Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30256.21ON31831816080.0
SAKL0E01210g6.21ON32332310271e-140
Kwal_56.224336.21ON3223199211e-124
ACR005W6.21ON3273338921e-119
KLTH0C11220g6.21ON3273208921e-119
TPHA0J003406.21ON3383348711e-116
YOR007C (SGT2)6.21ON3463308591e-114
KAFR0L004106.21ON3313288571e-114
TDEL0G044806.21ON3433288551e-113
Smik_15.1766.21ON3453308471e-112
ZYRO0C07788g6.21ON3343228331e-110
Kpol_1037.266.21ON3423328321e-110
KLLA0D01155g6.21ON3353378271e-109
Skud_15.1686.21ON3483328271e-109
CAGL0E02739g6.21ON3433238131e-107
Suva_15.1826.21ON3463308071e-106
TBLA0G010506.21ON3503257731e-101
NCAS0H008306.21ON3383347641e-100
NDAI0D008106.21ON3493397631e-99
KNAG0M011706.21ON3393257534e-98
Kpol_1032.86.21ON3433274961e-59
NCAS0D026706.21ON3513653733e-41
TPHA0M002706.21ON3773623605e-39
NDAI0I022406.21ON3503623585e-39
TBLA0A072706.21ON3733373062e-31
NCAS0G008105.617ON5842232762e-26
AEL224W5.617ON5802232701e-25
Kwal_55.199355.617ON5932252664e-25
CAGL0H08195g5.617ON5831042664e-25
KAFR0C058905.617ON5752352664e-25
TPHA0D028805.617ON5852222639e-25
NDAI0F009105.617ON5831032603e-24
SAKL0G07084g5.617ON5852242568e-24
ZYRO0A05676g5.617ON5722142542e-23
KLTH0E02178g5.617ON5931042542e-23
Kpol_1018.695.617ON5902252532e-23
YOR027W (STI1)5.617ON5891042515e-23
Smik_15.2055.617ON5891042471e-22
KNAG0B032005.617ON5792252452e-22
Skud_15.1925.617ON5891042453e-22
KLLA0A07062g5.617ON5811942453e-22
TBLA0E033005.617ON5822272401e-21
Suva_8.805.617ON5861042392e-21
Ecym_55825.617ON5841032392e-21
TDEL0A048405.617ON5761042321e-20
KLLA0F24046g2.152ON6041131861e-14
NCAS0A00490singletonON6201081816e-14
NDAI0B057903.481ON5231251611e-11
Suva_15.3142.152ON6441841612e-11
TBLA0C039503.481ON5121371602e-11
Skud_8.1782.152ON6381271593e-11
YHR117W (TOM71)2.152ON6391291575e-11
Kwal_33.147672.152ON5941171566e-11
KAFR0B066103.481ON5111231567e-11
KNAG0A079003.481ON5121231541e-10
Ecym_82042.152ON5971131532e-10
NCAS0F034903.481ON5121221513e-10
TDEL0D055003.481ON5121401513e-10
KAFR0E029808.506ON3801171494e-10
TBLA0C055302.152ON6101251496e-10
SAKL0E10956g2.152ON6001181487e-10
YGR123C (PPT1)3.481ON513911487e-10
NDAI0C052908.506ON3791181432e-09
CAGL0D05060g3.481ON5101341433e-09
Ecym_44133.481ON5101081433e-09
AGL268C8.506ON3792021423e-09
NDAI0F028102.152ON6091101433e-09
Kpol_505.413.481ON5131151424e-09
Smik_8.1952.152ON6351011434e-09
NCAS0B024008.506ON3801041414e-09
SAKL0H10934g8.506ON3801161405e-09
Suva_7.4083.481ON513901406e-09
KLTH0B05170g2.152ON5931171407e-09
KNAG0A039508.506ON3861161398e-09
TPHA0I015102.152ON6031251408e-09
ABR131W2.152ON594861408e-09
CAGL0H07425g8.506ON3802021389e-09
Skud_7.4323.481ON5131171391e-08
Smik_6.2153.481ON513911372e-08
KNAG0H035302.152ON614981362e-08
ZYRO0F08624g8.506ON3791171352e-08
CAGL0L04048g2.152ON587981353e-08
NCAS0G024802.152ON596911353e-08
Kwal_27.118908.506ON3341161334e-08
Smik_2.2958.506ON3851041334e-08
TPHA0D032203.481ON5131561335e-08
TDEL0B013108.506ON3802001325e-08
NCAS0B070102.152ON625981336e-08
AAR083C3.481ON5381581318e-08
SAKL0F03102g3.481ON5131011301e-07
YNL121C (TOM70)2.152ON6171251301e-07
Ecym_25598.506ON3702001282e-07
YBR155W (CNS1)8.506ON3851041282e-07
NDAI0B043402.152ON6641231292e-07
Suva_4.4058.506ON3851041272e-07
Smik_14.2072.152ON6171251255e-07
TDEL0B051402.152ON5991251255e-07
CAGL0L12936g2.152ON6001401256e-07
TPHA0L014208.506ON3742021246e-07
Suva_14.2192.152ON6171251212e-06
ZYRO0B04224g3.481ON5131151212e-06
KLLA0B09966g8.506ON3702011202e-06
Skud_14.2112.152ON6171251212e-06
KLTH0F14542g3.481ON5131041202e-06
Kpol_513.28.506ON3741171183e-06
ZYRO0G06512g2.152ON6041251193e-06
KLTH0E11748g8.506ON3782001183e-06
KAFR0F007202.152ON608861193e-06
TBLA0F032203.395ON536631184e-06
TBLA0H033808.506ON3751171165e-06
KLLA0B10912g3.481ON512841158e-06
Kpol_1048.212.152ON597981159e-06
Kwal_55.211753.481ON5111371132e-05
NCAS0B025608.470ON5781351113e-05
KNAG0I025206.328ON117901024e-05
KAFR0J025706.328ON121621025e-05
Skud_2.2828.506ON3851041077e-05
Ecym_20906.328ON172571021e-04
KNAG0A041208.470ON6021191042e-04
NDAI0C051308.470ON590881015e-04
NCAS0I008703.395ON585631015e-04
KLLA0C15455g8.470ON5661231006e-04
SAKL0E14542g5.689ON690115998e-04
TBLA0I023106.328ON11663910.001
TDEL0A074306.328ON12461920.001
Kpol_1018.1067.412ON75396980.001
CAGL0K11209g8.470ON590109960.002
SAKL0A01672g6.328ON12866900.002
Kpol_1006.43.367ON73289950.003
TPHA0E007407.412ON746129950.003
ADR230W5.689ON685115940.004
TBLA0H015203.367ON68996920.006
Ecym_13968.470ON573121920.006
Skud_4.5068.470ON61188920.007
Suva_2.4108.470ON61188910.008
Suva_2.347.412ON763105910.009
Smik_2.367.412ON751105910.010
Smik_4.4918.470ON61288900.010
YBL084C (CDC27)7.412ON758105900.011
TPHA0M016303.367ON1043129900.012
AGL294W7.412ON65696900.012
Skud_2.2403.367ON984118900.013
Smik_2.2543.367ON1020118900.013
NCAS0A112003.367ON907112900.013
YDR244W (PEX5)8.470ON61288890.014
YBR112C (CYC8)3.367ON966110890.016
TDEL0B016608.470ON549137880.017
AFR453W8.470ON569121880.017
NCAS0D045006.328ON12158830.018
KLTH0C06204g7.412ON627102880.018
SAKL0H11946g8.470ON573120880.019
Kpol_1028.516.328ON11786820.020
CAGL0K09240g6.328ON14263830.022
NDAI0A051003.367ON100796880.023
Suva_4.3613.367ON963113870.025
Ecym_71427.412ON67596870.026
Kwal_27.117378.470ON575118870.027
TBLA0A016908.470ON66288870.028
KAFR0H008703.367ON88788870.028
YCR060W (TAH1)6.328ON11188810.029
YCR014C (POL4)1.429ON582100860.030
KNAG0H006103.367ON97396870.031
Kpol_1043.605.689ON70663860.033
ZYRO0C16522g3.367ON97488860.033
Kwal_27.107407.412ON62891860.034
CAGL0D01364g3.367ON114888860.038
TDEL0C050903.367ON75988860.041
KLTH0F18150g5.689ON689142850.042
Kpol_1031.648.470ON60777850.044
ADL344W3.367ON91088850.049
TBLA0F012303.367ON118988850.049
TPHA0D038606.328ON12082800.050
NCAS0E024907.412ON809108850.054
KLLA0C08910g6.328ON11553790.062
KLLA0B09262g3.367ON94189840.063
SAKL0B07986g3.367ON88096840.066
KLLA0E20857g7.412ON71087830.079
KLTH0E10934g8.470ON568118830.081
Kwal_23.36703.367ON80296830.084
Smik_3.991.429ON581110830.089
ZYRO0F16544g1.88ON1028138830.093
Ecym_34593.367ON111596830.099
KLTH0F10428g3.367ON79596820.11
Kpol_172.23.367ON41880800.14
NDAI0F004005.689ON76469810.16
Skud_2.247.412ON769105810.16
AAR054C6.328ON13367760.17
KNAG0B012903.395ON53763800.19
TPHA0L012108.470ON58879800.19
ZYRO0B03828g7.412ON72796800.22
Smik_3.1596.328ON11570740.22
ZYRO0A02926g8.470ON577120790.24
SAKL0F12936g7.412ON63296790.26
KLTH0F02508g1.88ON1055108790.29
TBLA0B086803.32ON91487790.30
NDAI0I004406.328ON12840740.35
CAGL0K07986g3.395ON53293770.42
Kpol_2000.601.88ON1033115770.43
Ecym_40315.689ON68889760.52
NDAI0A081703.395ON53963760.57
Kwal_33.134281.88ON1052102760.62
Kpol_520.67.458ON292150740.80
TDEL0C027207.412ON70096740.88
KLLA0E22705g1.456ON389117731.2
NDAI0J001307.546ON140344741.2
SAKL0D11110g1.456ON432115712.1
NCAS0G003505.689ON698128712.2
SAKL0B08646g3.395ON52275712.5
KAFR0L018707.412ON71296693.6
Ecym_20333.32ON90999703.6
NDAI0D021905.152ON583143694.1
KAFR0D004701.88ON1051115694.3
TDEL0E027505.352ON56463694.4
Suva_16.5217.546ON1424178694.4
Kwal_55.209437.154ON1230191694.8
Kwal_34.160921.456ON395128685.2
ZYRO0E03300g1.456ON397131675.7
TDEL0B021705.703ON56791676.4
TDEL0C061301.88ON1025115676.5
Skud_3.1356.328ON11859636.9
TBLA0C015901.456ON408135667.6
NCAS0A147707.458ON30085667.9
AEL281C7.546ON1390131669.1
NDAI0E040407.412ON78389669.2
TBLA0H019705.352ON84076669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3025
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   624   0.0  
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   400   e-140
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   359   e-124
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   348   e-119
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   348   e-119
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   340   e-116
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   335   e-114
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   334   e-114
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   333   e-113
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   330   e-112
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   325   e-110
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   325   e-110
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   323   e-109
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   323   e-109
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   317   e-107
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   315   e-106
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   302   e-101
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   298   e-100
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   298   1e-99
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   294   4e-98
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   195   1e-59
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   148   3e-41
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   143   5e-39
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   142   5e-39
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   122   2e-31
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...   110   2e-26
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...   108   1e-25
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...   107   4e-25
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...   107   4e-25
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...   107   4e-25
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...   105   9e-25
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}    104   3e-24
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...   103   8e-24
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...   102   2e-23
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...   102   2e-23
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...   102   2e-23
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...   101   5e-23
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...   100   1e-22
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    99   2e-22
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    99   3e-22
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    99   3e-22
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    97   1e-21
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    97   2e-21
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    97   2e-21
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    94   1e-20
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    76   1e-14
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       74   6e-14
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    67   1e-11
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    67   2e-11
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    66   2e-11
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    66   3e-11
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    65   5e-11
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    65   6e-11
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    65   7e-11
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    64   1e-10
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    64   2e-10
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    63   3e-10
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    63   3e-10
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    62   4e-10
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    62   6e-10
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    62   7e-10
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    62   7e-10
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    60   2e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    60   3e-09
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    60   3e-09
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    59   3e-09
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    60   3e-09
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    59   4e-09
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    60   4e-09
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    59   4e-09
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    59   5e-09
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    59   6e-09
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    59   7e-09
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    58   8e-09
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    59   8e-09
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    59   8e-09
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    58   9e-09
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    58   1e-08
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    57   2e-08
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    57   2e-08
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    57   2e-08
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    57   3e-08
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    57   3e-08
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    56   4e-08
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    56   4e-08
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    56   5e-08
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    55   5e-08
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    56   6e-08
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    55   8e-08
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    55   1e-07
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    55   1e-07
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    54   2e-07
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    54   2e-07
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    54   2e-07
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    54   2e-07
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    53   5e-07
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    53   5e-07
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    53   6e-07
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    52   6e-07
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    51   2e-06
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    51   2e-06
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    51   2e-06
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    51   2e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    51   2e-06
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    50   3e-06
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    50   3e-06
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    50   3e-06
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    50   3e-06
TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {O...    50   4e-06
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    49   5e-06
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    49   8e-06
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    49   9e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    48   2e-05
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    47   3e-05
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    44   4e-05
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    44   5e-05
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    46   7e-05
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    44   1e-04
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    45   2e-04
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    44   5e-04
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    44   5e-04
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    43   6e-04
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    43   8e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    40   0.001
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    40   0.001
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    42   0.001
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    42   0.002
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    39   0.002
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    41   0.003
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    41   0.003
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    41   0.004
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    40   0.006
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    40   0.006
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    40   0.007
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    40   0.008
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    40   0.009
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    40   0.010
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    39   0.010
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    39   0.011
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    39   0.012
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    39   0.012
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    39   0.013
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    39   0.013
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    39   0.013
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    39   0.014
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    39   0.016
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    39   0.017
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    39   0.017
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    37   0.018
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    39   0.018
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    39   0.019
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    36   0.020
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    37   0.022
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    39   0.023
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    38   0.025
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    38   0.026
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    38   0.027
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    38   0.028
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    38   0.028
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.029
YCR014C Chr3 complement(139185..140933) [1749 bp, 582 aa] {ON}  ...    38   0.030
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    38   0.031
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    38   0.033
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    38   0.033
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    38   0.034
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    38   0.038
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    38   0.041
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    37   0.042
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    37   0.044
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    37   0.049
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    37   0.049
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    35   0.050
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    37   0.054
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    35   0.062
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    37   0.063
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    37   0.066
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    37   0.079
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    37   0.081
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    37   0.084
Smik_3.99 Chr3 complement(139083..140828) [1746 bp, 581 aa] {ON}...    37   0.089
ZYRO0F16544g Chr6 (1360946..1364032) [3087 bp, 1028 aa] {ON} sim...    37   0.093
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    37   0.099
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    36   0.11 
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    35   0.14 
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    36   0.16 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    36   0.16 
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    34   0.17 
KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.3...    35   0.19 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    35   0.19 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    35   0.22 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.22 
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    35   0.24 
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    35   0.26 
KLTH0F02508g Chr6 complement(214785..217952) [3168 bp, 1055 aa] ...    35   0.29 
TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3...    35   0.30 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.35 
CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa] ...    34   0.42 
Kpol_2000.60 s2000 (119866..122967) [3102 bp, 1033 aa] {ON} (119...    34   0.43 
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    34   0.52 
NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa] ...    34   0.57 
Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa] ...    34   0.62 
Kpol_520.6 s520 (15903..16781) [879 bp, 292 aa] {ON} (15903..167...    33   0.80 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    33   0.88 
KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]...    33   1.2  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    33   1.2  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    32   2.1  
NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}...    32   2.2  
SAKL0B08646g Chr2 complement(734944..736512) [1569 bp, 522 aa] {...    32   2.5  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    31   3.6  
Ecym_2033 Chr2 complement(51082..53811) [2730 bp, 909 aa] {ON} s...    32   3.6  
NDAI0D02190 Chr4 complement(510934..512685) [1752 bp, 583 aa] {O...    31   4.1  
KAFR0D00470 Chr4 (70746..73901) [3156 bp, 1051 aa] {ON} Anc_1.88...    31   4.3  
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    31   4.4  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    31   4.4  
Kwal_55.20943 s55 complement(620378..624070) [3693 bp, 1230 aa] ...    31   4.8  
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    31   5.2  
ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {...    30   5.7  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...    30   6.4  
TDEL0C06130 Chr3 (1108534..1111611) [3078 bp, 1025 aa] {ON} Anc_...    30   6.5  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    29   6.9  
TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {O...    30   7.6  
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    30   7.9  
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    30   9.1  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    30   9.2  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    30   9.9  

