 (6%)

Query: 54  AYTESNTLQLTRFHSRVP---PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE 110
           A T ++ +++ + +S +    P+  +  ++ RL K+S+++   L+A+  Y+  L S+ P 
Sbjct: 24  ASTTASIIKIKKTNSMIDIALPAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPS 83

Query: 111 --FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVN 166
             + +++ T HR  L    +A+K L DS   N H+A+   G +   E+N +E E L   +
Sbjct: 84  NVYGIET-TRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFD 142

Query: 167 YRILPRDENIKRC 179
           + +    +++  C
Sbjct: 143 WDVTISTDDLITC 155

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 64/123 (52%), Gaps = 8/123 (6%)

Query: 54  AYTESNTLQLTRFHSRVP---PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE 110
           A +  + +Q+   HS +    P+  +  ++ +L KYS+++   L+A+  ++  L S+ P 
Sbjct: 24  ARSTESIIQVRETHSMIDVAIPAPKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPA 83

Query: 111 --FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVN 166
             + +++ T HR  L    +++K L DS   N H+A+   G +   E+N +E E L   +
Sbjct: 84  NVYGIET-TRHRIFLGCLILSAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFD 142

Query: 167 YRI 169
           + +
Sbjct: 143 WNL 145

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 54  AYTESNTLQLTRFHSRVP---PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE 110
           A T ++ +++ + +S +    P+  +  ++ RL K+S+++   L+A+  Y+  L S+ P 
Sbjct: 24  ASTTASIIKIKKTNSMIDIALPAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPS 83

Query: 111 --FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVN 166
             + +++ T HR  L    +A+K L DS   N H+A+   G +   E+N +E E L   +
Sbjct: 84  NVYGIET-TRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFD 142

Query: 167 YRI 169
           + +
Sbjct: 143 WDV 145

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 72  PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFP-EFRLDSLTVHRFLLTATTVAS 130
           P +S+ D++  L   S+++   L+++V Y+  L S+ P        T HR  L    +AS
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 131 KGLCDSFCTNTHYAKVGG--VQCNELNVLENEFLTRVNYRILPRDENIKRC 179
           K L DS   N H+ +     +   E+N +E E L   N+ +L  ++++  C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 62/121 (51%), Gaps = 9/121 (7%)

Query: 56  TESNTLQLTRFHSRVP---PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE-- 110
           TES  +Q+ R +S +    P   +  ++  L   S+++   L+A+  Y+  L ++ P   
Sbjct: 27  TES-IIQVRRSNSMISIALPPPPLVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNV 85

Query: 111 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYR 168
           + ++S T HR  L    +ASK L DS   N H+A+   G +Q  E+N +E E L   ++ 
Sbjct: 86  YGIES-TRHRIFLGCLILASKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWN 144

Query: 169 I 169
           I
Sbjct: 145 I 145

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 58/116 (50%), Gaps = 3/116 (2%)

Query: 64  TRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFP-EFRLDSLTVHRFL 122
           T    + P   S+  ++ +L +Y+++    LL +V Y++ L  + P + +    T+HR  
Sbjct: 48  TELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLF 107

Query: 123 LTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENI 176
           L    +++K   DS   N H+AK   G     ++N++E + L  +N+ +    E++
Sbjct: 108 LACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNWDLRVEQEDL 163

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 74  ISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE-FRLDSLTVHRFLLTATTVASKG 132
           +S+ D++  L   S+++   L+++  Y+  L S+ P        T HR  L    +A+K 
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKN 102

Query: 133 LCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
           L DS   N H+A    G +   E+N +E E L   ++ +    +++  C
Sbjct: 103 LNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTC 151

>Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {ON}
           YPL219W (PCL8) - cyclin (Pho85p) [contig 165] FULL
          Length = 480

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 58/118 (49%), Gaps = 12/118 (10%)

Query: 62  QLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFP---------EFR 112
           QL  F+    P+++  +YL RL    S    V L + +   LL S+F          ++ 
Sbjct: 344 QLATFNMDSTPTLAYEEYLQRLHCKFSFAPIVYLTAAH---LLQSLFLTRKDNKLCCKYH 400

Query: 113 LDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRIL 170
           LD+  VHR ++ +  +A+K L D   ++T ++++ G+    L  LE  FL  +N+  L
Sbjct: 401 LDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFEGL 458

