Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30276.22ON54954925880.0
ACR004W6.22ON56354619020.0
KLLA0D01221g6.22ON56652718380.0
SAKL0E01364g6.22ON54153918090.0
KLTH0C11176g6.22ON53653517960.0
TDEL0G044706.22ON54254117960.0
KAFR0A050706.22ON56454117890.0
Kpol_1037.276.22ON54654617840.0
Kwal_56.224376.22ON53653217390.0
TBLA0G009706.22ON55954317400.0
ZYRO0C07744g6.22ON54754917370.0
NCAS0D021606.22ON56355017250.0
KNAG0F028906.22ON56354017230.0
Suva_15.1776.22ON54453117090.0
NDAI0C026306.22ON58054417120.0
CAGL0E02629g6.22ON54852917070.0
YOR002W (ALG6)6.22ON54453117010.0
Skud_15.1636.22ON54453117000.0
Smik_15.1716.22ON54453116950.0
TPHA0J003506.22ON55955816700.0
TBLA0A093105.669ON5462602712e-24
TPHA0J013805.669ON5752622676e-24
Kpol_1018.735.669ON6212762623e-23
Kwal_55.217425.669ON5552702605e-23
Skud_15.2345.669ON5772622571e-22
Smik_15.2475.669ON5772622571e-22
YOR067C (ALG8)5.669ON5772652571e-22
Suva_8.1185.669ON5762622534e-22
CAGL0L10450g5.669ON5502652507e-22
KLLA0F16621g5.669ON5612542482e-21
ZYRO0A11506g5.669ON5562672472e-21
KLTH0F17666g5.669ON5552732472e-21
ADR210C5.669ON5722662436e-21
KNAG0L019205.669ON5682622392e-20
NCAS0G004505.669ON5702712383e-20
TDEL0B025405.669ON5692632364e-20
KAFR0D024405.669ON5752632348e-20
NDAI0F005105.669ON5702632331e-19
SAKL0G00836g5.669ON5612672223e-18
Ecym_40515.669ON6042592162e-17
KNAG0A071902.571ON48984761.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3027
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...  1001   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   737   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   712   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   701   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   696   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   696   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   693   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   691   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   674   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   674   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   673   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   669   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   668   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   662   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   664   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   662   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   659   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   659   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   657   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   647   0.0  
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   108   2e-24
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   107   6e-24
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   105   3e-23
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   104   5e-23
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   103   1e-22
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   103   1e-22
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   103   1e-22
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   102   4e-22
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   100   7e-22
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   100   2e-21
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   100   2e-21
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   100   2e-21
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...    98   6e-21
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...    97   2e-20
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...    96   3e-20
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...    96   4e-20
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...    95   8e-20
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...    94   1e-19
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...    90   3e-18
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    88   2e-17
KNAG0A07190 Chr1 complement(1129595..1131064) [1470 bp, 489 aa] ...    34   1.2  

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/549 (90%), Positives = 498/549 (90%)

Query: 1   MSGSSGAVASEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLA 60
           MSGSSGAVASEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLA
Sbjct: 1   MSGSSGAVASEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLA 60

Query: 61  VXXXXXXXXXXXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILG 120
           V               DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILG
Sbjct: 61  VGLGGYSGKGKGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILG 120

Query: 121 RLGSFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPI 180
           RLGSFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPI
Sbjct: 121 RLGSFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPI 180

Query: 181 GQYVACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQ 240
           GQYVACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQ
Sbjct: 181 GQYVACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQ 240

Query: 241 MALYYSPVIFAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVY 300
           MALYYSPVIFAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVY
Sbjct: 241 MALYYSPVIFAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVY 300

Query: 301 RVFPFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPK 360
           RVFPFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTT            LYPK
Sbjct: 301 RVFPFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPK 360

Query: 361 KFLLPYALAACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTX 420
           KFLLPYALAACSMAFFLFSFQVHEK            HISTNWDVLSMVAWINNVALFT 
Sbjct: 361 KFLLPYALAACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTL 420

Query: 421 XXXXXXXXXXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPK 480
                      QYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPK
Sbjct: 421 WPLLKKDGLLLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPK 480

Query: 481 NIFWRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYR 540
           NIFWRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYR
Sbjct: 481 NIFWRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYR 540

Query: 541 MRNSSLNEL 549
           MRNSSLNEL
Sbjct: 541 MRNSSLNEL 549

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/546 (63%), Positives = 419/546 (76%), Gaps = 5/546 (0%)

Query: 9   ASEKGQ-----DTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXX 63
           + E GQ     D ++  ++E+FFASPLYDFLYPLRPV NQW+AKYII+IFALI+RLAV  
Sbjct: 18  SKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGL 77

Query: 64  XXXXXXXXXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLG 123
                        DFEAQRHWME+T  +P+S+WYF+ L+YWGLDYPPLTAYHSY+LG+LG
Sbjct: 78  GGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLG 137

Query: 124 SFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQY 183
           S+++  WF L+ SRG+ES DLKS+MR+TV+LSEL  YIPAV+YFTRWIGR R QSPIGQY
Sbjct: 138 SYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQY 197

Query: 184 VACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMAL 243
           +A AAILFQP+LILIDHGHFQYNCVMLGL V  INNLLD++Y  AA+ FV SLGFKQMAL
Sbjct: 198 IAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMAL 257

Query: 244 YYSPVIFAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVF 303
           YY+PV+F YL SRS YYPR N PRF  +A+ATL+ FG LYAPL L G+   I QS++RVF
Sbjct: 258 YYAPVMFVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVF 317

Query: 304 PFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFL 363
           PF RG+FEDKVANFWCVTNV++KY+  YT  QL+F+ L+ T            LYPKKF+
Sbjct: 318 PFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFM 377

Query: 364 LPYALAACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXX 423
           LPYALAACSM+FFLF FQVHEK            + ST+W+VLSMVAWINN+ALFT    
Sbjct: 378 LPYALAACSMSFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPL 437

Query: 424 XXXXXXXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIF 483
                   QYAIMFLLSNWL+GNFSF+TPTFLPK LTPGPSVSDVAD YRRRSLLP NI 
Sbjct: 438 LKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNII 497

Query: 484 WRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRN 543
           WRIIIV SY+C+  IH+ +L+  P +  PDIWVLA C +G + F  FW+WN Y+++ MRN
Sbjct: 498 WRIIIVVSYICVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRN 557

Query: 544 SSLNEL 549
           S++++L
Sbjct: 558 STISDL 563

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/527 (62%), Positives = 402/527 (76%)

Query: 23  ESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXXXXDFEAQR 82
           E+FFASP+YDFL P RPV NQW AKY+I+IFALI+R AV               DFEAQR
Sbjct: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99

Query: 83  HWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFESI 142
           HWMEIT  LP+  WY+YDL+YWGLDYPPLTAYHSY+LG+LGSF    WF L +SRG+ES+
Sbjct: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159

Query: 143 DLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILIDHGH 202
           +LKS+MR TV++SEL+ YIPAV+YFT+W+G++R+QSPIGQY+A AAILFQP+LIL+DHGH
Sbjct: 160 NLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGH 219

Query: 203 FQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAYYPR 262
           FQYNCVMLG+ VYT+NNLLD FY   AICFVLSL FKQMALYYSP+ FAYL S+S Y P 
Sbjct: 220 FQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPG 279

Query: 263 FNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGIFEDKVANFWCVTN 322
            N PR   I+++T L F   + P+ +FG ++N++QS++R+FPF+RGIFEDKVANFWCV+N
Sbjct: 280 INLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVANFWCVSN 339

Query: 323 VIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALAACSMAFFLFSFQV 382
           + IKYR L+TQK LQ Y LL T            LYPK+ LLPYALAACSM+FFLFSFQV
Sbjct: 340 IFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSFQV 399

Query: 383 HEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXXXXQYAIMFLLSNW 442
           HEK            + S +W+VLS+V WINNVALFT            QY +MF+ SNW
Sbjct: 400 HEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFSNW 459