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/318 (97%), Positives = 309/318 (97%)

Query: 1   MPGSNKEIAALIVQFLSTSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGR 60
           MPGSNKEIAALIVQFLSTSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGR
Sbjct: 1   MPGSNKEIAALIVQFLSTSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGR 60

Query: 61  GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYT 120
           GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYT
Sbjct: 61  GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYT 120

Query: 121 EAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKP 180
           EAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKP
Sbjct: 121 EAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKP 180

Query: 181 EEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFP 240
           EEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFP
Sbjct: 181 EEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFP 240

Query: 241 DLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPNLGD 300
           DLSSM         NNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPNLGD
Sbjct: 241 DLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPNLGD 300

Query: 301 MMKDPNIKDMAGKFFGQK 318
           MMKDPNIKDMAGKFFGQK
Sbjct: 301 MMKDPNIKDMAGKFFGQK 318

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 202/323 (62%), Positives = 251/323 (77%), Gaps = 9/323 (2%)

Query: 1   MPGSNKEIAALIVQFLSTSTKD--VQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNKEIAALIV FLS++ +   V E+Y DSLNVAIDCI+EAFE ER+  +EIV  +++
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 59  GRGLVDLVKSGASE-PTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVK 117
            R L +L+KS A+  PT   SEP   N  A       +AE+LKL+GNKA A+KDFE A+K
Sbjct: 61  NRKLDELLKSAATALPT--QSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIK 118

Query: 118 KYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYAL 177
           KYTEAIE++P+NAV+Y NRAAAYSS KK+EE+V+DAESA+++NPSYS+GYSRLG AKYAL
Sbjct: 119 KYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYAL 178

Query: 178 GKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQ---TSEG 233
           GKPEEA+EAYK VLDIEGD AT+ MKRDYE+AK+KVE+SLNLE ++P   ++Q   T  G
Sbjct: 179 GKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAG 238

Query: 234 SSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGG 293
           + A GFPD++S+         NNPQVM AAQK+MQNP AM EMM NPA++QMA+NF+SGG
Sbjct: 239 AGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFSSGG 298

Query: 294 GTPNLGDMMKDPNIKDMAGKFFG 316
           GTPNLGD+M +P IKDMA   FG
Sbjct: 299 GTPNLGDLMSNPAIKDMAKNLFG 321

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 235/319 (73%), Gaps = 4/319 (1%)

Query: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNK++A LIV FLS +   K+V E+YVDSLNVAIDCI EAFE +RE     + K + 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118
           GR L  +V++ AS  + S  E    N      E   +AE+LKLEGNKA AAKDFE AV K
Sbjct: 61  GRSLKQVVEA-ASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLK 119

Query: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178
           Y+EAI+++P NAV+Y NRAAA+SS KK+EEAV+DAE A+++NPSYS+GYSRLG A+YALG
Sbjct: 120 YSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALG 179

Query: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQTSEGSSAG 237
           KPEEA++AYKKVLDIEG+ AT+AMKRDY++A KKV +SLN+E + P          + +G
Sbjct: 180 KPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSG 239

Query: 238 GFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPN 297
           G PD+SSM         NNPQ+MQAAQ+MMQNP+AMQE+MNNPA+KQMA+ F SGGGTP+
Sbjct: 240 GLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPAVKQMAEKFQSGGGTPS 299

Query: 298 LGDMMKDPNIKDMAGKFFG 316
           + D+M +P + DMA   FG
Sbjct: 300 MADLMNNPALMDMAKNMFG 318

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 185/333 (55%), Positives = 238/333 (71%), Gaps = 21/333 (6%)

Query: 1   MPGSNKEIAALIVQFLSTSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGR 60
           M  SNK+IAALIV FL+TS K V E+Y DSL VAIDCI EAFE+   +++ +VS+   GR
Sbjct: 1   MSPSNKDIAALIVDFLTTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGR 60