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTV-HRFLLTATTVASKGL 133
           S+  ++  + KYS ++   L+AS  +++ L  + P +     T  HR  L    +ASK L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 134 CDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENI 176
            DS   N H+ K   G +   E+N +E E L  +++ +    E++
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNVRISTEDL 148

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 56/103 (54%), Gaps = 7/103 (6%)

Query: 71  PPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTV 128
           PP +S++  +  +   S+++   L+A+  Y++ L SV P+  + +++ T HR  L    +
Sbjct: 46  PPDLSIF--IKNVVIQSNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCLIL 102

Query: 129 ASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
           A+K L DS   N H+     G ++  E+N +E E L  +N+ +
Sbjct: 103 AAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV 145

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 8/110 (7%)

Query: 61  LQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--------FR 112
           +  + F  + PPS+S  D++ R+      +  V L + Y +  L  +  E        F+
Sbjct: 335 IAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLRFK 394

Query: 113 LDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFL 162
            +   VHR ++    +A+K L D   ++ ++ KV G+    L+ LE   L
Sbjct: 395 FEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 59/112 (52%), Gaps = 5/112 (4%)

Query: 72  PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVA 129
           P+ S+ +++  L  +S+++   L+A+  Y+  L S+ P   + +++ T HR  L    +A
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILA 103

Query: 130 SKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
           +K L DS   N H+A    G +  +E+N +E E L   ++ +    +++  C
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITC 155

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 56/106 (52%), Gaps = 9/106 (8%)

Query: 70  VPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSL----TVHRFLLTA 125
           +P   S+  ++ R+ +Y++++   LL +V Y++ L  + P    D++    T+HR  L  
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPA---DAVGIPSTIHRLFLAC 111

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
             +++K   DS   N H+A    G     ++N++E + L+ +++ +
Sbjct: 112 LILSAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 65/123 (52%), Gaps = 8/123 (6%)

Query: 54  AYTESNTLQLTRFHSRVP---PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE 110
           A T ++ +++ + +S +    P+  +  ++  L K+S+++   L+A+  Y+  L S+ P 
Sbjct: 24  ASTTASIIKIKKTNSMIDIALPAPPLTKFINGLIKHSNVQTPTLMATSVYLAKLRSIIPS 83

Query: 111 --FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVN 166
             + +++ T HR  L    +A+K L DS   N H+A+   G +   E+N +E E L   +
Sbjct: 84  NVYGIET-TRHRIFLGCLILAAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFD 142

Query: 167 YRI 169
           + +
Sbjct: 143 WDV 145

>Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W
           (REAL)
          Length = 501

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 54  AYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEF-- 111
           A +  +  +   F  + PPS+S  D++ R+         V L + Y + L+     E   
Sbjct: 353 AISAEDPQKFVNFTMKNPPSLSFKDFIDRIQNKCMFGAIVYLGATYLLQLVFLTRDELDG 412

Query: 112 ------RLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRV 165
                 +L     HR +++   +A+K L D   +  +  KV G+    L  LE  FL  V
Sbjct: 413 PIKLKAKLQEDQTHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFLASV 472

Query: 166 NY 167
           N+
Sbjct: 473 NF 474

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 70  VPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATT 127
           +PP   + +++  L  +S+++   L+A+  Y+  L  + P+  + +++ T HR  L    
Sbjct: 50  IPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMET-TRHRIFLGCLI 105

Query: 128 VASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
           +A+K L DS   N H+ K   G +   E+N +E E L    + +      + +C
Sbjct: 106 LAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNVTITTSELIKC 159

>Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W
           (REAL)
          Length = 500

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 52/122 (42%), Gaps = 8/122 (6%)

Query: 54  AYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL--------S 105
           A +  +  +   F  + PPS+S  D++ R+         V L + Y + L+         
Sbjct: 352 AVSSEDPQKFVNFIMKNPPSLSFKDFIDRIQNKCMFGSVVYLGATYLLQLVFLTRDEMNG 411

Query: 106 SVFPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRV 165
            V  + +L     HR +++A  + +K L D   +  +  KV G+    L  LE  F+  V
Sbjct: 412 PVKLKAKLQEDQAHRVIISAIRITTKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASV 471