Query: 443 LLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFIHLLD 502
           L+GNFSFVTP FLPKFLTPGPS+SD+  DYRR SLLPK++ WR+IIV SY+ M  IH LD
Sbjct: 460 LIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHFLD 519

Query: 503 LYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549
            YV PP  YPD+WVLA C+LGF+CF  FW+WN Y+L+ MRNS+L +L
Sbjct: 520 YYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/539 (62%), Positives = 407/539 (75%)

Query: 10  SEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXX 69
           S K +   R  V+ESFFASPL+DFL P RPVANQW AKYII++FALI+R  V        
Sbjct: 2   SSKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGM 61

Query: 70  XXXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNAT 129
                  DFEAQRHWME+TT LP+S+WY+YDL YWGLDYPPLTAYHSYILG+LG   + T
Sbjct: 62  NVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPT 121

Query: 130 WFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAI 189
           WF+L  SRG ES+DLKS+MR TVLLSEL+ YIP V+YF +WIG+HR Q+PIGQY+A AAI
Sbjct: 122 WFQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAI 181

Query: 190 LFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVI 249
           LFQPSLILIDHGHFQYN VMLGL VY INNLLDE+Y  AAICFVLS+ FKQMALYY+P+ 
Sbjct: 182 LFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIF 241

Query: 250 FAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGI 309
           F+YL S+S + P FN PR   +A ATL++F A++ PL ++G  RN++QS++R+FPFSRGI
Sbjct: 242 FSYLLSKSLFSPLFNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGI 301

Query: 310 FEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALA 369
           FEDKVANFWC +N+ IKY+ LYTQ QLQ Y L  T             YPKK L+PYAL 
Sbjct: 302 FEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALT 361

Query: 370 ACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXX 429
           ACSM+FFLFSFQVHEK            + ST+W+VLSMV+WINN+A FT          
Sbjct: 362 ACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGL 421

Query: 430 XXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIV 489
             QYA + LLSNWL+GNFSFVTP FLPKFLTPGPS SDV+++YRRRSLLP NIFW++IIV
Sbjct: 422 VLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIV 481

Query: 490 SSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNE 548
           +SY+ M  +HLLD YVQPP  YPD+WVL  C+LGF  F  FW+WNYY+++ +RN +L +
Sbjct: 482 ASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/535 (61%), Positives = 404/535 (75%)

Query: 15  DTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXX 74
           D R+S  +ESFFASPLYDFL P RPVANQ+ A+Y+I+IFAL++R AV             
Sbjct: 2   DARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPM 61

Query: 75  XXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLN 134
             DFEAQRHWME+TT LP+S+WY++DL+YWGLDYPPLTAYHSY LG+LGS +N  WF L 
Sbjct: 62  HGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALG 121

Query: 135 TSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPS 194
           +SRG E+ +LK++MR TV+LSE   YIPAV+YFT+W G  R QSPIGQY+A AAILFQPS
Sbjct: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181

Query: 195 LILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLF 254
           LILIDHGHFQYN VMLGL VY INNLLD F+G AAICF+LSL FKQMAL+YSP+ FAYL 
Sbjct: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241

Query: 255 SRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGIFEDKV 314
           SRS + P F F RF  +A++T++TF  +++PL +FG  +N++QS++R+FPFSRGIFEDKV
Sbjct: 242 SRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKV 301

Query: 315 ANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALAACSMA 374
           ANFWCV+NVI+KY + +TQ QLQ      T            LYPKK ++PY LAACSMA
Sbjct: 302 ANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMA 361

Query: 375 FFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXXXXQYA 434
           FFLF FQVHEK              ST+W+VL++V+WINNVALFT            QY 
Sbjct: 362 FFLFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYG 421

Query: 435 IMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVC 494
           IM LLSNWL+GNFSFVTP FLP F+TPGPS+S+VA+ YRRRS LP NI W+I+I++SY+ 
Sbjct: 422 IMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIV 481

Query: 495 MAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549
           MA IH+LDL+VQPP   PD+WVL  CALGF CF+ FWLWN Y+L+ MRN S+ +L
Sbjct: 482 MAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/541 (60%), Positives = 403/541 (74%), Gaps = 1/541 (0%)

Query: 10  SEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXX 69
           + K ++ +R+ VEESF+ASPLYDFLYP RP  +QW  +Y+I++FALI+  AV        
Sbjct: 2   APKNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQ 61

Query: 70  XXXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNAT 129
                  DFEAQRHWMEIT  L  S+WY++DLEYWGLDYPPLTAYHSY+LG++GSF+   
Sbjct: 62  FSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPE 121

Query: 130 WFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAI 189
           WF+LN SRG E+ DLK+FMR TVLLSE + YIPAV+YFT+W+G+HR +SPIGQ+++ AAI
Sbjct: 122 WFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAI 181

Query: 190 LFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVI 249
           LFQPSL+LIDHGHFQYNCVMLGL VY IN+L +EFY  AAICFVLS+ FKQMALYY+P+ 
Sbjct: 182 LFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIF 241

Query: 250 FAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLF-GDFRNIIQSVYRVFPFSRG 308
           FAYL S+S + PRFNFPR   IA+AT+L+F A+YAPL +F G   N+IQSV+R+FPF+RG
Sbjct: 242 FAYLLSKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARG 301

Query: 309 IFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYAL 368
           IFEDKVANFWCVTNV  KY+ ++ Q+QLQ Y L+ T            LYPKK ++ YAL
Sbjct: 302 IFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYAL 361

Query: 369 AACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXX 428
           A CSM+F+LFSFQVHEK            + S+NWDVLSM  WINNV LFT         
Sbjct: 362 ATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDG 421

Query: 429 XXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIII 488
              QY + F LSNWLLGNFSFVTP FLPKFLTPGPSVS V  +YRRRS LP N+ W+III
Sbjct: 422 LTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIII 481

Query: 489 VSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNE 548
           VSSY  M  +H++D  + PP +YPD+WVL  CALGF CFT FWLW+YY L+ M   +L +
Sbjct: 482 VSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQ 541

Query: 549 L 549
           L
Sbjct: 542 L 542

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/541 (60%), Positives = 397/541 (73%), Gaps = 2/541 (0%)

Query: 11  EKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXX 70
           +K        +EE F+ASPLYDFLYP RP  NQW A+YII+ FALI+R A+         
Sbjct: 24  KKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMG 83

Query: 71  XXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATW 130
                 DFEAQRHWMEIT  LPIS+WY++DL+YWGLDYPPLTAYHSYILG++GSF+   W
Sbjct: 84  HSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKW 143

Query: 131 FKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAIL 190
           F LN SRG E   +KS+MR TVL+SE V Y PA++YF++W G+HRNQSPIGQY+A  AIL
Sbjct: 144 FTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAIL 203

Query: 191 FQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIF 250
           FQPSL+LIDHGHFQYN VMLGL VY INNLLD+FY  A++CFVLS+ FKQM+LYY+P+ F
Sbjct: 204 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFF 263

Query: 251 AYLFSRSAYYPR-FNFPRFAGIAIATLLTFGALYAPLCLFGD-FRNIIQSVYRVFPFSRG 308
            YL S+S ++PR FN PR  GIA  T++TF A+Y+PL +FG    N+IQSV+R+FPF+RG
Sbjct: 264 GYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARG 323

Query: 309 IFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYAL 368
           IFEDKVANFWCVTN++IKY+  +TQ QLQ Y L  T            LYPKK LLPYAL
Sbjct: 324 IFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYAL 383

Query: 369 AACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXX 428
           AACSM+FFLFSFQVHEK            + ST+W+VLSMV WINNVALFT         
Sbjct: 384 AACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDG 443

Query: 429 XXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIII 488
              QYA+ F LSNWLLGNFSFVTP FLPK LTPGPS+S + ++Y RRSLLP NI W+++I
Sbjct: 444 LILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVI 503

Query: 489 VSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNE 548
           VSSY+ MA  H LD +V+PP NYPDIW+   C +GF  F  FW+W YY L+ +RN +L +
Sbjct: 504 VSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMD 563