Query: 61  GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYT 120
            L  L+ +G +  T  + EP        A E+ + AE LKLEGN+A AAKD+E A++KYT
Sbjct: 61  SLSQLLTTGMAH-TSDAGEPK-----VAAEELKKEAEALKLEGNRAMAAKDYETAIQKYT 114

Query: 121 EAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKP 180
            AIE++P +AV+Y NRAAAYSS +++E+AV DAE A +++ SYS+G+SRLG AKYALG+ 
Sbjct: 115 AAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRH 174

Query: 181 EEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEE--QQTSEGSSAGG 238
           EEA+EAYK+VLDIEGDNATEAM+RDYESAK+KVEES+N++   +  E     +  +   G
Sbjct: 175 EEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAAGSAGGSG 234

Query: 239 FPDLSSM-------------XXXXXXXXXNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQM 285
            PDL+SM                      NNPQVMQAAQKMMQNPSA+QEMM+NPAIK+M
Sbjct: 235 LPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPAIKKM 294

Query: 286 AQNFASGGGTPNLGDMMKDPNIKDMAGKFFGQK 318
           A+NFASG G+  LGD+M DP +++MA KFFG K
Sbjct: 295 AENFASGNGSSGLGDLMADPAVRNMASKFFGPK 327

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 236/320 (73%), Gaps = 7/320 (2%)

Query: 4   SNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGRG 61
           + KE+A+LI+ +L  +   K++ E+Y+DSLNVAIDC+ EAFE+E+E ++ ++ K++ G+ 
Sbjct: 4   TKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQS 63

Query: 62  LVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTE 121
           L  +V + +  PT +  EP   N      E+  +AE LKLEGNKA A KDFE A+ KY+E
Sbjct: 64  LEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISKYSE 123

Query: 122 AIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPE 181
           AI  +P+NAV++ NRAAAYSS KK+ EAV DAE+A+++NPSYS+GYSRLG A+YALG+PE
Sbjct: 124 AIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPE 183

Query: 182 EAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQTSEGSSAGGFP 240
           EA++AYKKVLDIEG NAT+AMKRDY++A KKVE+SLN+E + P     ++ + +   GFP
Sbjct: 184 EALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGSGFP 243

Query: 241 DLSSM----XXXXXXXXXNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGGGTP 296
           D++SM              NPQVMQAAQ+MMQNP+AMQEMM+NPAIKQMA  F SGGGTP
Sbjct: 244 DIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQEMMSNPAIKQMADKFQSGGGTP 303

Query: 297 NLGDMMKDPNIKDMAGKFFG 316
           ++ D+M +P + DMA   FG
Sbjct: 304 SMADLMNNPALMDMAKNMFG 323

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 232/334 (69%), Gaps = 23/334 (6%)

Query: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNKEIAALIV +L+     K+V  +  DSLNVA+DCIAEAFE ER+   + V  A+N
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118
           G GL   +   A+     +        DA   E    AE LKLEGNKA A KD+E A+KK
Sbjct: 61  GNGLTSFLSGSATNDIQVNIA-----DDAADEEQKATAEGLKLEGNKAMATKDYESAIKK 115

Query: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178
           Y+EAIE++P NAV+Y NRAAAYSS KK+++AV DAESA+++NP+YS+GYSRLG AK+A G
Sbjct: 116 YSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQG 175

Query: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEAL-PKGEEQQTS------ 231
           K E+A++AYKKVLDIEGD AT+ MKRDYE+AKKKVE+SLNLE + PK  E +++      
Sbjct: 176 KVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADAGTG 235

Query: 232 --EGSSAGGFPDLSSM----XXXXXXXXXNNPQVMQAAQKMMQNPSAMQE---MMNNPAI 282
                  GGFPDLSSM              NPQ+MQAAQ+MMQNP+AMQ+   MM NPA+
Sbjct: 236 AAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNPAV 295

Query: 283 KQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           +QMA+NFASG GTP+L  MM +P++KDMA   FG
Sbjct: 296 RQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  335 bits (859), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/330 (56%), Positives = 243/330 (73%), Gaps = 15/330 (4%)

Query: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKA-Y 57
           M  S +EIAALIV + S+    K++ E+  DSLNVA+DCI+EAF  ERE  + I+ K+ +
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 58  NGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPE----VAERAENLKLEGNKAFAAKDFE 113
            G+ L D++ S +  P  S+ +    N + + PE       +AE+LK++GNKA A KD+E
Sbjct: 61  KGQHLADILNSASRVPE-SNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYE 119

Query: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173
            A+ KYTEAI+++P NA++Y NRAAA+SS K++++AV+DAESA+ I+PSY RGYSRLG A
Sbjct: 120 LAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFA 179

Query: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALP---KGEEQQ 229
           KYA GKPEEA+EAYKKVLDIEGDNATEAMKRDYESAKKKVE+SLNLE  +P   +  +  
Sbjct: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVD 239

Query: 230 TSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMA 286
            S+G+SAGG PDL S+         NNPQ+MQAAQKMM NP AM   Q+MM +P+I+QMA
Sbjct: 240 ASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMA 299

Query: 287 QNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           + FASGGGTPNL D+M +P +++MAG  FG
Sbjct: 300 EGFASGGGTPNLSDLMNNPALRNMAGNLFG 329

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  334 bits (857), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/328 (54%), Positives = 236/328 (71%), Gaps = 15/328 (4%)

Query: 1   MPGSNKEIAALIVQFLSTSTK--DVQEEYVDSLNVAIDCIAEAFEIEREDSNEIV-SKAY 57
           MP SNKEI+ LIV +L   T+  DV E+  DSLNVAIDCI ++FE ER+ ++ ++ SK Y
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 58  NGR--GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGA 115
           N     L+++    +++  ++ + P     +    +V  +AE LKLEGNKA A KDF+ A
Sbjct: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKV--KAEKLKLEGNKAMAMKDFDLA 118

Query: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175
           + KY+EAI + PNNA++Y NRAAAYSS K FE+A  DAESA+R++P+YS+GYSRLG AKY
Sbjct: 119 IAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178

Query: 176 ALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNL---EALPKGEE-QQTS 231
           AL KPEEA+EAYKKVLD+EGD ATE MKRDYE+AKK+VE+SLNL   E+ PK E   +++
Sbjct: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238

Query: 232 EGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMAQN 288
             ++AGGFPD+SSM         NNPQ+MQAAQ+MM +P+AM   Q MM NP+I+QMA+N
Sbjct: 239 ANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAEN 298

Query: 289 FASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           F   G TP+   +M DPNIKDMA  FFG
Sbjct: 299 F-QNGNTPDFSQLMNDPNIKDMAKNFFG 325

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  333 bits (855), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 177/328 (53%), Positives = 237/328 (72%), Gaps = 16/328 (4%)

Query: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNKE+A+LIV +LS     K V EE +DSLNVAIDCI E+FE+++ DS  +    + 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56

Query: 59  GRGLVDLVK--SGASEPTLSS-SEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGA 115
           G+GLV+L++  SG+S  T ++ +E    N  A   E   +AE LKLEGNKA A KDF+ A
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLA 116

Query: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175
           +KKY++AIE++P NAV+Y NRAAA+SS K +EEA++DAESA++ +P+YS+GYSRLG AK+
Sbjct: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176

Query: 176 ALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQ----QTS 231
           ALG+ E+A+EAYKKVLDIEGD A++ MKRDYE+AKKKVE+SL+LE  P+ + +       
Sbjct: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAG 236

Query: 232 EGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAMQE---MMNNPAIKQMAQN 288
               +GGF D +SM         NNPQ+MQAAQ+MMQNP AM +   MM NP ++QMA+N
Sbjct: 237 GAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAEN 296

Query: 289 FASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           FA G G PN+GD+M +P ++DMAG  FG
Sbjct: 297 FAQGNGMPNMGDLMNNPALRDMAGSLFG 324

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  330 bits (847), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/330 (54%), Positives = 243/330 (73%), Gaps = 15/330 (4%)

Query: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKA-Y 57
           M  S +EIAALIV + S+    K++ E+  DSLNVA+DCI+EAF  ER+ ++ I+ K+ +
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 58  NGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPE----VAERAENLKLEGNKAFAAKDFE 113
            G+ L D++ S AS+ + S+ +    N + + PE       +AE+LK++GNKA A KD+E
Sbjct: 61  KGKSLADVLNS-ASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYE 119

Query: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173
            A+ KYTEAI+++P NA++Y NRAAA+SS ++++EAV+DAES++ I+PSY RGYSRLG A
Sbjct: 120 LAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFA 179

Query: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALP---KGEEQQ 229
           KYA GKPEEA+EAYKKVLDIEGDNATEAMKRDYESAKKKVE+SLNLE A+P   +  +  
Sbjct: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADAN 239

Query: 230 TSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMA 286
            S+G+ + G PDL S+         NNPQ+MQAAQKMM NP AM   Q+MM +P+I+QMA
Sbjct: 240 ASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMA 299

Query: 287 QNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           + F SGGG PNL D+M +P +++MAG  FG
Sbjct: 300 EGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  325 bits (833), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 230/322 (71%), Gaps = 20/322 (6%)

Query: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNK+I++LIV +L+     K V E+ +DSLNVAI+CI EAF IE+  S    S A+ 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSS----SAAFG 56

Query: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118
           G+ L +L+ +GA  P+ S  E    N  A   E+  +AE+LKLEGNKA A KD+E A+KK
Sbjct: 57  GKNLAELLSAGAGAPS-SQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKK 115

Query: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178
           Y+EAI ++P NAV+Y NRAAA+SS K ++EA++DAESAV+++ SYS+GYSRLG AK+A G
Sbjct: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175

Query: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSE------ 232
           K EEA+EAYKKVLDIEGD+AT+ MKRDYE+AK+KVE++L L    K +E +TS+      
Sbjct: 176 KSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELN---KTDETETSDRGTGEP 232

Query: 233 -GSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAMQE---MMNNPAIKQMAQN 288
            G++ GG  DLSSM         NNPQVMQAAQ+MMQNP AM +   MM NP ++QMA+ 
Sbjct: 233 AGANPGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAEK 292

Query: 289 FASGGGTPNLGDMMKDPNIKDM 310
           FA G GTPNL D+M +P ++DM
Sbjct: 293 FAGGNGTPNLNDIMNNPALRDM 314

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  325 bits (832), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 228/332 (68%), Gaps = 16/332 (4%)