Query: 166 NY 167
           N+
Sbjct: 472 NF 473

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 54  AYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEF-- 111
           A +  +  +   F  + PPS+S  D++ R+         V L + Y + L+     E   
Sbjct: 344 AISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMDG 403

Query: 112 ------RLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRV 165
                 +L     HR +++   +A+K L D   +  +  KV G+    L  LE  F+  V
Sbjct: 404 PIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASV 463

Query: 166 NY 167
           N+
Sbjct: 464 NF 465

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 74  ISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLD-SLTVHRFLLTATTVASKG 132
           +S+ +++  L   S+++   L+++  Y+  L S+ P   L    T HR  L    +A+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 133 LCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRC 179
           L DS   N H+A    G +   E+N +E E L   ++ +    + +  C
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAIC 153

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 8/104 (7%)

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTA 125
           +R+P   S+  ++ RL +Y+++    LL +  Y++ L  + P+    L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNY 167
             +++K   DS   N H+A+   G     ++N++E + L  +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 3/102 (2%)

Query: 71  PPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLD-SLTVHRFLLTATTVA 129
           PP  ++ +++  L   S +    L+AS  Y+  L  + P   +    T HR  L    +A
Sbjct: 44  PPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIA 103

Query: 130 SKGLCDSFCTNTHYAKVGG--VQCNELNVLENEFLTRVNYRI 169
           +K L D+   N H++K     +   E+N++E E L+ + +R+
Sbjct: 104 AKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 8/104 (7%)

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTA 125
           +R+P   S+  ++ RL +Y+++    LL +  Y++ L  + P+    L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNY 167
             +++K   DS   N H+A+   G     ++N++E + L  +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSL--TVHRFLLTA 125
           S++P   S+  ++ +L +Y+++    LL +  Y+  L  + P+   + L  T+HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLAC 108

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENI 176
             +++K   DS   N H+A+   G     ++N++E + L  +N+ I  ++E++
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDL 161

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 8/104 (7%)

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTA 125
           +R+P   S+  ++ RL +Y+++    LL +  Y++ L  + P     L S T+HR  L  
Sbjct: 50  TRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPS-TIHRIFLAC 105

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNY 167
             +++K   DS   N H+A+   G     ++N++E + L  +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 56  TESNTLQLTRFHSRVPPSISVYD----------YLIRLTKYSSLEHCVLLASVYYIDLLS 105
           T  N + L R +   PPS  +YD          ++ +L +Y+ +    LL ++ Y++ L 
Sbjct: 27  TTENVMDLKRTYP-TPPSSPLYDEEDELPTLREFICKLVEYTHVYTPTLLMTISYLNRLR 85

Query: 106 SVFPEFRLD-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFL 162
            + P+       T+HR  L    +++K   DS   N H+ K   G     ++N++E   L
Sbjct: 86  RILPKGAAGIPSTLHRIFLACLIISAKNHNDSSPLNRHWTKYTDGLFTLEDVNLMERHLL 145

Query: 163 TRVNYRI 169
             +N+ +
Sbjct: 146 DLLNWNL 152

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 53/98 (54%), Gaps = 5/98 (5%)

Query: 76  VYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVASKGL 133
           ++ ++ ++   S+++   L+A+  Y++ L ++ P   + +++ T HR  L    +A+K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIET-TRHRIFLGCLILAAKTL 106

Query: 134 CDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
            DS   N H++    G ++  E+N +E E L   N+ +
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 54  AYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEF-- 111
           A +  +  +   F  + PPS+S  D++ R+         V L + Y + L+     E   
Sbjct: 344 AISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMNG 403

Query: 112 ------RLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRV 165
                 +L     HR +++   +A+K L D   +  +  KV G+    L  LE  F+  V
Sbjct: 404 PIKLKTKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMACV 463

Query: 166 NY 167
           N+
Sbjct: 464 NF 465

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 72  PSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLD-SLTVHRFLLTATTVAS 130
           PS++++  + RL  +S+++   L++++ Y+  L  + P   +    T HR  +    +A+
Sbjct: 45  PSLALF--IKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAA 102

Query: 131 KGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
           K L DS   N H+ +   G  +  E+N +E E L   N+ +
Sbjct: 103 KSLNDSSPLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 53/105 (50%), Gaps = 8/105 (7%)