Query: 549 L 549
           L
Sbjct: 564 L 564

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/546 (61%), Positives = 401/546 (73%), Gaps = 4/546 (0%)

Query: 8   VASEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXX 67
           +AS+K        VEESFFASPLYDFL P RPV+NQW  +YII+IFALIVR A+      
Sbjct: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60

Query: 68  XXXXXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVN 127
                    DFEAQRHWMEIT  LPIS+WYF+DLEYWGLDYPPLTAYHSY+LG +GSF+N
Sbjct: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120

Query: 128 ATWFKLNTSRGFESI--DLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVA 185
            +WF LN SRG+ES   DLK++MR TV++SE++ YIP V+YFT+W+GRHR QS IGQY+A
Sbjct: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180

Query: 186 CAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYY 245
            AAILFQPSL+LIDHGHFQYN VMLGL VY INNLLDEFY  AA+CFVLS+ FKQMALYY
Sbjct: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240

Query: 246 SPVIFAYLFSRSAYYPRF-NFPRFAGIAIATLLTFGALYAPLCLFGD-FRNIIQSVYRVF 303
           +P+ F YL  RS +  +F N  RF  IAI+T+  F ++YAPL +FG   RN+IQSV+R+F
Sbjct: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300

Query: 304 PFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFL 363
           PF+RG+FEDKVANFWCVTN+ IKY+ LYTQK+LQ Y L+ T             YPKK L
Sbjct: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360

Query: 364 LPYALAACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXX 423
           LPYALAACSM+F+LFSFQVHEK            + ST+W+VLS V+W+NNV LFT    
Sbjct: 361 LPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPL 420

Query: 424 XXXXXXXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIF 483
                   QY + F LSNWL+GNFSF+TP FLPK LTPGP V +  D Y RRSLLP NI 
Sbjct: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480

Query: 484 WRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRN 543
           W+IIIVSSY+ M  IHL +++V PP  YPDIWVL  C LGF CF  FWLWNYY+++ + N
Sbjct: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540

Query: 544 SSLNEL 549
            +L  L
Sbjct: 541 KTLQYL 546

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/532 (60%), Positives = 400/532 (75%)

Query: 17  RRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXXXX 76
           ++    E FFASPLYDFL P RPVANQ+ A+Y+I+IFAL++R AV               
Sbjct: 4   KKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHG 63

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DFEAQRHWME+T  LP+S+WY+YDL+YWGLDYPPLTAYHSY+LG+LGS +N+ WF L +S
Sbjct: 64  DFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSS 123

Query: 137 RGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLI 196
           RG E+ D+K++MR TV+LSE   YIPAV+YFT+W G  R QSPIGQY+A AAILFQPSLI
Sbjct: 124 RGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLI 183

Query: 197 LIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSR 256
           LIDHGHFQYN VMLGL VY+INNLLD +YG AAICFVLSL FKQMALYYSPV FAYL S 
Sbjct: 184 LIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSE 243

Query: 257 SAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGIFEDKVAN 316
               P  N PRF  +A +T+++F  +++PL +FG  +N++QS++R+FPFSRGIFEDKVAN
Sbjct: 244 CLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVAN 303

Query: 317 FWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALAACSMAFF 376
           FWCV+NV+ KY + YTQ++LQ + ++ T             YPKK ++P+ALAACSMAFF
Sbjct: 304 FWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFF 363

Query: 377 LFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXXXXQYAIM 436
           LFSFQVHEK            + ST+W+VLSMV+WINNVALFT            QY I+
Sbjct: 364 LFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGIL 423

Query: 437 FLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMA 496
            LLSNWL+GNFSFVTP FLPKF+TPGPS+S V++ YRRRS LP N FW++IIV+SY+ MA
Sbjct: 424 MLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMA 483

Query: 497 FIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNE 548
            IH+LD +V  P   PD+WVL  CALGF CFT FWLW +Y+L+ MRN++L +
Sbjct: 484 AIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/543 (60%), Positives = 405/543 (74%), Gaps = 15/543 (2%)

Query: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXXXXDFEAQ 81
           EE+F+ASPL+DFLYP RPV +QW  +Y+I+IFA+I+R A+               DFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141
           RHWMEIT  LPIS+WY++DL+YWGLDYPP TAYHSY  G+LGSF N  WF LN+SRG+ES
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 142 ID--LKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILID 199
            D  LK++MR TV+LSE V YIPAV+YFT+W+G+HRNQSPIGQ++A AAILFQPSL+LID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 200 HGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAY 259
           HGHFQYN VMLGL VY INNLLDEFYG AAICFVLSL FKQMALYYSP+ F YL S+S  
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 260 YPRFNFPRFAGIAIATLLTFGALYAPLCLFGD-------------FRNIIQSVYRVFPFS 306
           +P  N  RF  +AI+T+++F  ++ P+ LFG                N+IQ + R+FPF+
Sbjct: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316

Query: 307 RGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPY 366
           RGIFEDKVANFWCVTNV+IKYREL+TQ+QLQFY L+ T            LYP+KFL+PY
Sbjct: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376

Query: 367 ALAACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXX 426
           ALAACSM+FFLFSFQVHEK            + ST+W+VLS+V WINNVALFT       
Sbjct: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436

Query: 427 XXXXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRI 486
                QY + + LSNWL+GNFSF+TP FLP FLTPGPS+S++ DDYRR SLLP NI W+I
Sbjct: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKI 496

Query: 487 IIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSL 546
           II+SSY+ M  + +LDL+ QPP NYPD+W++  C +GF CF  FWLWN Y++ +MRN +L
Sbjct: 497 IIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556

Query: 547 NEL 549
           N+L
Sbjct: 557 NDL 559

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/549 (60%), Positives = 405/549 (73%), Gaps = 5/549 (0%)

Query: 2   SGSSGAVASEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAV 61
           S +S  V   +  +T     EESF+ASPLYDFLYP +PV +QW  +YII++FA+I+R A+
Sbjct: 3   SKTSKKVEKAQADNT----AEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAI 58

Query: 62  XXXXXXXXXXXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGR 121
                          DFEAQRHW+EIT  LPIS+WY++DLEYWGLDYPPLTAYHSYILG+
Sbjct: 59  GLGPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGK 118

Query: 122 LGSFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIG 181
           LGS +N  WF LN SRG ES DLK++MR TV+LSE++ YIPAV+YFT+W+GRHR  SP+G
Sbjct: 119 LGSLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVG 178

Query: 182 QYVACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQM 241
           Q++A AAILFQP+L+LIDHGHFQYNCVMLG  VY IN+L+DEFY  AA CFVLS+ FKQM
Sbjct: 179 QFIAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQM 238

Query: 242 ALYYSPVIFAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGD-FRNIIQSVY 300
           ALYYSP+ FAYL  R  +     FPRF  IA+AT+ TF  +Y PL + G   +N++QSV+
Sbjct: 239 ALYYSPIFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVH 298

Query: 301 RVFPFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPK 360
           R+FPF+RGIFEDKVANFWCVTN+ +KY++L+TQ+QLQ Y LL T            LYPK
Sbjct: 299 RIFPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPK 358

Query: 361 KFLLPYALAACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTX 420
           K L+P+ALAACSM+FFLFSFQVHEK            + STNWDVLS+V+WINNV LFT 
Sbjct: 359 KHLVPFALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTL 418

Query: 421 XXXXXXXXXXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPK 480
                      QY + F   NWL+GNFSFVTPTFLPKFLTPGPSVS V  +YRRRSLLPK
Sbjct: 419 WPLLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPK 478

Query: 481 NIFWRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYR 540
           +I W++IIV SY+ M  IH+LD++V PP NYPD+WV+  C LGF CF  FWLWNYY+L+ 
Sbjct: 479 SIIWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFS 538

Query: 541 MRNSSLNEL 549
           +   SL +L
Sbjct: 539 LAGQSLQQL 547

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/550 (58%), Positives = 395/550 (71%), Gaps = 4/550 (0%)