Query: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNK+IAALI+ FLST     +V E+  DSLNVA+DCIAEAFE ER+    +V  ++ 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 59  GRGLVDLV--KSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAV 116
           G  L   +   + AS  T ++ E    N      E +E AE LKLEGNKA A KD+E A+
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 117 KKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYA 176
           KKYTEAI  +P NAV++ NRAAAYSS KK++EAV DA SA++INP+YS+GYSRLG AK+A
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 177 LGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQTSEGSS 235
            GK E+A+EAYKKVLDIEGD ATE MKRDYE+AKKKVE+SLNLE +   G     S+ +S
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 236 A-------GGFPDLSSM-XXXXXXXXXNNPQVMQAAQKMMQNPSAMQE---MMNNPAIKQ 284
           A       GG PD SSM          NNPQ+MQAAQ+MMQ+P AM++   MM NP++KQ
Sbjct: 241 AADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVKQ 300

Query: 285 MAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           MA  F+SG GTP+   +M DP+I+DMA   FG
Sbjct: 301 MADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 178/337 (52%), Positives = 231/337 (68%), Gaps = 30/337 (8%)

Query: 1   MPGSNKEIAALIVQFLSTSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGR 60
           M  SNKEIAALIV FLS+S+  V E+YVDSLNVAIDCI EAF+ ER++++ ++S  +NG+
Sbjct: 1   MSLSNKEIAALIVDFLSSSSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK 60

Query: 61  GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYT 120
            L +L+ S  S   +S  EP   +          +AE LKL+GNKA AAK F+ A++KYT
Sbjct: 61  KLPELLASAPSSGGVSG-EPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKYT 119

Query: 121 EAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKP 180
            AIE+ P+NAV+Y NRAAAYSS K++E+AV+DAE A+ ++P+YS+G+SRLG AKYAL KP
Sbjct: 120 AAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKP 179

Query: 181 EEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFP 240
           EEA++AYKKVLDIEG+ AT+ MKRDYE+AKKKVE S+NLE        ++S  +S+    
Sbjct: 180 EEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLE--------KSSTSASSEDVS 231

Query: 241 DLSSM---------------------XXXXXXXXXNNPQVMQAAQKMMQNPSAMQEMMNN 279
           D S+                               NNPQVMQAA+KMMQNP  MQ+MM+N
Sbjct: 232 DKSATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMSN 291

Query: 280 PAIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           PA+KQMA  F+SGGG P+L  MM DP+I+DMA   FG
Sbjct: 292 PAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFG 328

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 180/332 (54%), Positives = 231/332 (69%), Gaps = 17/332 (5%)

Query: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKA-Y 57
           M  S  EIA+LIV + S+    K++ E+  DSLNVA+DCI+EAF  ERE    I+  + +
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 58  NGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPE----VAERAENLKLEGNKAFAAKDFE 113
            G+ L DL+ S  S  + S+ +    N + + PE    +  +AE+LK++GNKA A KD+E
Sbjct: 61  KGQNLTDLLNS-TSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYE 119

Query: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173
            A+ KYTEAI+++P NA++Y NRAAA+SS K ++EAV DAESA+ I+P+Y RGYSRLG A
Sbjct: 120 LAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFA 179

Query: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQ---- 228
           KYA GKPEEA+EAYKKVLDIEGDNATEAMKRDYESAKKKVE+SLNLE  +P+        
Sbjct: 180 KYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADAN 239

Query: 229 -QTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQ 284
              S+G+   G PDL S+         NNPQ+MQAAQKMM NP AM   Q+MM +P IKQ
Sbjct: 240 ADASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQ 299

Query: 285 MAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           MA+ F SGGG PNL D+M +P ++ MAG  FG
Sbjct: 300 MAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  317 bits (813), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 226/323 (69%), Gaps = 17/323 (5%)

Query: 5   NKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGRGL 62
           +KE+AA+I+++L    + K V E+Y+DS+NVAIDCIAE+FE+ER D + ++ ++   +GL
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 63  ---VDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKY 119
              ++ +K GA +     SE    N  A   E   +AE LKLEGNKA A KDFE A+ KY
Sbjct: 62  EECLECMKGGAVK-----SEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKY 116

Query: 120 TEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGK 179
           +EAIE++P NA++Y NRAAA+SS K+++EAV DAE A+ I+P+YS+GYSRLG AKYA  K
Sbjct: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176

Query: 180 PEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGF 239
           PEEA+EAYKKV+D+EGD AT+ MKRDYE+AKKKVE+SLNLE  P      +  G+ AG  
Sbjct: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAG 236

Query: 240 P----DLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSA---MQEMMNNPAIKQMAQNFASG 292
                D SSM         NNPQ+MQAAQ+MM NP A   MQ MM +P+I+QMA+ F SG
Sbjct: 237 GAGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296

Query: 293 GGTPNLGDMMKDPNIKDMAGKFF 315
            GTPN+ D+M +P +++MA   F
Sbjct: 297 NGTPNMDDLMSNPALRNMASSMF 319

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  315 bits (807), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 237/330 (71%), Gaps = 15/330 (4%)

Query: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKA-Y 57
           M  S +EIA+LIV + S+    K+V E+  DSLNVA+DCI+EAF  ER+  + I+ K+ +
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 58  NGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPE----VAERAENLKLEGNKAFAAKDFE 113
            G+ L +L+ S +  P  S  +    N + + PE       +AE LK++GNKA A K++E
Sbjct: 61  KGQSLNNLLSSSSKLPE-SGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYE 119

Query: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173
            A+KKYTEAI+++P NA++Y NRAAA+SS K+++EA++DAESA+ ++PSY RGYSRLG A
Sbjct: 120 LAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFA 179

Query: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEAL----PKGEEQQ 229
           KYA GKPEEA+EAYKKVLDIEGDNAT+AMKRDYESAKK+VE+SLNLE      P+     
Sbjct: 180 KYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGAN 239

Query: 230 TSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMA 286
             +G+ AGG PDL S+         NNPQ+MQAAQKMM NP AM   Q MM +P+I+QMA
Sbjct: 240 AGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQMA 299

Query: 287 QNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           + F SGGGTPNL D+MK+P +++MAG  FG
Sbjct: 300 EGFTSGGGTPNLSDLMKNPALRNMAGSLFG 329

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  302 bits (773), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 223/325 (68%), Gaps = 12/325 (3%)

Query: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNK+IA L+V FLST+   K V  +  DSLNVAIDCI EAFE E++D    ++  + 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 59  GRGLVDLVKSGASEPTLSSSE-----PTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFE 113
           G+ L +L+ +  +    SSS         +  +    E+A +AE LKLEGNKA AAKD+ 
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173
            AV+KY  AI+L+P  AV+Y NRAAAYSS +K++EA++DAESA+++ P++S+GYSRLG A
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEG 233
           K+A GK +EA+EAYKK L+++GD AT+ MKRDYE+AKKKVE+SLN+E          S  
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK-SATPSASASAS 239

Query: 234 SSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAMQE---MMNNPAIKQMAQNFA 290
           +SAGG PD++SM         NNPQ+MQAAQ+MM NP AM++   MM NP+I+QMA+N +
Sbjct: 240 ASAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENLS 299

Query: 291 SGGGTPNLGDMMKDPNIKDMAGKFF 315
           S G +  +GD M +P I++MA   F
Sbjct: 300 S-GSSEGMGDFMNNPAIREMASNLF 323

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  298 bits (764), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 222/334 (66%), Gaps = 20/334 (5%)

Query: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNKE+ +LIV FLST    K++ E+  DSLNVAIDCI E+FE ER+   + +   ++
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 59  GRGLVDLVKSGASEPTLSSSEPTGN-NTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVK 117
           G+ L +++ S ++  T S  E +   N      E+   AE+ KLEGNKA AAKD+  A++
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120

Query: 118 KYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYAL 177
           KY+EAI+ +P N ++Y NRAAAYSS K+++ A++DAE A+ I+P+YS+GYSRL  AKYAL
Sbjct: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180

Query: 178 GKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE----ALP---KGEEQQT 230
            KPEEA+E YKKVLD+EGD AT AMKRD+E AK +VE S+NLE      P   +   QQ 
Sbjct: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240

Query: 231 SEGSSAGGFPDLSSM-----XXXXXXXXXNNPQVMQAAQKMMQNPSA---MQEMMNNPAI 282
           +   +  G PD+SS+              NNPQVMQAAQ+MM +P++   MQEMM NP +
Sbjct: 241 ANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300

Query: 283 KQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           ++MAQN ASG    NL D+M +P++KDMA   FG
Sbjct: 301 REMAQNLASGDA--NLDDLMNNPSVKDMANNLFG 332

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  298 bits (763), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 164/339 (48%), Positives = 224/339 (66%), Gaps = 26/339 (7%)

Query: 1   MPGSNKEIAALIVQFLSTSTK--DVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  +NK+I ALIV FLST  +  +V E+  DSLNVA+DCI+EA E +RE   E +   +N
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 59  GRGLVDLVKSGASEPT---LSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGA 115
           G+ LVD++ + ++      +   E    N      E+   AE  KLEGNKA A KDF  A
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175
           V+KYTEAI+++P NA++Y NRAAA+SS K+FEEA++DAESA++I+PSYS+GYSRL  AKY
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 176 ALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGE----EQQTS 231
            LGK EEA+E+YKKVLDIEGDNAT  MKRDYE+AKK+VEES+N+E     E    +QQT+
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 232 EGSS-------AGGFPDLSS-----MXXXXXXXXXNNPQVMQAAQKMMQNPSAMQE---M 276
           E +        AGG PD+SS               +NP  M  AQK+M +P+AMQ+   M
Sbjct: 241 ESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQSM 300

Query: 277 MNNPAIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFF 315
           M++P+++ +A NF +G    ++ D+M +P I++MA   F
Sbjct: 301 MSDPSMRDLANNFKNGN--TDMNDIMNNPAIRNMASNLF 337

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  294 bits (753), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 222/325 (68%), Gaps = 12/325 (3%)

Query: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNKE+++LI+ +L+   S  +V  + +DSLNVAIDC+ E F +E++  +  +   +N
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAP----EVAERAENLKLEGNKAFAAKDFEG 114
           G+ L +L+ + AS+   ++ E        + P    E   +AE LKLEGNKA A+KD++ 
Sbjct: 61  GKSLTELLDA-ASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDL 119

Query: 115 AVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAK 174
           AV+KYTEAI+++P NAV++ NRAAAY++ + ++EAV+DAE A++++P+YS+GYSRL  AK
Sbjct: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179