Query: 67  HSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLT 124
             R+P   S+  ++ +L +Y+++    LL +  Y+  L  + P+    L S T+HR  L 
Sbjct: 49  QQRLP---SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPS-TIHRMFLA 104

Query: 125 ATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNY 167
              +++K   DS   N H+A+   G     ++N++E + L  +N+
Sbjct: 105 CLIISAKYHNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 57/119 (47%), Gaps = 3/119 (2%)

Query: 54  AYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRL 113
           A T ++ + +     R   ++S+ D++  L ++S+++   L+A+  Y+  L S+ P    
Sbjct: 24  AATTASVISINDTDVRHGSTVSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVC 83

Query: 114 D-SLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
               T HR  +    +A+K L DS   N H+     G     ++N +E E L+  ++ +
Sbjct: 84  GIETTRHRIFIGCLILAAKNLNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 52/107 (48%), Gaps = 9/107 (8%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL---------SSVFPEFRLDSL 116
           F+ +  PS+S  D+L R+      E  V L + + +D L         +++  + +L   
Sbjct: 300 FYMKSKPSLSSVDFLRRIQDKCEYEPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEK 359

Query: 117 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLT 163
            VHR ++ +  +++K L D   ++ +++KV GV    L+ LE   L 
Sbjct: 360 EVHRVIIASVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEISLLV 406

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 71  PPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTV 128
           PP +S +  +  +   S+++   L+A+  Y++ L ++ P   + +++ T HR  L    +
Sbjct: 47  PPDLSTF--IKNVVIQSNVQTPTLMATSVYLNKLRNIIPRNVYGIET-TRHRIFLGCLIL 103

Query: 129 ASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
           A+K L DS   N H+     G ++  E+N +E E L   N+ +
Sbjct: 104 AAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDV 146

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 55/104 (52%), Gaps = 8/104 (7%)

Query: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTA 125
           S++P   S+  ++ RL +++++    LL +  Y++ L  + P+    L S T+HR  L  
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLAC 138

Query: 126 TTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNY 167
             +++K   DS   N H+AK   G     ++N++E + +  +N+
Sbjct: 139 LILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNW 182

>Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W
           (REAL)
          Length = 437

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 9/106 (8%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL---------SSVFPEFRLDSL 116
           F+ +  PS+S  D+L R+      E  V L +++ I++L           +  + +L   
Sbjct: 302 FYMKSKPSLSSVDFLKRIQDKCKYEPTVYLVAMFLIEMLFLTRNKNGDDGLQLKRKLKEK 361

Query: 117 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFL 162
            VHR ++ A  +++K L D   ++ +++KV G+    L  LE   L
Sbjct: 362 EVHRVIIAAVRLSTKLLEDYVHSHEYFSKVCGISKRLLTKLEVSLL 407

>NDAI0I00860 Chr9 complement(197860..199491) [1632 bp, 543 aa] {ON}
           Anc_6.236 YGL134W
          Length = 543

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 16/123 (13%)

Query: 52  NDAYTESNTLQLTRFHSRVPPSISVYDYLIRL-TKYSSLEHCVLLASVYYIDLLSSVFPE 110
           N+A ++S  ++ + F  +  PS++   YL R+ TK     H  L+A+     LL ++F E
Sbjct: 397 NEAASDSTMIRYSNFKMKSLPSLTFELYLDRIHTKCEYDSHIYLIATY----LLQTLFLE 452

Query: 111 -----------FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLEN 159
                       +L+S   HR ++    +++K L D   ++ ++ KV G+    L+ LE 
Sbjct: 453 RDSTSNSLKLKMKLESTETHRLIIATIRISTKLLEDHVHSHEYFCKVCGISKKLLSKLEI 512

Query: 160 EFL 162
             L
Sbjct: 513 SLL 515

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 64  TRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL--------SSVFPEFRLDS 115
           +RF  +  PS+S  D++ R+      +  V L++ Y + +L        +S+  +F+L  
Sbjct: 349 SRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSAESNSLELKFKLQR 408

Query: 116 LTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGV 149
             +HR ++    +++K L D   ++ +++KV GV
Sbjct: 409 DGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 20/148 (13%)

Query: 67  HSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSL----TVHRFL 122
           H+ VP   S+  ++ RL +Y+++    LL +V Y++ L  + P    D+     T HR  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPS---DAAGLPTTCHRIF 106