Query: 4   SSGAVASEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXX 63
           S       K    +    EESF+ASPLYD LYP RP  +QW  +Y I++F+LI+R AV  
Sbjct: 14  SQKKSGKTKETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGL 73

Query: 64  XXXXXXXXXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLG 123
                        DFEAQRHWMEIT  LPI +WY++DL+YWGLDYPPLTAYHSYI G++G
Sbjct: 74  GPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIG 133

Query: 124 SFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQY 183
           SF N  WF L++SRG+E+ DLK+FMR+TVL+SE + YIP V+YF +W+G+HR QSPIGQ+
Sbjct: 134 SFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQF 193

Query: 184 VACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMAL 243
           +A AAIL QPSLILIDHGHFQYN V LGL VY INNLLDEFY  AA+CFVLS+ FKQM L
Sbjct: 194 IAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTL 253

Query: 244 YYSPVIFAYLFSRSAYYPR-FNFPRFAGIAIATLLTFGALYAPLCLFGD---FRNIIQSV 299
           YYSP+ FAYL S+S + P+ FN PRF  IAIAT+ +F  +Y PL +FG      N++QS+
Sbjct: 254 YYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSI 313

Query: 300 YRVFPFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYP 359
           +R+FPF+RGIFEDKVANFWCVTNVI KY+ L+TQ++LQ Y L+ T             YP
Sbjct: 314 HRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYP 373

Query: 360 KKFLLPYALAACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFT 419
           KK+LLPYAL+ACSMAF+LFSFQVHEK            + ST+ +VLS V+W+NN+ LFT
Sbjct: 374 KKYLLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFT 433

Query: 420 XXXXXXXXXXXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLP 479
                       QY +  LLSNWL+GNFSF+TP FLPK LTPGPSVS + ++Y  RSLLP
Sbjct: 434 LWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLP 493

Query: 480 KNIFWRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLY 539
           +NIFW++IIV SY+ M  IH+LD +V PP  YPD+WV+  C LGF CF  FW+WNYY+L+
Sbjct: 494 RNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLF 553

Query: 540 RMRNSSLNEL 549
            M   SL+ L
Sbjct: 554 SMIKKSLHHL 563

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/540 (57%), Positives = 394/540 (72%), Gaps = 1/540 (0%)

Query: 11  EKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXX 70
           ++ +D     VEE F+ASP+YDFLYP R   +QW  +YII++F LI++ A+         
Sbjct: 24  QRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQ 83

Query: 71  XXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATW 130
                 DFEAQRHWMEIT  LP+S+WY++DL+YWGLDYPP TAYHSY+LG++G+F+   W
Sbjct: 84  TPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPW 143

Query: 131 FKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAIL 190
           F+L+ SRG E+  +KS+MR TVLLSE + YIPA++YFT+W+GR + QSPIGQ+VA AAIL
Sbjct: 144 FELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAIL 203

Query: 191 FQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIF 250
           FQP+L+LIDHGHFQYNCVMLGL VY INNLLD FY  AA+CFVLS+ FKQMALYY+P+ F
Sbjct: 204 FQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFF 263

Query: 251 AYLFSRSAYYPR-FNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGI 309
           A L S+S ++PR FN PRF  +A ATL +   ++APL +FG   N++QS++R+FPF+RGI
Sbjct: 264 AVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRIFPFARGI 323

Query: 310 FEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALA 369
           FEDKVANFWCVTNV  KY+ ++TQ +LQFY L+ T             YPKKFL+PY LA
Sbjct: 324 FEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLA 383

Query: 370 ACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXX 429
           ACSMAFFLFSFQVHEK              STNW+ LSMV W+NNVALFT          
Sbjct: 384 ACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGL 443

Query: 430 XXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIV 489
             QY +  ++ NWLLGNFSF+TP FLPK LTPGPS+S++A++YRRRSLLP NI W+III+
Sbjct: 444 WLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIIL 503

Query: 490 SSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549
            SY+CM  IH+L+  +  P  YPD+WV   C +GF CF  FW+W YY+L  +RN ++ EL
Sbjct: 504 VSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/531 (58%), Positives = 394/531 (74%), Gaps = 3/531 (0%)

Query: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXXXXDFEAQ 81
           EESF+ASP+YDFLYP RPV NQW  +YII + A+IVR A+               DFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEAQ 73

Query: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141
           RHWMEIT  LP+S+WY+YDL+YWGLDYPPLTA+HSY+LG +G+F N +WF L+ SRGFES
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFES 133

Query: 142 ID--LKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILID 199
            D  LK++MR TV++S+++ Y PAV+YFT+W+GR+RNQSPIGQ +A AAILFQPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193

Query: 200 HGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAY 259
           HGHFQYN VMLGL  Y INNLLDE+Y  AA+CFVLS+ FKQMALYY+P+ FAYL SRS +
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLF 253

Query: 260 YPRFNFPRFAGIAIATLLTFGALYAPL-CLFGDFRNIIQSVYRVFPFSRGIFEDKVANFW 318
           +P+FN  R   IA ATL TF  ++APL  L G  RNI Q ++R+FPF+RGIFEDKVANFW
Sbjct: 254 FPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGIFEDKVANFW 313

Query: 319 CVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALAACSMAFFLF 378
           CV+N+ +KY+E ++ +QLQ Y L+ T            L+PKK LLPY L ACSM+FFLF
Sbjct: 314 CVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 379 SFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXXXXQYAIMFL 438
           SFQVHEK            + ST+W+VLS+V+WINNVALFT            QY + FL
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYVVSFL 433

Query: 439 LSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFI 498
           L+NWL+GNFSF+TP FLPK LTPGPS+S +  DYRRRSLLP N+ W+  I+ +Y+ M   
Sbjct: 434 LTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY 493

Query: 499 HLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549
           H LDL+V PP+ YPD+WVL  CA+GF CF+ FW+W+YY+++   N S+ +L
Sbjct: 494 HFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/544 (57%), Positives = 396/544 (72%), Gaps = 5/544 (0%)

Query: 11  EKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXX 70
              Q       +ESF+ASPLYDFLYP RP  +QW  +YII++FA+I+R AV         
Sbjct: 37  NNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFN 96

Query: 71  XXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATW 130
                 DFEAQRHWMEIT  LPIS+WY++DL+YWGLDYPPLTA+HSY+ G++GSF    W
Sbjct: 97  TPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNW 156

Query: 131 FKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAIL 190
           F L  SRG+E  DLK+FMR+TVL SE +CYIPAV+YFT+W+G+ RNQSPIGQ++A AAIL
Sbjct: 157 FTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAIL 216

Query: 191 FQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIF 250
           FQPSLILIDHGHFQ+N VMLGL VYT+NNLLDEFY FAA+CFVLS+ FKQMALYYSP+ F
Sbjct: 217 FQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFF 276

Query: 251 AYLFSRSAYYPR-FNFPRFAGIAIATLLTFGALYAPLCLF----GDFRNIIQSVYRVFPF 305
           AYL S+S ++PR FN PRFA I+ AT+ TF +++ P+  F    G   N++QS+ R+FPF
Sbjct: 277 AYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPF 336

Query: 306 SRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLP 365
           +RGIFEDKVANFWCVTNVI KY+  +TQ+QLQ Y L+ T            LYP+K+LL 
Sbjct: 337 ARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLL 396

Query: 366 YALAACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXX 425
           YAL+ACSM+F+LFSFQVHEK            + ST+ +VLS V+W+NN+ LFT      
Sbjct: 397 YALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456

Query: 426 XXXXXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWR 485
                 QY +  +LSNWL+GNFSF+TP FLPK LTPGPS+  + ++YRR +LLP N  W+
Sbjct: 457 KDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWK 516

Query: 486 IIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSS 545
           +IIV SYV M  IH +D +++PP  YPD+WV+  C LGF CF  FWLWNYY+L+ M   +
Sbjct: 517 VIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKN 576

Query: 546 LNEL 549
           +++L
Sbjct: 577 IHQL 580

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/529 (58%), Positives = 394/529 (74%), Gaps = 1/529 (0%)