Query: 175 YALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQTSEG 233
           Y     EE++EAYKKVL+IEGD+ATE  KR YE+AKK+VEESLNLE ++P       +  
Sbjct: 180 YVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNP 239

Query: 234 SSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMAQNFA 290
           ++ GGFPD SS+         NNPQ+MQAAQ MM NP AM   Q MM NPAI+QMA+ F 
Sbjct: 240 AAGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQF- 298

Query: 291 SGGGTPNLGDMMKDPNIKDMAGKFF 315
            GG TP+  +MM +P +++MA   F
Sbjct: 299 KGGNTPDFSEMMNNPAVRNMASSLF 323

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  195 bits (496), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 183/327 (55%), Gaps = 26/327 (7%)

Query: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  +NK+  ALIV +L      K+V E+  +SLNVAIDCI++ FE++     +I++  +N
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118
              L  +   G     +S         +  + +  + AE LKLEGNK  + K+++ A+ K
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDK 120

Query: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178
           Y++AIE+ P+N  +Y NRAAAY   + F  AV DA +A++++P+YS+ YSRLG AK A G
Sbjct: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180

Query: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEAL---PKG---------- 225
             E+A+ A+KKVL++EGD +TE MK DYE+AKK V+  + L      P G          
Sbjct: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVL 240

Query: 226 EEQQTSEGSSAGGF-PDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQ 284
            +  T  GSS G    +   M          NP++MQ  + +MQ          NP ++Q
Sbjct: 241 TDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQ----------NPVVRQ 290

Query: 285 MAQNFASGGGTPNLGDMMKDPNIKDMA 311
            A+N A+G G   L D++ +P++K++A
Sbjct: 291 FAENVANGNGPGGLSDVLNNPSVKEVA 317

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  148 bits (373), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 119/365 (32%), Positives = 177/365 (48%), Gaps = 68/365 (18%)

Query: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  SNKEIA+ IV +LS+   T  V E+Y +S++VAI+CI ++F+++ E S      A +
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVS------ADS 54

Query: 59  GRGLVDLVKSGAS-EPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVK 117
               V L       EP LS  E            V E+A  LKLEGNKA   ++++ A+ 
Sbjct: 55  DLATVLLANLNLEPEPKLSEKE---------RELVNEQAIKLKLEGNKAVERENYKDAID 105

Query: 118 KYTEAIELMPNNAV-----FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGL 172
           KYT AI+L+  N +     +  N++ A +   ++EEA  DA + ++I+P++S+GYSRL  
Sbjct: 106 KYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAE 165

Query: 173 AKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEAL---------- 222
           AK    K E+AM AYK+VLD+EG+ AT+ MKRD+E  K+K  E+LN              
Sbjct: 166 AKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKF-ETLNFSTHIDSGSATPIS 224

Query: 223 -------PKGEEQQTSEGSSAGGFP--------------------DLSSMXXXXXXXXXN 255
                  PK EE +T         P                    +++ +         N
Sbjct: 225 EAANKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILN 284

Query: 256 NPQVMQAAQKMMQ-NPSA---MQEMMNNPAIKQ-MAQNFASGGGTPNLGDMMKDPNIKDM 310
           NPQV  A     Q NP A   +QE+ NNP  K  ++Q   +   +P   +  K    K++
Sbjct: 285 NPQVQLALSHFAQRNPDAARKVQEISNNPMFKMALSQLMDAANQSPE--EFFKSEKFKNL 342

Query: 311 AGKFF 315
              F 
Sbjct: 343 VNSFI 347

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  143 bits (360), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 109/362 (30%), Positives = 183/362 (50%), Gaps = 62/362 (17%)

Query: 1   MPGSNKEIAALIVQFLS---TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAY 57
           M  +++EIA++IV + +   TS K + ++ VDSLNVAIDCIA+ F+++++  + I+  AY
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGK-LNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAY 59

Query: 58  NGRGLVDLVKSGA--------SEPTLSSSEPTG-----------NNTDAHAP-EVAE--- 94
               L+  + +G            T++ S  T            N  D + P +V E   
Sbjct: 60  RSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119

Query: 95  -------------RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYS 141
                        +AE LK +GN+   AK +  A+  Y++AI+L P N  +Y NRA AY 
Sbjct: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179

Query: 142 SFKKFEEAVRDAESAV----RINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDI---- 193
               F+ A+ DA  ++    +I+P+  + Y RLGLAKY +G  E ++ A+K++++I    
Sbjct: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239

Query: 194 -EGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGG------FPDLSSMX 246
            +GD  T+ M  DYE AK+KV+E   ++ + K   ++ S  S   G        D+ +M 
Sbjct: 240 NKGDEITKQMDADYEKAKEKVQELFFMQ-ITKSTGKEGSGNSVNDGPKRKVTLNDILNMA 298

Query: 247 XXXXXXXXNNPQVMQAAQKMM-QNPSAMQE---MMNNPAIKQMAQNFASG--GGTPNLGD 300
                   +NP   +  ++++  NP A Q+   +MN+P ++QM +N  S      P L D
Sbjct: 299 GNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDSMSNIPILKD 358

Query: 301 MM 302
           + 
Sbjct: 359 LF 360

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  142 bits (358), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 107/362 (29%), Positives = 174/362 (48%), Gaps = 65/362 (17%)

Query: 1   MPGSNKEIAALIVQFLSTSTKD--VQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58
           M  + ++ A+LI+ +LS  T +  + E+  +SL VAI CI E+F ++     +I+  +  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLD----GDILPTSLK 56

Query: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118
            R L  +++   +  TL +++   N          E AE LK EGN+A     +E A+KK
Sbjct: 57  ERTLKTILQENLN--TLEATQKIHN----------EEAEALKKEGNEAMIEGQYEEAIKK 104

Query: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178
           YTEAI+    N  +Y NR+ AYS   ++E+AV DA  A+ I+PS+S+ YSRLG AK    
Sbjct: 105 YTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQD 163

Query: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEE--------------SLNLEALPK 224
           K E+ M AYK+ +D+EG NA++ +  DYE A+ K E+               +  E  P+
Sbjct: 164 KLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPE 223

Query: 225 -----------------------GEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQ 261
                                   EE +    S A    +++ +         NNPQ+ Q
Sbjct: 224 KNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQ 283

Query: 262 AA-QKMMQNPSA---MQEMMNNPAIKQMAQ---NFASGGGTPNLGDMMKDPNIKDMAGKF 314
              Q +  NP A   +++++NNP ++       N   GG TP   +M++   + ++   F
Sbjct: 284 MVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTPQ--EMLQSGTVNNLIQSF 341

Query: 315 FG 316
             
Sbjct: 342 LA 343

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  122 bits (306), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 162/337 (48%), Gaps = 47/337 (13%)

Query: 4   SNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEI-EREDSNEIVSKAYNGR 60
           ++K++A LIV FL    S K++ ++ +DSLNVAIDCI + + + E   S+ ++ K ++  
Sbjct: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILK-FSKS 65

Query: 61  GLVDLVKSGA----------SEPTLSSSEPTG----------------------NNTDAH 88
            L  ++ + A           E T  + EP+                       N  D  
Sbjct: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125

Query: 89  APEVAER----AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFK 144
               +++    A+  K EGN+   ++D++ A++ YT AI   P + ++Y NR+ AY    
Sbjct: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185

Query: 145 KFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKR 204
            +E A+ DA   + I+ ++S+ Y RL   K    +  +A++ YKK +++  D+  E + R
Sbjct: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245

Query: 205 DYESAKKKVEESLNLEALPKGE---EQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQ 261
           ++E  K KV+  ++L  +           +  +S    PD+ S+         +NP + Q
Sbjct: 246 EFEDLKLKVQTDISLREISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQQ 305

Query: 262 AAQKMMQ-NPSAMQEM---MNNPAIKQMAQNFASGGG 294
              K++Q NP A + +   + NPA+K + QNF +G  
Sbjct: 306 MIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score =  110 bits (276), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 116/223 (52%), Gaps = 36/223 (16%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAI--ELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+ LK +GN AFA+KDF GA++ +TEAI     PN+ V Y NR+A Y+S K+F+EA+ DA
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNH-VLYSNRSACYTSLKQFQEALNDA 62

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           +  V+INP +S+GY+R+G A   LG  ++A   YKK L+++ +N                
Sbjct: 63  QQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN---------------- 106

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
                 +A  +G EQ      S    PD             ++P ++   +K+ QNP   
Sbjct: 107 ------KAASEGLEQVHRVQESRKSRPDFG------MTEMFSDPNLI---EKLRQNPKT- 150

Query: 274 QEMMNNPAIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           ++MMN+P++    Q++ S     +  D+M DP +  +     G
Sbjct: 151 KDMMNDPSLVAKLQSYKSNPQGLS-SDLMGDPRLMTIMATLLG 192

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 102/206 (49%), Gaps = 22/206 (10%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG + F   D+  AVK YTE I+  P +A  Y NRAAA +    F EA++D 
Sbjct: 388 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDC 447

Query: 154 ESAVRINPSYSRGYSRLGLAKYALG---KPEEAMEAYKKVLD--IEGDNATEAMKRDYES 208
           E A+  +P++ R Y R   A+ A+    K  E +E  KK  D    G ++ E MK   ++
Sbjct: 448 EKAIEKDPNFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMKLQMKA 507

Query: 209 AKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQ 268
            +++ +        P G E        A   P+++++          +P VMQ+  +  Q
Sbjct: 508 TQERFQ-------APTGNETPEETYKRAMQDPEVAAI--------MQDP-VMQSILQQAQ 551

Query: 269 N-PSAMQEMMNNPAIKQMAQNFASGG 293
           N P+A+QE M NP I +  Q   S G
Sbjct: 552 NDPAALQEHMKNPEISKKIQVLVSAG 577

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score =  108 bits (270), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 114/223 (51%), Gaps = 36/223 (16%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           AE  K EGN AFAAKDFE A++ + +AIE+   PN+ V Y NR+A Y+S +KF EA+ DA
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNH-VLYSNRSACYASMRKFREALADA 62

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           +  VRI P +S+G++RLG A Y LG  +EA E+YKK L+++  N             K  
Sbjct: 63  QECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSN-------------KAA 109

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
           ++ L   A  +  +QQ  E       PDL             +P ++   QK+  NP   
Sbjct: 110 QDGL---AQVQATQQQRMEQ------PDLG------FGQMFQDPNLI---QKLKNNPKTA 151