Query: 123 LTATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRILPRDENIKRCS 180
           L    +++K   DS   N H+ K   G     ++N++E + L    +       +++  S
Sbjct: 107 LACLILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW-------DLRVES 159

Query: 181 REHQEGTFSFAN-IPADAEQDQKSEENR 207
            E  +  +  AN I  D E+  +  + R
Sbjct: 160 EELWDNLYDLANPIRRDLERGAQINKTR 187

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 60/126 (47%), Gaps = 20/126 (15%)

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVASKG 132
           S+  ++ +L +Y+++    LL +V Y+  L ++ P     L S T HR  L    +++K 
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPS-TTHRIFLACLILSAKF 113

Query: 133 LCDSFCTNTHYAKV--GGVQCNELNVLENEFLT------RVN---------YRILPRDEN 175
             DS   N H+++   G     ++N++E + L       R+N         + +LP  E+
Sbjct: 114 HNDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALAQDLQWLLLPIKED 173

Query: 176 IKRCSR 181
           +KR  +
Sbjct: 174 LKRSKK 179

>Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W
           (REAL)
          Length = 442

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL-------SSVFPEFRLDSLTV 118
           F+ +  PS+S  D+L R+      E  V L + + +D +         +  + +L    +
Sbjct: 309 FYMKSKPSLSSVDFLKRIQDKCEYESTVYLVATFLMDTIYLTRNDNDVLQLKLKLQEKEI 368

Query: 119 HRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLT 163
           HR ++    +++K L D   ++ +++KV GV    L+ LE   L 
Sbjct: 369 HRMIIATVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEVSLLV 413

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVASKG 132
           S+  ++ RL +++++    LL +  Y++ L  + P+    L S TVHR  L    +++K 
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRIFLACLILSAKF 109

Query: 133 LCDSFCTNTHYAKVGG--VQCNELNVLENEFLTRVNY 167
             DS   N H+AK         ++N++E + +  +N+
Sbjct: 110 HNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 36.2 bits (82), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 68/149 (45%), Gaps = 28/149 (18%)

Query: 75  SVYDYLIRLTKYS-SLEHCVLLASVYYIDLLSSVF------PEFRLDSLTVH---RFLLT 124
           S+  YL+ + K S S  + V++AS Y+  L +SV       PEF      VH   R  L+
Sbjct: 87  SIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEF------VHCSKRIFLS 140

Query: 125 ATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQ 184
              ++ K L D   +   ++ + G+   +L++LE   L R+NY ++     I +      
Sbjct: 141 CLILSHKFLNDKTFSMKAWSLISGISKRDLSILERWCLMRLNYHLVVDVTEINK------ 194

Query: 185 EGTFSFANIPADAEQDQKSEENRFDVLEN 213
              +SF N+    + D K   + + +L N
Sbjct: 195 ---WSFTNLK---KWDNKKMVSNYSILYN 217

>ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {ON}
           weakly similar to uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 428

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/109 (20%), Positives = 49/109 (44%), Gaps = 8/109 (7%)

Query: 63  LTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL--------SSVFPEFRLD 114
             +F  +  P+++  +++ R+    +    V LAS + +  L          +    RL 
Sbjct: 288 FNQFSMKSMPTVTYQEFITRIQTKCTYSPAVFLASAFLLQTLCLMRNDNNGELCLRHRLQ 347

Query: 115 SLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLT 163
              +HR ++    +A+K + D   ++ +++KV G+    L+ LE   +T
Sbjct: 348 DSQIHRLVIACVRIATKIMEDHVHSHQYFSKVCGISKRLLSRLEISLVT 396

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 12/96 (12%)

Query: 69  RVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSL----TVHRFLLT 124
           R+P   S+  ++ RL +Y+++    LL +V Y++ L  + P+   D+     T+HR  L 
Sbjct: 51  RLP---SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPK---DATGLPSTIHRIFLA 104

Query: 125 ATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLE 158
              +++K   DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>Kpol_228.1 s228 (611..2293) [1683 bp, 560 aa] {ON} (611..2293)
           [1683 nt, 561 aa]
          Length = 560

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 8/115 (6%)

Query: 52  NDAYTESNTLQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL------- 104
           N    E+  L+   F+ +  P++S  D L R+         + L S Y +  L       
Sbjct: 410 NKTKEEAINLEYNHFNMKSVPTVSYKDLLNRIHTKCMFGSIIYLGSTYLLQSLILERDFE 469