Query: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXXXXDFEAQ 81
           EESF+ASPLYDFL+P RP  +QW  ++II++FA+I+R A+               DFEAQ
Sbjct: 20  EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQ 79

Query: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141
           RHWMEIT  LPIS+WY+YDL+YWGLDYPPLTA+HSY+LG+LG+F N  WF L++SRG E+
Sbjct: 80  RHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIET 139

Query: 142 IDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILIDHG 201
             LK++MR TVLLSE + Y+PAV+YFT+W+GR RNQSPIGQ++A AAILFQPSL+LIDHG
Sbjct: 140 QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHG 199

Query: 202 HFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAYYP 261
           HFQYN +MLG  VY INNLLDEFY  AAICFVLS+ FKQM+LYY+P+ FAYL  RS ++P
Sbjct: 200 HFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFP 259

Query: 262 R-FNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGIFEDKVANFWCV 320
           + FN PRF  I+IATL+TF A+++P  +FG    + Q+V R+FPF+RGIFEDKVANFWCV
Sbjct: 260 KLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRIFPFARGIFEDKVANFWCV 319

Query: 321 TNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALAACSMAFFLFSF 380
            N I+K++ L+T  QL+ Y L+ T            LYP+K LLPYALAACSM+F+LFSF
Sbjct: 320 VNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSMSFYLFSF 379

Query: 381 QVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXXXXQYAIMFLLS 440
           QVHEK              S +W+VLSMV+WINNVALFT            QY + F LS
Sbjct: 380 QVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFVCFFLS 439

Query: 441 NWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFIHL 500
           NWL+GNFSF+TP FLPKF+TPGPS+S V+D+YRRRSLLP +IFW++IIVSSY+ M   H 
Sbjct: 440 NWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAYHF 499

Query: 501 LDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549
           LDL+++ P  +PD+WV+  C +GF  F+ FWLW YY+   +   ++ +L
Sbjct: 500 LDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/531 (59%), Positives = 391/531 (73%), Gaps = 3/531 (0%)

Query: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXXXXDFEAQ 81
           EESF+ASP+YDFLYP RPV NQW  +YII + A+I+R  +               DFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQ 73

Query: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141
           RHWMEIT  LP+S+WY+YDL+YWGLDYPPLTA+HSY+LG +GSF N +WF L  SRGFES
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFES 133

Query: 142 ID--LKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILID 199
            D  LK++MR TV++S+++ Y PAV+YFT+W+GR+RNQSPIGQ +A +AILFQPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193

Query: 200 HGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAY 259
           HGHFQYN VMLGL  Y INNLLDE+Y  AA+CFVLS+ FKQMALYY+P+ FAYL SRS  
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 260 YPRFNFPRFAGIAIATLLTFGALYAPL-CLFGDFRNIIQSVYRVFPFSRGIFEDKVANFW 318
           +P+FN  R   IA ATL TF  ++APL  L G  +NI Q ++R+FPF+RGIFEDKVANFW
Sbjct: 254 FPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVANFW 313

Query: 319 CVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALAACSMAFFLF 378
           CVTNV +KY+E +T +QLQ Y L+ T            L+PKK LLPY L ACSM+FFLF
Sbjct: 314 CVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 379 SFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXXXXQYAIMFL 438
           SFQVHEK            + ST+W+VLS+V+WINNVALFT            QYA+ FL
Sbjct: 374 SFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFL 433

Query: 439 LSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFI 498
           LSNWL+GNFSF+TP FLPK LTPGPS+S +  DYRRRSLLP N+ W+  I+ +Y+ M F 
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFY 493

Query: 499 HLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549
           H LD +V PP  YPD+WVL  CA+GF CF+ FWLW+YY+++   + S+ +L
Sbjct: 494 HFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/531 (59%), Positives = 390/531 (73%), Gaps = 3/531 (0%)

Query: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXXXXDFEAQ 81
           EESF+ASP+YDFLYP RPV NQW  +YII + A+IVR A+               DFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQ 73

Query: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141
           RHWMEIT  LP+S+WY+YDL+YWGLDYPPLTA+HS + G +G+F N +WF L+ SRGFES
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFES 133

Query: 142 ID--LKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILID 199
            D  LK++MR TV++S+++ Y PAV+YFT+W+GR+RNQSPIGQ +A AAILFQPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193

Query: 200 HGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAY 259
           HGHFQYN VMLGL  Y INNLLDE+Y  AA+CFVLS+ FKQMALYY+P+ FAYL SRS  
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 260 YPRFNFPRFAGIAIATLLTFGALYAPL-CLFGDFRNIIQSVYRVFPFSRGIFEDKVANFW 318
           +P+FN  R   IA ATL TF  + APL  L G  RNI Q +YR+FPFSRGIFEDKVANFW
Sbjct: 254 FPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANFW 313

Query: 319 CVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALAACSMAFFLF 378
           CVTN+ +KY++ +T +QLQ Y L+ T            L+PKK LLPY L ACSM+FFLF
Sbjct: 314 CVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 379 SFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXXXXQYAIMFL 438
           SFQVHEK            + ST+W+VLS+V+WINNVALFT            QY + FL
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFL 433

Query: 439 LSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFI 498
           LSNWL+GNFSF+TP FLPK LTPGPS+S +  DYRRRSLLP N+ W+  I+ +Y+ M   
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVY 493

Query: 499 HLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549
           HLLDL+V PP  YPD+WVL  CA+GF CF+ FW+W+YY+++   N S+ +L
Sbjct: 494 HLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/531 (58%), Positives = 390/531 (73%), Gaps = 3/531 (0%)

Query: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVXXXXXXXXXXXXXXXDFEAQ 81
           EESF+ASP+YDFLYP RPV NQW  +YII + A+IVR  +               DFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEAQ 73

Query: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141
           RHWMEIT  LP+S+WY+YDL+YWGLDYPPLTA+HSY+LG +GSF N +WF L+ SRGFES
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFES 133

Query: 142 ID--LKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILID 199
            D  LK++MR TV++S+++ Y PAV+YFT+W+GR+RNQSPIGQ +A +AILFQPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193

Query: 200 HGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAY 259
           HGHFQYN VMLGL  Y INNLLDE+Y  AA+CFVLS+ FKQMALYY+P+ FAYL SRS  
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 260 YPRFNFPRFAGIAIATLLTFGALYAPL-CLFGDFRNIIQSVYRVFPFSRGIFEDKVANFW 318
           +P+FN  R   I+ ATL TF  + APL  L G  +NI Q ++R+FPF+RGIFEDKVANFW
Sbjct: 254 FPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGIFEDKVANFW 313

Query: 319 CVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXXXXXXXLYPKKFLLPYALAACSMAFFLF 378
           CVTNV +KY+E ++ +QLQ Y L+ T            L+PKK LLPY L ACSM+FFLF
Sbjct: 314 CVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 379 SFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAWINNVALFTXXXXXXXXXXXXQYAIMFL 438
           SFQVHEK            + ST+W+VLS+V+WINNVALFT            QYA+ FL
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQYAVSFL 433

Query: 439 LSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAFI 498
           LSNWL+GNFSF+TP FLPK LTPGPS+S +  DYRRRSLLP N+ W+  I+ +Y+ M   
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY 493

Query: 499 HLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549
           H LDL+V PP  YPD+WVL  C +GF CF+ FW+W+YY+++   + S+ +L
Sbjct: 494 HFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/558 (57%), Positives = 397/558 (71%), Gaps = 11/558 (1%)

Query: 3   GSSGAVASEK-GQDTRRSCVE--------ESFFASPLYDFLYPLRPVANQWSAKYIILIF 53
           G SG   S+K  + T ++ +         E F+ASPLY FL P +   NQW + YII++F
Sbjct: 2   GKSGKHNSKKFVKQTHKNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLF 61

Query: 54  ALIVRLAVXXXXXXXXXXXXXXXDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTA 113
           ALI+R A+               DFEAQRHWMEIT  LPIS+WYFYDL+YWGLDYPPLTA
Sbjct: 62  ALIIRCAIGLGPYSGMNEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTA 121