Query: 274 QEMMNNPAIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
            EMM +P +      F S     +  ++M+DP +  +     G
Sbjct: 152 -EMMKDPQLVAKVLQFQSNPQAIS-TELMRDPRLMTVMAAILG 192

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 106/223 (47%), Gaps = 18/223 (8%)

Query: 75  LSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYG 134
           L S E      +A A    E+AE  +L+G + F   D+  AVK YTE I+  P +A  Y 
Sbjct: 367 LRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYS 426

Query: 135 NRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAME----AYKKV 190
           NRAAA +    F +A++D + A++ +P++ R Y R   A+ A+ +   A+E    A +K 
Sbjct: 427 NRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTAREKD 486

Query: 191 LDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXX 250
            ++   + T  + + Y  A ++  +  N    P+         + A   P+++++     
Sbjct: 487 AEVNNGSNTREIDQLYIKATQQRFQPANANESPE------ETYARAVKDPEVAAI----- 535

Query: 251 XXXXNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGG 293
                +P +     +  QNP+A+QE M NP + +  Q   + G
Sbjct: 536 ---LQDPVMQSILSQAQQNPAALQEHMKNPQVFKKIQTLIAAG 575

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 55/104 (52%), Gaps = 8/104 (7%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           +AE  K +GN+ +  + F+ A+  Y +A +L   +  +  NRAAA      +E A++  E
Sbjct: 253 KAEEAKAKGNELYKKRQFDEAIANYEKAWDLH-KDITYLNNRAAAEYEKGDYESAIKTLE 311

Query: 155 SAVR----INPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
            AV     +   Y   ++ ++RLG A Y L   ++A+E Y+K L
Sbjct: 312 KAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score =  107 bits (266), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 115/225 (51%), Gaps = 40/225 (17%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           AE  K +GN AF AKDFE A + +++AIE    PN+ V Y NR+A Y+S KKF+EA+ DA
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNH-VLYSNRSACYTSLKKFKEALEDA 61

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           E  V+INP++S+GY+R+G A+Y LG  ++A + YKK L+I+  N                
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSN---------------- 105

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
                 +A  +G EQ     ++    PDL            N+P ++   +K+  NP   
Sbjct: 106 ------KAAQEGLEQVQKTQNARQQQPDLG------FGQLFNDPNMI---EKLKSNPKTA 150

Query: 274 QEMMNNPAIKQMAQNFASGGGTPNL--GDMMKDPNIKDMAGKFFG 316
            E+M +P +      F S    P +   ++MKDP +  +     G
Sbjct: 151 -ELMKDPQLVSKVLQFQSN---PQMMGQEVMKDPRMMTIMAAILG 191

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 102/207 (49%), Gaps = 24/207 (11%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +L+G + F   D+  AV  YTE I+  P +A  Y NRAA  +    F +A++D 
Sbjct: 399 EKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDC 458

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAME----AYKKVLDI-EGDNATEAMKRDYES 208
           + A+  +P++ R Y R   A+ A+ +   AME    A  K L+I +G NA E  +   ++
Sbjct: 459 DVAISKDPNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIEQLYVKA 518

Query: 209 AKKKVEESLNLEALPKGEEQQTSEGSSAGGF--PDLSSMXXXXXXXXXNNPQVMQAAQKM 266
           ++++ +           +  +T E + A     P+++++          +P +     + 
Sbjct: 519 SQQRFKPE---------DPNETPEQAYARALKDPEVAAI--------MQDPVMQSILSQA 561

Query: 267 MQNPSAMQEMMNNPAIKQMAQNFASGG 293
            QNP+A+QE M NPA+    Q   + G
Sbjct: 562 QQNPAALQEHMKNPAVFSKIQTLIAAG 588

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           +A+  K EGNK + A+ F+ A++ Y +A +L   +  +  NR+AA      +E+A++   
Sbjct: 266 KADAEKAEGNKYYKARKFDEAIEHYNKAWDLH-RDVTYLNNRSAAEYEKGDYEQAIKTLT 324

Query: 155 SAV----RINPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
            AV     +   Y   S+ ++R+G A   +   ++A+E Y++ L
Sbjct: 325 EAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score =  107 bits (266), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 75/104 (72%), Gaps = 3/104 (2%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AKD+E A+  +++AIE+   PN+ VFY NR+A Y+S KKF EA+ DA
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNH-VFYSNRSACYASLKKFPEALNDA 62

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
           E  V+INP++S+GY+RLG A   LG  +EA  +YKK L+++G N
Sbjct: 63  EECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSN 106

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 94/205 (45%), Gaps = 20/205 (9%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG   F   D+  AVK YTE I+  P +A  Y NRAAA S    F EA+ D 
Sbjct: 388 EKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDC 447

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYK--KVLDIEGDNATEAMKRDYESAKK 211
             A+  +P++ R Y R   A+ A+ +   A+E     +  D E +N+    + D      
Sbjct: 448 NKAIEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAARTKDAEVNNSANVREID------ 501

Query: 212 KVEESLNLEALPKGEEQQTSEGSSAGGFPDL---SSMXXXXXXXXXNNPQVMQAAQKMMQ 268
                L ++A      QQ  + +S+   P+     +M          +P +    Q+  Q
Sbjct: 502 ----QLYVKA-----SQQRFQPASSNETPEQVYERAMKDPEVIAIMQDPVMQSILQQAQQ 552

Query: 269 NPSAMQEMMNNPAIKQMAQNFASGG 293
           NP+A+QE M NP + +  Q   + G
Sbjct: 553 NPAALQEHMKNPDVFKKIQTLIAAG 577

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAY-------SSFKKFEEAVRDAES 155
           GNKA+ A+ F+ A+  Y  A  L   +  +  NR+AA        ++ K  +EAV     
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLH-QDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 156 AVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
                   ++ ++R+G   +     ++A+E Y+K L
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL 357

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score =  107 bits (266), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 122/235 (51%), Gaps = 46/235 (19%)

Query: 92  VAERAENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEA 149
           +++ A+  K EGN AF AKD++ A+  +T+AIE+   PN+ V Y NR+AAY+S K++E+A
Sbjct: 1   MSKTADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNH-VLYSNRSAAYTSSKQYEQA 59

Query: 150 VRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESA 209
           + DA+  ++INPS+++GY+R G A   L K EEA + Y + L I+ +NA          A
Sbjct: 60  LSDADECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNAI---------A 110

Query: 210 KKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQN 269
           K  + + ++         QQ++     GGFP    +                   ++ ++
Sbjct: 111 KDSLAQIVSA--------QQSASRGFPGGFPGDMGLG------------------ELFKD 144

Query: 270 PSAMQEMMNNPAIKQMA--QNFA----SGGGTPN--LGDMMKDPNIKDMAGKFFG 316
           P+ M+++  +P + ++   Q+F     S G  P     DMM DP I  + G   G
Sbjct: 145 PNLMEKLRRDPKVAELMNDQDFVAKINSYGNNPQALTNDMMTDPRIMQLFGALLG 199

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 92/200 (46%), Gaps = 14/200 (7%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG + F   D+  AVK YTE I+  P++A  Y NRAAA +    F +A+ D 
Sbjct: 383 EKAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDC 442

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
             A+  +PS+ R Y R    + A+ +   A+E     LD+       A +RD     K  
Sbjct: 443 NKAIEKDPSFIRAYLRKATCQIAVKEFAGAIE----TLDL-------ARERD---DGKNG 488

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
            E   L A    +  Q +EG+         +M          +P ++   Q+   +P+A+
Sbjct: 489 NEINQLYAKASAQRFQPAEGNETPEETYARAMKDPEVAKIMQDPVMVSILQQAQNDPAAL 548

Query: 274 QEMMNNPAIKQMAQNFASGG 293
           QE M NP + +  Q   + G
Sbjct: 549 QEHMKNPEVFRKIQTLIAAG 568

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 15/129 (11%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAA-------YSSFKKFEE 148
           A+  K EGNKA+ A+ F+ A+  Y +A E    +  +  NR+AA        +  K   E
Sbjct: 251 ADKAKAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 149 AVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYES 208
           AV +A          ++ ++R+G A   L   ++A+E Y+K L       TE    D  S
Sbjct: 310 AVENARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL-------TEHRTPDILS 362

Query: 209 AKKKVEESL 217
             +K E+ L
Sbjct: 363 KLRKAEKDL 371

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score =  105 bits (263), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 115/222 (51%), Gaps = 34/222 (15%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN-NAVFYGNRAAAYSSFKKFEEAVRDAE 154
           A+  K +GN AF+AK++E AV  +++AIE+ P  N V Y NR+A Y+S KKF +A+ DA 
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 155 SAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVE 214
              +INP++S+GY+R+G A Y LG  +EA ++YKK L+++  N             K  +
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASN-------------KVAQ 111

Query: 215 ESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAMQ 274
           E L        + ++T E   A     L+SM         N+P ++   +K+  NP    
Sbjct: 112 EGLE-------QVKRTQEARKAQPDMGLTSM--------FNDPNLI---EKLKSNPKTA- 152

Query: 275 EMMNNPAIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
           EMMN+P +     ++ S     +  ++  DP +  +     G
Sbjct: 153 EMMNDPQLVAKLLSYRSNSQALS-TELFSDPRLMTIMATLLG 193

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 92/203 (45%), Gaps = 16/203 (7%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +++G   F    +  AVK YTE I   P++A  Y NRAAA S    F EA+ D 
Sbjct: 390 EKAEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDC 449

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           E A+  +P++ + Y R   A+ A+ +   A+E     LDI       A  +D E      
Sbjct: 450 EKALEKDPNFVKAYIRKATAQIAIKEYSSALE----TLDI-------ARSKDTELNNGSN 498

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLS---SMXXXXXXXXXNNPQVMQAAQKMMQNP 270
              +N   L     QQ  E +S+   P+ +   +M          +P +    Q+   NP
Sbjct: 499 IREIN--QLYAKATQQRFEPASSNETPEQTYQRAMKDPEVAAIMQDPVMQSILQQAQTNP 556

Query: 271 SAMQEMMNNPAIKQMAQNFASGG 293
           +A+QE M NP I +  Q   S G
Sbjct: 557 AALQEHMKNPEIFKKIQTLISAG 579

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 73/154 (47%), Gaps = 17/154 (11%)