Query: 105 -SSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLE 158
            +S+    +L S  +HR ++ +  VA+K L D   ++ +  KV G+    L  LE
Sbjct: 470 DNSLRIRRKLKSTEIHRVVIASIRVATKLLEDFVHSHEYITKVCGISKKLLTKLE 524

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 87  SSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYA 144
           S+++   L+A+   ++ L  + P   + ++S T HR  L    +++K L DS   N H+A
Sbjct: 60  SNVQTPTLMATTVLLEKLKKIIPSNVYGIES-TRHRIFLGCLILSAKSLNDSSPLNKHWA 118

Query: 145 KV--GGVQCNELNVLENEFLTRVNYRI 169
           K     +   E+N +E E L   ++ +
Sbjct: 119 KYTESYIHLREVNTIERELLNYFDWNV 145

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 6/93 (6%)

Query: 69  RVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFP-EFRLDSLTVHRFLLTATT 127
           R+P   S+  ++ RL +Y+++    LL +V Y++ L  + P + +    T+HR  L    
Sbjct: 56  RLP---SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLFLACLI 112

Query: 128 VASKGLCDSFCTNTHYAKV--GGVQCNELNVLE 158
           +++K   DS   N H+ +   G     ++N++E
Sbjct: 113 ISAKFHNDSSPLNKHWTRYTDGLFSLEDINLME 145

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 8/97 (8%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPE--FRLDSLTVHRFLL 123
           +  R+P   S+  ++  L +Y+++    LL +V Y++ L  + P+    L S T+HR  L
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPS-TIHRIFL 103

Query: 124 TATTVASKGLCDSFCTNTHYAKV--GGVQCNELNVLE 158
               +++K   DS   N H+ K   G     ++N++E
Sbjct: 104 ACLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 18/129 (13%)

Query: 75  SVYDYLIRLTKYSSLEHCVLLA-SVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGL 133
           S++ ++ RL +Y+++    LL  +VY   L   +  +      T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 134 CDSFCTNTHYAKV--GGVQCNELNVLENEFL------TRVNYRILPRD---------ENI 176
            DS   N H+ K   G     ++N++E + L       RV +R L RD          ++
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRDLAPLLAPIKLDL 172

Query: 177 KRCSREHQE 185
            RC+R H  
Sbjct: 173 TRCARMHAR 181

>NDAI0F01480 Chr6 (365467..366939) [1473 bp, 490 aa] {ON} Anc_6.236
           YGL134W
          Length = 490

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 46/101 (45%), Gaps = 8/101 (7%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL--------SSVFPEFRLDSLT 117
           F  +  PS+S  D+L R+         + +++ Y   +L          +  + +L  + 
Sbjct: 355 FTMKNTPSLSYEDFLKRIQSKCMFGAIIYMSATYLFQILLLNRDDSKGPIKLKNKLQEVE 414

Query: 118 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLE 158
           +HR ++    VA+K + D   ++ ++ KV GV    L+ LE
Sbjct: 415 IHRMIIATIRVATKLVEDFVHSHQYFCKVCGVSKRLLSKLE 455

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 47/107 (43%), Gaps = 11/107 (10%)

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLL--------SSVFPEFRLDSLTVHRFLLTAT 126
           S+  ++  +TK S  +  +LL + YY   L         S  PEF   +    R  LT  
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEF---AFCAKRSFLTCI 150

Query: 127 TVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRD 173
            +A K L DS  +   ++ + G+    L+ +E   L +++Y +   D
Sbjct: 151 IIAHKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON}
           Anc_5.347 YHR071W
          Length = 199

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 98  VYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVL 157
           +Y   L +   P+F   +    R  L+   +A K L D+  T   +  + G+  N+L ++
Sbjct: 93  IYDGQLWNGKLPDF---ARCSKRIFLSCLILAHKYLNDNSFTMKTWNMISGLSQNDLCLM 149

Query: 158 ENEFLTRVNYRILPRDENI 176
           E   L +++YR+L  +E++
Sbjct: 150 ERWGLEKLDYRLLVAEEDL 168

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 71  PPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLD-SLTVHRFLLTATTVA 129
           P  + +  ++  L   S ++   L+A+  Y+D LS + P        T HR  L    ++
Sbjct: 50  PKPVELSLFVEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGIETTKHRMFLGCLILS 109

Query: 130 SKGLCDSFCTNTHYAKV--GGVQCNELNVLENEFLTRVNYRI 169
           SK L DS   N H+ K   G +   E+N +E E L+  N+ I
Sbjct: 110 SKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELLSYFNWDI 151

>KAFR0K02280 Chr11 (465010..465705) [696 bp, 231 aa] {ON} Anc_5.347
           YHR071W
          Length = 231

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 6/93 (6%)

Query: 83  LTKYSSLEHCVLLASVYYIDLL---SSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFCT 139
           L +  S +H  +LAS Y+  L    S   PEF   +    R  L    +A K   D   +
Sbjct: 97  LKRSKSNKHVAVLASFYFQKLHGLNSKDIPEF---AKCPKRIFLVCLILAHKFSNDVTFS 153

Query: 140 NTHYAKVGGVQCNELNVLENEFLTRVNYRILPR 172
           N  ++ + G++  +L+V+E   L ++NY +  +
Sbjct: 154 NKSWSLISGLKSKDLSVMERFCLNQLNYDLFIK 186

>CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {ON}
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 481

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 44/101 (43%), Gaps = 8/101 (7%)

Query: 66  FHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLL--------SSVFPEFRLDSLT 117
           F  +  PSIS +D++ R+         + L + Y + +L          +  + +L    
Sbjct: 346 FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILFLTREYNDGPLRLKHKLQQNE 405

Query: 118 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLE 158
           VHR ++    +A+K L D   ++ +  KV G+    +  LE
Sbjct: 406 VHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLE 446

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 10/120 (8%)

Query: 64  TRFHSRVPPS-ISVYDYLIRLTKYSSLEH-CVLLASVYYIDLLSSV-----FPEFRLDSL 116
           ++ H R+  S  S+ ++L  +TK + +    +LLAS+Y+  L+ S       PEF   + 
Sbjct: 60  SKSHKRINNSKTSIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEF---AY 116

Query: 117 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENI 176
              R LL    +A K   D   +   + +V G+    + ++E   L ++NY +   +E +
Sbjct: 117 CGKRLLLVCIILAHKFSNDITFSMRVWTQVSGLPTRSIAIMERWCLKQLNYGLTVTNEAM 176

>Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON}
           (29070..30029) [960 nt, 320 aa]
          Length = 319

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 59/144 (40%), Gaps = 16/144 (11%)

Query: 75  SVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLT--------VHRFLLTAT 126
           ++  +++ +   S     VLL + YY   + S+ P    +S +          R  L   
Sbjct: 150 TIVPFIVEIIDRSKCNKNVLLLATYYFKQIYSLNPISTKNSKSPLPTFSHCAKRIFLCCL 209

Query: 127 TVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYR-------ILPRDENIKRC 179
            ++ K L D+  T   +  + G+    L+++E   LTR+NY        +L  +E + + 
Sbjct: 210 IISHKFLNDNTFTMKSWHCISGLPQTHLSLMERWCLTRLNYNLNVHQDALLQLEEILVQT 269

Query: 180 SREHQEGTFSFAN-IPADAEQDQK 202
           S      T S    +P D E + K
Sbjct: 270 SESQMLATPSKKRPLPVDGEDNDK 293

>Suva_12.176 Chr12 (265904..268816) [2913 bp, 970 aa] {ON} YJR089W
           (REAL)
          Length = 970

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 5/64 (7%)

Query: 192 NIPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDA--SPDKSYDLNFTLEE-PELVIDP 248
           N  AD  +  K +ENR  +++NY+H ++  I N DA  S D+  DL F +++ P   +D 
Sbjct: 854 NARADFGEWCKIDENRL-LVKNYFHDLLKYINNNDATLSNDQDGDLAFLIKQMPNEELD- 911

Query: 249 ITFT 252
           +TFT
Sbjct: 912 MTFT 915

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,044,096
Number of extensions: 1353311
Number of successful extensions: 4119
Number of sequences better than 10.0: 116
Number of HSP's gapped: 4175
Number of HSP's successfully gapped: 117
Length of query: 351
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 241
Effective length of database: 40,868,139
Effective search space: 9849221499
Effective search space used: 9849221499
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)