Query: 114 YHSYILGRLGSFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGR 173
           YHSYI G +G F N  WF+L TSRG E  +LK+FMR+T ++SE++ YIPA++YFT W+G+
Sbjct: 122 YHSYICGLIGKFFNPAWFELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGK 181

Query: 174 HRNQSPIGQYVACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFV 233
            R QSP+GQY+A AAILFQP L+LIDHGHFQYN VMLGL VY INNLLD+ Y  AAI FV
Sbjct: 182 QRKQSPMGQYIAAAAILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFV 241

Query: 234 LSLGFKQMALYYSPVIFAYLFSRSAYYPRF-NFPRFAGIAIATLLTFGALYAPLCLFGDF 292
           +S+ FKQM+LYY+P+ FAYL  RS +  +F N  RF  IAIAT+++F  ++APL +FG  
Sbjct: 242 MSICFKQMSLYYAPIFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGG 301

Query: 293 -RNIIQSVYRVFPFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTXXXXXXX 351
            RNIIQSV+R+FPF+RGIFEDKVANFWCVTNVI+KY+  YTQ +LQ Y L+ T       
Sbjct: 302 KRNIIQSVHRIFPFARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPA 361

Query: 352 XXXXXLYPKKFLLPYALAACSMAFFLFSFQVHEKXXXXXXXXXXXXHISTNWDVLSMVAW 411
                 +PKK LLPY+LAAC+M+FFLFSFQVHEK            + ST+W+VLS+V+W
Sbjct: 362 MVTILWFPKKHLLPYSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSW 421

Query: 412 INNVALFTXXXXXXXXXXXXQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADD 471
           INNVALFT            QY + F+LSNWL+GNFSF TP FLPK LTPGP + +V   
Sbjct: 422 INNVALFTLWPLLKKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTH 481

Query: 472 YRRRSLLPKNIFWRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFW 531
           YRRRSLLP NI W+IIIV SY+ M  I  L+L+V+PP  YPDI+VL  C LGF CFT+FW
Sbjct: 482 YRRRSLLPNNIIWKIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFW 541

Query: 532 LWNYYQLYRMRNSSLNEL 549
           LWNYY+L+ + + +L  L
Sbjct: 542 LWNYYKLFTLTSKNLQYL 559

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 127/260 (48%), Gaps = 14/260 (5%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGR-LGSFVNATWFKLNT 135
           DF+  R+W+ IT  LP+  WY+ +   W LDYPP  AY  + L + +  FV         
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 136 SRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
             G        F R+TV++SE++ ++   ++        + QS    +V  ++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
           ++IDH HFQYN  + G+++ +I    ++ Y    + + ++L FK + LY +P  F +L  
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 256 RSAY-YPRFNFPRFAGIAI----ATLLTFGALYAPL--CLFGDF-RNIIQSVYRVFPFSR 307
                +  F F  +  + +      L+  G +   +    FG F R++ Q + R+FPFSR
Sbjct: 219 AYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQLLSRLFPFSR 278

Query: 308 GIFEDKVA-NFWCVTNVIIK 326
           G+     A NFW + + + K
Sbjct: 279 GLTHAYWAPNFWAIYSFVDK 298

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  107 bits (267), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 128/262 (48%), Gaps = 18/262 (6%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT+ LPIS+WY+ +   W LDYPP  AY  ++L R    +      L+  
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 137 R-GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
             G   +    F R+TV++SE++ +     Y      + R Q     +V  ++I+  P  
Sbjct: 124 EVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLSPGF 179

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
           ++IDH HFQYN  +  + + +I     + Y   A+ + +SL FK + LY +P  F +L  
Sbjct: 180 LIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFLL- 238

Query: 256 RSAYYPRF-NFPRFAGIAIATLLTFGALYA---------PLCLFGDFRNIIQSVYRVFPF 305
             AY   F NF   + + + +++ +  L+           +C       + Q + R+FPF
Sbjct: 239 -RAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAPFIFQLPQVLSRLFPF 297

Query: 306 SRGIFEDKVA-NFWCVTNVIIK 326
           SRG+     A NFW + + I K
Sbjct: 298 SRGLTHAYWAPNFWAMYSFIDK 319

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 123/276 (44%), Gaps = 46/276 (16%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+WM IT  LPIS+WYF +   W LDYPP  AY  + L +         F     
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQ---------FVPKIV 159

Query: 137 RGFESIDLKS----------FMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVAC 186
           R    +D+            F R+TV++SE+  +     Y        R QS    +V  
Sbjct: 160 RDDGCLDIVEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVA 215

Query: 187 AAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYS 246
           ++I+  P  +++DH HFQYN  +  +++ +I     + Y   A+ + ++L FK + LY +
Sbjct: 216 SSIVLSPGFLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLA 275

Query: 247 PVIFAYLFSRSAY---YPRFNFP------------RFAGIAIATLLTFGALYAPLCLFGD 291
           P  F +L    AY   +  F F             R   +    L  FG  +AP      
Sbjct: 276 PCYFVFLL--RAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPFIF--- 330

Query: 292 FRNIIQSVYRVFPFSRGIFEDKVA-NFWCVTNVIIK 326
              + Q + R+FPFSRG+     A NFW + + + K
Sbjct: 331 --QMPQVLSRLFPFSRGLTHAYWAPNFWAIYSFLDK 364

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 133/270 (49%), Gaps = 18/270 (6%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LP+ +WYF +   W LDYPP  AY  + L +L   +      L+  
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 137 R-GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
           + G   +    F R+TV+ SE++ ++   +Y    I +         +V  ++I+  P  
Sbjct: 104 KVGQFGMPTIVFQRLTVIASEILLFVVLQVY----INKSHISERSANFVVASSIVLSPGF 159

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
           ++IDH HFQYN  +  +++ +I    ++ Y    + F +++ FK + LY +P  F +L  
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLLR 219

Query: 256 RSAY-YPRFNFPRFAG-IAIA---TLLTFGALYAPLCLFGD-FRNII----QSVYRVFPF 305
                +  F+F  +   I+I     L   G++   LC+FG  F   I    Q + R+FPF
Sbjct: 220 VYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVV--LCVFGVCFAPFISQWPQLLSRLFPF 277

Query: 306 SRGIFEDKVA-NFWCVTNVIIKYRELYTQK 334
           SRG+     A NFW + +++ K   L   K
Sbjct: 278 SRGLTHAYWAPNFWAMYSLLDKVLTLIILK 307

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 123/262 (46%), Gaps = 18/262 (6%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  AY  + L +    V      L+  
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 137 R-GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
             G   +    F R+TV+ S+++ ++   +Y        R+QS    +V  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPGF 181

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
            +IDH HFQYN  +  +++ +I     + Y   AI +  ++ FK + LY +P  F +L  
Sbjct: 182 FMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLL- 240

Query: 256 RSAYYPRFNFPRFAG-------IAIATLLTFGALYA---PLCLFGDFRNIIQSVYRVFPF 305
             AY    N  +F         I  A L   G++      +C       + Q + R+FPF
Sbjct: 241 -RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFLPFAHQMPQVLSRLFPF 299

Query: 306 SRGIFEDKVA-NFWCVTNVIIK 326
           SRG+     A NFW + + + K
Sbjct: 300 SRGLTHAYWAPNFWALYSFMDK 321

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 122/262 (46%), Gaps = 18/262 (6%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LPIS WY+     W LDYPP  AY  + L +    V      L+  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 137 R-GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
             G   +    F R+TV+ SE++ Y    +Y        R+QS    +V  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
           ++IDH HFQYN  +  +++ +I    ++ Y   A  +  ++ FK + LY +P  F +L  
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLL- 240

Query: 256 RSAYYPRFNFPRFAG-------IAIATLLTFGALYA---PLCLFGDFRNIIQSVYRVFPF 305
             AY    N  +F         I  A L   G++      +C       + Q + R+FPF
Sbjct: 241 -RAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPFAHQMPQVLSRLFPF 299

Query: 306 SRGIFEDKVA-NFWCVTNVIIK 326
           SRG+     A NFW + + + K
Sbjct: 300 SRGLTHAYWAPNFWALYSFMDK 321

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 121/265 (45%), Gaps = 36/265 (13%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LPIS WY+     W LDYPP  AY  + L +         F   + 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQ---------FVPKSV 116

Query: 137 RGFESIDLKS----------FMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVAC 186
           R    +D+            F R+TV+ SE++ ++   +Y        R+QS    +V  
Sbjct: 117 RDDGCLDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVA 172

Query: 187 AAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYS 246
           ++I+  P  ++IDH HFQYN  +  +++ +I    ++ Y   A+ +  ++ FK + LY +
Sbjct: 173 SSIVLSPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLA 232

Query: 247 PVIFAYLFSRSAYYPRFNFPRFAG-------IAIATLLTFGALYA---PLCLFGDFRNII 296
           P  F +L    AY    N  +F         I  A LL    +      +C       + 
Sbjct: 233 PCYFVFLL--RAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPFAHQMP 290

Query: 297 QSVYRVFPFSRGIFEDKVA-NFWCV 320
           Q + R+FPFSRG+     A NFW +
Sbjct: 291 QVLSRLFPFSRGLTHAYWAPNFWAL 315

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  102 bits (253), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 123/262 (46%), Gaps = 18/262 (6%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LP+S WY+     W LDYPP  AY  + L +    V      L+  
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 137 R-GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
             G   +    F R+TV+ SE++ +    +Y        R+QS    +V  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
           ++IDH HFQYN  +  +++ +I    ++ Y + A+ +  S+ FK + LY +P  F +L  
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLL- 240

Query: 256 RSAYYPRFNFPRFAG-------IAIATLLTFGALYA---PLCLFGDFRNIIQSVYRVFPF 305
             AY    N  +F         I    L   G++      +C       + Q + R+FPF
Sbjct: 241 -RAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPFAHQMPQVLSRLFPF 299

Query: 306 SRGIFEDKVA-NFWCVTNVIIK 326
           SRG+     A NFW + + + K
Sbjct: 300 SRGLTHAYWAPNFWALYSFMDK 321

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  100 bits (250), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 122/265 (46%), Gaps = 24/265 (9%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGR-LGSFVNATWFKLNT 135
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  + L + + S+V +       
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIV 95

Query: 136 SRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
             G   +    F R+TV+ SE++ ++   +Y        R QS    +V  ++I   P  
Sbjct: 96  EVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPGF 151

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
           ++IDH HFQYN  +  +++ +I    ++ Y +    + ++L FK + LY +P  F +L  
Sbjct: 152 LIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLLR 211

Query: 256 RSAYYPR-FNFPRF------------AGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRV 302
                 + F F  +              +    + TF   + P        ++ Q + R+
Sbjct: 212 AYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGPFIF-----DLPQLLTRL 266

Query: 303 FPFSRGIFEDKVA-NFWCVTNVIIK 326
           FPFSRG+     A NFW + + I K
Sbjct: 267 FPFSRGLTHAYWAPNFWAIYSTIDK 291

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/254 (29%), Positives = 119/254 (46%), Gaps = 14/254 (5%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LP+++WY      W LDYPP  AY  + L +      A    L+  
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDGCLDIV 111

Query: 137 R-GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
           + G   +    F RITV+LSELV Y    ++    I           +V  ++I+  P L
Sbjct: 112 KVGSFGLPTIIFQRITVILSELVLYAALQVF----INTSDISEKSANFVVASSIVLSPGL 167

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIF----- 250
           +++DH HFQYN  + G+++ +I    ++ Y   A  F ++L FK + LY +P  F     
Sbjct: 168 LIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVFLLR 227

Query: 251 AYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYA---PLCLFGDFRNIIQSVYRVFPFSR 307
           AY+   S++  R      + +  + LL   ++      L          Q + R+FPFSR
Sbjct: 228 AYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPFITTWQQLLARLFPFSR 287

Query: 308 GIFEDKVA-NFWCV 320
           G+     A N W V
Sbjct: 288 GLTHAYWAPNVWAV 301

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 129/267 (48%), Gaps = 28/267 (10%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  + L +   FV  T   +   
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQ---FVPGT---VKQD 98

Query: 137 RGFESIDLKS-------FMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAI 189
              E +D          F R TV+LSE++ ++   ++        R QS    +V  ++I
Sbjct: 99  GCLEIVDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSI 154

Query: 190 LFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVI 249
           +  P+ +++DH HFQYN  +  +++ +I       Y + A  + ++L FK + LY +P  
Sbjct: 155 VLSPAFLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCY 214

Query: 250 FAYLF-SRSAYYPRFNFPRFAGIAIAT----LLTFGALYA---PLCLFGDF-RNIIQSVY 300
           F +L  +    +  F F  +  +        L   G++      LC FG F +++ Q + 
Sbjct: 215 FVFLLRAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALC-FGPFVKDLPQVLT 273

Query: 301 RVFPFSRGIFEDKVA-NFWCVTNVIIK 326
           R+FPFSRG+     A NFW + + + K
Sbjct: 274 RLFPFSRGLTHAYWAPNFWALYSFLDK 300

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 123/273 (45%), Gaps = 24/273 (8%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGR-LGSFVNATWFKLNT 135
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  ++L + +   V         
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCLDIV 103

Query: 136 SRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
           + G   +    F R+TV++SE++ ++   +Y    I +         +V  ++I+  P  
Sbjct: 104 AVGQFGLPTIVFQRVTVIVSEILLFVVLQVY----INKSHISDRSANFVVASSIVLSPGF 159

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYL-- 253
           ++IDH HFQYN  +  +++ +I     + Y      F  +L FK + LY +P  FA+L  
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFAFLLR 219

Query: 254 --------FSRSAYYPRFNFPRFAG---IAIATLLTFGALYAPLCLFGDFRNIIQSVYRV 302
                   F    Y    +  R+     +    L  F   +AP         + Q + R+
Sbjct: 220 VYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPFI-----YQLPQLMSRL 274

Query: 303 FPFSRGIFEDKVA-NFWCVTNVIIKYRELYTQK 334
           FPFSRG+     A NFW + + + K   L+  K
Sbjct: 275 FPFSRGLTHAYWAPNFWALYSALDKVLTLFFLK 307

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score = 98.2 bits (243), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 121/266 (45%), Gaps = 26/266 (9%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRL--GSFVNATWFKLN 134
           DFE  R+W+ +T  LP+ +WY      W +DYPPL A+  + L ++  G+       KL 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKL- 117

Query: 135 TSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPS 194
            + G        F R+TV+ SE++ Y+   +Y +    + R  +    +V   ++   P+
Sbjct: 118 VAEGRYGWPTVVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALSPA 173

Query: 195 LILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLF 254
            +L+DH HFQYN  +  ++V +I    +  Y      F ++L  K + LY +P  F +L 
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 255 SRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGD------------FRNII-QSVYR 301
              AY       RF        L F   +  LC  G             F  ++ Q + R
Sbjct: 234 --RAYVLDLGEFRFRSYRD---LVFAVRWGNLCRLGGVVLAIMAVTFAPFAGVMPQLMAR 288

Query: 302 VFPFSRGIFEDKVA-NFWCVTNVIIK 326
           +FPFSRG+     A NFW + + + K
Sbjct: 289 LFPFSRGLTHAYWAPNFWAIYSFVDK 314

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 124/262 (47%), Gaps = 18/262 (6%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGR-LGSFVNATWFKLNT 135
           DF+  R+W+ IT  LP+  WY+     W LDYPP  AY  ++L + + + V A       
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 136 SRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
            +G        F R TV+ SE++ ++   +Y        + QS    +V  ++I+  P L
Sbjct: 113 PQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVLSPML 168

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
           +++DH HFQYN  +  +++ +I       +   A  +  +L FK + LY +P  F +L  
Sbjct: 169 LIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFLL- 227