Query: 100 KLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAY-------SSFKKFEEAV-- 150
           K EGNK + A  F+ A++ Y +A EL  N+  +  N+AAA        ++ K  E+A+  
Sbjct: 262 KDEGNKLYKAHKFDEAIEHYDKAWELH-NDITYLNNKAAAQYEKGDYETTIKTLEDAIEK 320

Query: 151 -RDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESA 209
            R+  +  +I    ++ ++R+G A   L   ++A E + K L      AT    R  E  
Sbjct: 321 GRELRADYKI---IAKAFTRMGNAYEKLNDLKKAAEFFNKSLTEFRTPATLTKLRSLEK- 376

Query: 210 KKKVEESLNLEALPKGEEQ--QTSEGSSAGGFPD 241
           K KV+E+       K EE   Q  +  + G +PD
Sbjct: 377 KIKVQEAEAYINPEKAEEARIQGKDFFNKGQWPD 410

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score =  104 bits (260), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN-NAVFYGNRAAAYSSFKKFEEAVRDAE 154
           A+  K +GN AF +KDF  A++ +T+AIE+ P  N V Y NR+AAY+S K+F+EA+ DA 
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 155 SAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
             V+INP++S+GY+RLG A++ LG  EEA + YK+ L ++ +N
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 101/205 (49%), Gaps = 20/205 (9%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG + F   D+  AVK Y+E I+  P +A  Y NRAAA S    F EA++D 
Sbjct: 387 EKAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDC 446

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIE-----GDNATEAMKRDYES 208
           ++A++ +P++ R Y R   A+ A+ +   A++  ++    +     G N+ E M+   ++
Sbjct: 447 DNAIKKDPNFVRAYIRKATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIMRLQMKA 506

Query: 209 AKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQ 268
            +++ +        P G E        A   P+++++          +P +    Q+   
Sbjct: 507 TQERFQ-------APTGNETPEETYKRAMQDPEVAAIMQ--------DPVMQSILQQAQT 551

Query: 269 NPSAMQEMMNNPAIKQMAQNFASGG 293
           NP+A+QE M NP I +  Q   + G
Sbjct: 552 NPAALQEHMKNPEISKKIQILIAAG 576

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 8/103 (7%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAES 155
           A+  K+EGNK + A  F+ A+++Y +A  L   +  +  NR+AA      FE A+     
Sbjct: 255 ADEAKVEGNKLYKAHKFDEAIEQYNKAWALN-KDITYLNNRSAAEFEKGDFETAIATLNE 313

Query: 156 AV----RINPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           AV     +   Y   ++ ++R+G A +  G  +++++ Y+K L
Sbjct: 314 AVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSL 356

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score =  103 bits (256), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 73/224 (32%), Positives = 114/224 (50%), Gaps = 39/224 (17%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AFAAKDFE A++ +T+AIE+   PN+ V Y NR+A Y+S K+F +A+ DA
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNH-VLYSNRSACYTSTKQFNKALEDA 61

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           +  V INP++S+GY+R+G A + LG  +EA + YKK L+++  N                
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSAN---------------- 105

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
                 +A   G EQ      S    PDL            N+P ++   +K+  NP   
Sbjct: 106 ------KAAQDGLEQVHKTQQSRQQQPDLG------LGQIFNDPNLI---EKLKNNPKTA 150

Query: 274 QEMMNNPAIKQMAQNFASGGGTPNLG-DMMKDPNIKDMAGKFFG 316
            E+M +P +      F S    P +G ++++DP +  +     G
Sbjct: 151 -ELMKDPQLVAKILQFKSN---PQMGMEVLQDPRLMTIMAALMG 190

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 98/202 (48%), Gaps = 14/202 (6%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +L+G + F   D+  AVK YTE I+  P +A  Y NRAAA S    F EA++D 
Sbjct: 391 EKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDC 450

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYK--KVLDIEGDNATEAMKRDYESAKK 211
             A+  +P++ R Y R   A+ A+ +    +E     +  D + +N   A + D +   K
Sbjct: 451 NVAISKDPNFIRAYIRKATAQIAVREFVSVIETLDEARTKDSQINNGANAREID-QLYIK 509

Query: 212 KVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPS 271
             ++    E + +  EQ  +    A   P+++++          +P +    Q+  QNP+
Sbjct: 510 ASQQRFQPEDVNESPEQAYAR---AMKDPEVANI--------MQDPVMQSILQQAQQNPA 558

Query: 272 AMQEMMNNPAIKQMAQNFASGG 293
           A+QE M NP + +  Q   + G
Sbjct: 559 ALQEHMKNPEVFKKIQTLIAAG 580

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 59/104 (56%), Gaps = 8/104 (7%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           +A+  K EGNK + A+ F+ A++ Y++A EL   +  +  NRAAA     ++E A++   
Sbjct: 258 KADAEKAEGNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKTLT 316

Query: 155 SAVR----INPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
            AV     +   Y   S+ ++R+G + + L + ++A+E Y+K L
Sbjct: 317 EAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 109/214 (50%), Gaps = 61/214 (28%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AKD+  A+  +T+AIE+   PN+ V Y NR+A Y+S KKFEEA++DA
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNH-VLYSNRSACYASNKKFEEALKDA 61

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           E  V+I+PS+S+GY+R+G A++ L + +EA ++YK+ L+++  N         ++AK  +
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN---------KAAKDGL 112

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
           E   + +A P+               PDL                      +M  +P+ +
Sbjct: 113 EHVQSAKAGPQ--------------MPDL-------------------GLSQMFNDPNLI 139

Query: 274 QEMMNNPAIKQMAQNFASGGGTPNLGDMMKDPNI 307
           Q + NN                P   DMMKDP +
Sbjct: 140 QNLKNN----------------PKTADMMKDPQL 157

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 97/219 (44%), Gaps = 10/219 (4%)

Query: 75  LSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYG 134
           L S+E      ++ A    E+AE  +L+G + F   D+  AVK YTE ++  P +A  + 
Sbjct: 359 LRSTEKELKKAESEAYVNPEKAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFS 418

Query: 135 NRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIE 194
           NRAAA +    F EA+ D   AV I+P++ R Y R   A+ A+ +   A+E      + +
Sbjct: 419 NRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRKATAQIAVKEFAAAIETLNIAREKD 478

Query: 195 GDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXX 254
                 A  R+ +    K        A      +QT E   A   P+++S+         
Sbjct: 479 AQVNKGANVREIDQLHAKASSQRFQPASDNETPEQTYE--RAMRDPEVASI--------M 528

Query: 255 NNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGG 293
            +P +     +  Q+P+A+QE + NP +    Q     G
Sbjct: 529 KDPVMQSILSQAQQDPAALQEHIKNPEVFNKIQVLIQAG 567

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 8/103 (7%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAES 155
           AE  K EGNK + A+ FE A++ Y +A EL   +  +  NR+AA      ++ A++    
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELH-KDITYLNNRSAAEFEKGDYDTAIKTLND 304

Query: 156 AV----RINPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           AV     +   Y   ++ ++R+G A Y L    +A+E Y + L
Sbjct: 305 AVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 73/104 (70%), Gaps = 3/104 (2%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           AE  K +GN AF AKD+E A + +T+AIE    PN+ V Y NR+A ++S KKF EA+ DA
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNH-VLYSNRSACFTSLKKFNEALNDA 61

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
              V+INP++S+GY+R+G A + LGK +EA + YKK L+I+  N
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN 105

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 94/204 (46%), Gaps = 18/204 (8%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +L+G + F   D+  AVK YTE  +  P +A  Y NRAAA +    F EA++D 
Sbjct: 399 EKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDC 458

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYK--KVLDIEGDNATEAMKRDYESAKK 211
           + A+  +P++ R Y R   A+ A+ +   A+E     +  D E +N     + D    K 
Sbjct: 459 DMAISKDPNFIRAYIRKATAQIAVREFASAIETLDAARAKDTELNNGANVREIDQLYIK- 517

Query: 212 KVEESLNLEALPKGEEQQTSEGSSAGGF--PDLSSMXXXXXXXXXNNPQVMQAAQKMMQN 269
                 + +     +  +T E + A     P+++S+          +P +     +  QN
Sbjct: 518 -----ASQQRFQPQDPNETPEQAYARALKDPEVASI--------MQDPVMQSILSQAQQN 564

Query: 270 PSAMQEMMNNPAIKQMAQNFASGG 293
           P+A+QE M NP +    Q   + G
Sbjct: 565 PAALQEHMKNPEVFNKIQTLIAAG 588

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 100 KLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAV-- 157
           K EGNK + A+ F+ A++ Y +A +L   +  +  NR+AA      +E+A++    AV  
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQ 329

Query: 158 --RINPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
              +   Y   S+ ++R+G A   L   ++A+E Y+K L
Sbjct: 330 GREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score =  102 bits (253), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 109/225 (48%), Gaps = 40/225 (17%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AKD++ A+  +++AI++   PN+ V Y NR+A Y+S KKF  A++DA
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNH-VLYSNRSACYTSLKKFVNALKDA 63

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           E  V+INPS+S+GY+R+G A + +G  +EA   YKK L+++  N                
Sbjct: 64  EECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASN---------------- 107

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
                 +A  +G EQ      S  G PD+            N+P +++  +K   NP   
Sbjct: 108 ------KAAQEGLEQVHRTQESRRGMPDMG------LTQMFNDPNLIENLKK---NPKTA 152

Query: 274 QEMMNNPAIKQMAQNFASGGGTPNL--GDMMKDPNIKDMAGKFFG 316
            EMM +P   Q+          P     D+  DP +  +     G
Sbjct: 153 -EMMKDP---QLVAKLIQYRSNPQAISQDLFTDPRLMTIMATLMG 193

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 93/203 (45%), Gaps = 16/203 (7%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG   F   D+  AVK YTE I+  P +A  Y NRAA  S    F EA+ D 
Sbjct: 395 EKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDC 454

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
             A+  +P++ R Y R   A+ A+ +   A+E     LD       E  K    SA  + 
Sbjct: 455 NKAIEKDPNFVRAYIRKATAQIAVREFSSALE----TLDAARSKDAEVNK----SANTRE 506

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLS---SMXXXXXXXXXNNPQVMQAAQKMMQNP 270
            + L ++A      QQ  + + +   P+ +   +M          +P +    Q+  QNP
Sbjct: 507 IDQLYIKA-----SQQRFQPNDSNESPEQTYERAMKDPEVAAIMQDPVMQSILQQAQQNP 561