Query: 256 RSAYYPRFNFPRFAGIA-IATLLTFGALYA---------PLCLFGDFRNIIQSVYRVFPF 305
              Y  +F   RF     +  ++ +G L+           +C     R++ Q + R+FPF
Sbjct: 228 -RTYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPFARDMPQLLSRLFPF 286

Query: 306 SRGIFEDKVA-NFWCVTNVIIK 326
           SRG+     A NFW + ++  K
Sbjct: 287 SRGLTHAYWAPNFWALYSLCDK 308

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 121/271 (44%), Gaps = 48/271 (17%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ +T  LP+ +WY+     W LDYPP  AY  +I+ +         F     
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQ---------FVPQVV 106

Query: 137 RGFESIDLKS----------FMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVAC 186
           R    +D+            F R++V+ SE++ ++    +      + R QS    ++  
Sbjct: 107 RDDGCLDIVEIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVA 162

Query: 187 AAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYS 246
            +I+  P  +++DH HFQYN  +  +++ +I     + Y   A+ +  +L FK + LY +
Sbjct: 163 TSIILSPGFLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLA 222

Query: 247 PVIFAYL----------FSRSAYYPRF------NFPRFAGIAIATLLTFGALYAPLCLFG 290
           P  F +L          F   +Y          N  R AG+ ++ +   G  + P     
Sbjct: 223 PCYFVFLLRAYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIV---GVCFGPFIF-- 277

Query: 291 DFRNIIQSVYRVFPFSRGIFEDKVA-NFWCV 320
              ++ Q + R+FPFSRG+     A NFW +
Sbjct: 278 ---DMPQLLTRLFPFSRGLTHAYWAPNFWAI 305

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score = 95.5 bits (236), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 123/263 (46%), Gaps = 20/263 (7%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LP+  WY+     W LDYPP  AY  ++L +    +      L+  
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 137 R----GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQ 192
                G+ ++    F R+TV+ SE++ ++   ++        + +S    +V  ++I+  
Sbjct: 115 EIGQFGWPTV---VFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLS 167

Query: 193 PSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAY 252
           P  ++IDH HFQYN  +   ++ +I     + Y + A  + ++L FK + LY +P  F +
Sbjct: 168 PGFLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVF 227

Query: 253 LFSRSAY-YPRFNFPRFAGIAIATLLTFGALYAPLCL------FGDFR-NIIQSVYRVFP 304
           L       +  F F  +  +            A + L      FG F  ++ Q + R+FP
Sbjct: 228 LLRAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLYDLPQVMTRLFP 287

Query: 305 FSRGIFEDKVA-NFWCVTNVIIK 326
           FSRG+     A NFW + + + K
Sbjct: 288 FSRGLTHAYWAPNFWAIYSFLDK 310

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score = 94.7 bits (234), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 122/263 (46%), Gaps = 20/263 (7%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRL-GSFVNATWFKLNT 135
           DF+  R+W+ IT  + +  WY+     W LDYPP  AY  + +  L  SFV         
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 136 SRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
             G        F R+TV+ SE + ++   +Y        R QS    ++  ++I+  P  
Sbjct: 124 EVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPGF 179

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYL-- 253
           +++DH HFQYN  +  ++V +I    ++ Y   A+ + ++L FK + LY +P  F +L  
Sbjct: 180 LIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLLR 239

Query: 254 --------FSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFR-NIIQSVYRVFP 304
                   F   +Y       R+  +    ++  G     LC FG F  ++ Q + R+FP
Sbjct: 240 VYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVF--SLC-FGPFIFDMPQLLSRLFP 296

Query: 305 FSRGIFEDKVA-NFWCVTNVIIK 326
           FSRG+     A NFW + + + K
Sbjct: 297 FSRGLTHAYWAPNFWALYSFLDK 319

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 114/263 (43%), Gaps = 32/263 (12%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LP+  WY+     W LDYPP  AY  + + +         F     
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQ---------FVPKVV 104

Query: 137 RGFESIDLKS----------FMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVAC 186
           R    +D+            F R +V++SE++ ++    +  +     R QS    ++  
Sbjct: 105 RDDGCLDIVPVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVA 160

Query: 187 AAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYS 246
            +I+  P  ++IDH HFQYN  +  +++ +I     E Y    + + ++L FK + LY +
Sbjct: 161 TSIILSPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLA 220

Query: 247 PVIFAYLFSRSAYYPR-FNFPRFAGIAI----ATLLTFGALYAP---LCLFGDFRNIIQS 298
           P  F +L        + F F  +  + +      L   G +      +C      ++ Q 
Sbjct: 221 PCYFVFLLRAYVLNVKNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPFIYHLPQV 280

Query: 299 VYRVFPFSRGIFEDKVA-NFWCV 320
             R+FPF RG+     A NFW +
Sbjct: 281 FTRLFPFGRGLTHAYWAPNFWAI 303

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 117/267 (43%), Gaps = 28/267 (10%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           DF+  R+W+ IT  LP+  WY      W LDYPP  AY  + L +    +      L+  
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 137 R-GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSL 195
             G   +    F RITV++SE++ ++   ++    I +         ++  ++I+  P  
Sbjct: 108 EVGNFGMPTIIFQRITVIVSEVLLFVVLQIF----INKSATNEKSANFIVASSIVLSPGF 163

Query: 196 ILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFS 255
           +++DH HFQYN  +  +++  I       Y      F  +L FK + LY +P  F +L  
Sbjct: 164 LIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLL- 222

Query: 256 RSAY---YPRFNFP------------RFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVY 300
             AY   +  F F             R   + +  L  F   +AP         + Q + 
Sbjct: 223 -RAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPFI-----SEMPQLLE 276

Query: 301 RVFPFSRGIFEDKVA-NFWCVTNVIIK 326
           R+FPFSRG+     A NFW + +++ K
Sbjct: 277 RLFPFSRGLTHAYWAPNFWALYSLLDK 303

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 116/259 (44%), Gaps = 24/259 (9%)

Query: 77  DFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTS 136
           D E  R+W+ +T  LP+  WY      W LDYPP  AY  ++L +    V      L+  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 137 R----GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQ 192
           +    G+ ++    F+R+TV+ +E++ ++   ++    I           ++  ++I   
Sbjct: 153 KEGKFGWPTV---VFLRLTVIGTEILLFVVLQVF----INTSDESERTVNFIIASSIALS 205

Query: 193 PSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAY 252
           P  +++DH HFQYN  +  +++ +I     E Y      F   L FK + LY +P  F +
Sbjct: 206 PGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTF 265

Query: 253 LFSRSAY---YPRFNFPRFAGIAIA----TLLTFGALYAPL---CLFGDFRNIIQSVYRV 302
           L    AY   +  F+F  +  +        LL  G +   +   C       + Q + R+
Sbjct: 266 LL--RAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPVLPQLISRL 323

Query: 303 FPFSRGIFEDKVA-NFWCV 320
           FPFSRG+     A NFW V
Sbjct: 324 FPFSRGLTHAYWAPNFWAV 342

>KNAG0A07190 Chr1 complement(1129595..1131064) [1470 bp, 489 aa]
           {ON} Anc_2.571 YKL047W
          Length = 489

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 35/84 (41%), Gaps = 13/84 (15%)

Query: 100 DLEY---WGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFESIDLKSF-------MR 149
           D+EY    G    P T Y  Y + +L S +NA WF  N  +  +S   K F         
Sbjct: 103 DVEYDSERGTKQGPFTEYGHYYINKLESLLNA-WFTANDVKNTDS--FKDFYESHARDKD 159

Query: 150 ITVLLSELVCYIPAVMYFTRWIGR 173
           IT L   +   IP + Y   WI R
Sbjct: 160 ITTLELGVESQIPMIHYLYHWIKR 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.143    0.473 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,943,060
Number of extensions: 2031836
Number of successful extensions: 4816
Number of sequences better than 10.0: 50
Number of HSP's gapped: 4774
Number of HSP's successfully gapped: 50
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 68 (30.8 bits)