Query: 271 SAMQEMMNNPAIKQMAQNFASGG 293
           +A+QE M NP I +  Q   + G
Sbjct: 562 AALQEHMKNPEIFKKIQTLIASG 584

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 64/128 (50%), Gaps = 9/128 (7%)

Query: 72  EPTLSSSEPTGNNTDAHAPE-VAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNA 130
           EP + + EP   + D++  E   +RAE  K EGNK + A+ F+ AV KY EA E   N+ 
Sbjct: 238 EPVVQADEPEQMDVDSNEDENAKKRAEAAKAEGNKLYKARQFDEAVAKYNEAWEAH-NDI 296

Query: 131 VFYGNRAAA-------YSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEA 183
            +  NR+AA        +S K  EEAV             ++ ++R+G     L   ++A
Sbjct: 297 TYLNNRSAAEFEKGDYETSIKTLEEAVEKGREMRADYKVIAKSFARMGNCYTKLNDLKKA 356

Query: 184 MEAYKKVL 191
           ++ YKK L
Sbjct: 357 IDFYKKSL 364

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 3/104 (2%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AKD++ A++ +T+AIE+   PN+ V Y NR+A Y+S KKF +A+ DA
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNH-VLYSNRSACYTSLKKFSDALNDA 63

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
              V+INPS+S+GY+RLG A   LG  +EA   YKK L+++  N
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASN 107

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 101/207 (48%), Gaps = 24/207 (11%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG + F   D+  AVK YTE I+  P +A  Y NRAAA +    F EA+ D 
Sbjct: 394 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYK--KVLDIEGDNATEAMKRD---YES 208
             A+  +P++ R Y R   A+ A+ +   A+E     +  D E +N + A + D   Y++
Sbjct: 454 NKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKA 513

Query: 209 AKKKVEESLNLEALPKGEEQQTSEGSSAGGF--PDLSSMXXXXXXXXXNNPQVMQAAQKM 266
           ++++ +          G   +T E +       P+++++          +P +    Q+ 
Sbjct: 514 SQQRFQ---------PGTSNETPEETYQRAMKDPEVAAI--------MQDPVMQSILQQA 556

Query: 267 MQNPSAMQEMMNNPAIKQMAQNFASGG 293
            QNP+A+QE M NP + +  Q   + G
Sbjct: 557 QQNPAALQEHMKNPEVFKKIQTLIAAG 583

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 8/103 (7%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAES 155
           A+  K EGNK + A+ F+ A++ Y +A EL   +  +  NRAAA     ++E A+     
Sbjct: 262 ADKEKAEGNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLND 320

Query: 156 AV----RINPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           AV     +   Y   S+ ++R+G A + LG  ++ +E Y+K L
Sbjct: 321 AVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 3/104 (2%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AKD++ A++ +T+AIE+   PN+ V Y NR+A Y+S KKF +A+ DA
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNH-VLYSNRSACYASLKKFSDALNDA 63

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
           +  + INPS+S+GY+RLG A   LG  +EA   YKK L+++  N
Sbjct: 64  KECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASN 107

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 92/202 (45%), Gaps = 14/202 (6%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG   F   D+  AVK YTE I+  P +A  Y NRAAA +    F EA+ D 
Sbjct: 394 EKAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
             A+  +P++ R Y R   A+ A+ +   A+E        + D    A  R+ +    K 
Sbjct: 454 NKAIEKDPNFVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKA 513

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGF--PDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPS 271
            +    +    G   +T E +       P+++++          +P +    Q+  QNP+
Sbjct: 514 SQ----QRFQPGTGNETPEETYQRAMKDPEVAAIMQ--------DPVMQSILQQAQQNPA 561

Query: 272 AMQEMMNNPAIKQMAQNFASGG 293
           A+QE M NP + +  Q   + G
Sbjct: 562 ALQEHMKNPEVFKKIQTLIAAG 583

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 8/103 (7%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAES 155
           A+  K EGNK + A+ F+ A++ Y +A EL   +  +  NRAAA     +++ A+     
Sbjct: 262 ADKEKAEGNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTAIATLND 320

Query: 156 AVR----INPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           AV     +   Y   SR ++R+G A + LG  ++ +E Y+K L
Sbjct: 321 AVEQGREMRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 119/225 (52%), Gaps = 40/225 (17%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AFAAK ++ AV  +T+AIE+   PN+ V Y NR+A+Y+S +KF EA++DA
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNH-VLYSNRSASYASEQKFNEALKDA 63

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
               +INPS+++GY+R G A + +G  ++A  +YKK L+++ +N           AK+ +
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANNKI---------AKEGI 114

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
           E+      + + + Q+ ++       PDL            N+P ++   +K+  NP   
Sbjct: 115 EQ------IQRVQSQRQAQ-------PDLG------LTEMFNDPNLI---EKLKNNPKTA 152

Query: 274 QEMMNNPAIKQMAQNFASGGGTPN--LGDMMKDPNIKDMAGKFFG 316
            E+MN+P   Q+     S    PN    D+  DP +  + G   G
Sbjct: 153 -ELMNDP---QLVAKLLSFRSNPNGLAQDLFSDPRLMTIMGTLMG 193

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 96/205 (46%), Gaps = 20/205 (9%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG + F   D+  AVK YTE I+  P +A  Y NRAAA S    F +A+ D 
Sbjct: 383 EKAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDC 442

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYK--KVLDIE---GDNATEAMKRDYES 208
             A+  +P++ R Y R   A+ A+     A+E     +  D E   G NA E  +   ++
Sbjct: 443 NKAIEKDPNFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQLYMKA 502

Query: 209 AKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQ 268
           A+++ + +        G+E        A   P+++ +          +P +    Q+   
Sbjct: 503 AQQRFQPAT-------GDETPEQTYERAMRDPEVAKI--------MQDPVLQSILQQAQN 547

Query: 269 NPSAMQEMMNNPAIKQMAQNFASGG 293
           +P+A+QE M NP I +  Q   + G
Sbjct: 548 DPAALQEHMKNPEIFKKIQTLIAAG 572

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 78  SEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRA 137
           +EP   + D    E    AE  K+EGNKA+ A++F+ A+  Y +A EL  NN  +  NR+
Sbjct: 233 AEPEAESMDVDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWEL-DNNITYLNNRS 291

Query: 138 AAYSSFKKFEEAVRDAESAV----RINPSY---SRGYSRLGLAKYALGKPEEAMEAYKKV 190
           AA     +++ A+     A+     +   Y   ++ ++R+G A   +G  +EA+  Y+K 
Sbjct: 292 AAEFEKGEYDTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKS 351

Query: 191 L 191
           L
Sbjct: 352 L 352

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 74/104 (71%), Gaps = 3/104 (2%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AK+++GA++ +T+AIE+   P++ V + NR+A Y+S KKF +A+ DA
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSH-VLFSNRSACYTSLKKFSDALNDA 63

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
              V+INPS+S+GY+RLG A   LG  +EA   YKK L+++ +N
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANN 107

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 96/203 (47%), Gaps = 16/203 (7%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           ++AE  +LEG + F   D+  AVK YTE I+  P +A  Y NRAAA +    F EA+ D 
Sbjct: 394 DKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
             A+  +P++ R Y R+  A+ A+ +   A+E     LD+      E  K    SAK+  
Sbjct: 454 NKAIEKDPNFVRAYIRMAAAQIAVKEFAAALE----TLDVARTKDAEVNKG--ASAKE-- 505

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLS---SMXXXXXXXXXNNPQVMQAAQKMMQNP 270
                ++ L     QQ  +  +    P+ +   +M          +P +    Q+  QNP
Sbjct: 506 -----IDQLYYKASQQRFQPDTGSETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNP 560

Query: 271 SAMQEMMNNPAIKQMAQNFASGG 293
           +A+QE M NPA+ +  Q   + G
Sbjct: 561 AALQEHMKNPAVFKKIQTLIAAG 583

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 67/153 (43%), Gaps = 16/153 (10%)

Query: 77  SSEPTGNNTDAHAPEVAE--------RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN 128
           SS       DA  PE  E         A+N K EGNK + A  F+ A++ Y  A EL   
Sbjct: 235 SSSTAPQQKDAEEPEPMEVDEDNSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWELH-K 293

Query: 129 NAVFYGNRAAAYSSFKKFEEAVRDAESAVR----INPSY---SRGYSRLGLAKYALGKPE 181
           +  +  NRAAA      +E  +     AV     +   Y   S+ ++R+G A + LG  +
Sbjct: 294 DITYLNNRAAAEYEKGDYETVIATLNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDLK 353

Query: 182 EAMEAYKKVLDIEGDNATEAMKRDYESAKKKVE 214
           + +E Y+K L         A  R+ E  +KK E
Sbjct: 354 KTIEYYQKSLTEHRTADILAKLRNVEKEQKKAE 386

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/194 (33%), Positives = 105/194 (54%), Gaps = 21/194 (10%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K EGN+AFA+KD+  A++ +T+AIE+   PN+ V + NR+A Y+S K F +A+ DA
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNH-VLFSNRSACYASNKDFVKALDDA 61

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
              V+INPS+++GY+RLG A Y LG  +EA ++YKK L++             +SA K  
Sbjct: 62  NECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALEL-------------DSANKAA 108

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXX----NNPQVMQAAQKMMQN 269
           ++ L+     + +     +      F D   +              +PQ +    +  QN
Sbjct: 109 QDGLSQVQQTQQQRTAQPDLGLGNMFKDPMMIEKLKKNPKTAEFMKDPQFVAKILQFQQN 168

Query: 270 PSAM-QEMMNNPAI 282
           P AM QEM+++P +
Sbjct: 169 PQAMGQEMLSDPRL 182

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 94/204 (46%), Gaps = 18/204 (8%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +L+G + F   D+  AV+ YTE I+  PN+A  Y NRAAA S    F +A+RD 
Sbjct: 387 EKAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDC 446

Query: 154 ESAVRINPSYSRGYSRLGLAKYAL----GKPEEAMEAYKKVLDIEGDNATEAMKRDYESA 209
           + A+  +P++ R Y R    + A+    G  E    A  K  ++     T  + + Y  A
Sbjct: 447 DKAIEKDPNFVRAYIRKATGQIAIKDYAGAIETLDSARTKDAEVNSGANTREIDQLYIKA 506

Query: 210 KKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQN 269
            +   E  N    P+         + A   P+++S+          +P +     +  QN
Sbjct: 507 SQARFEPANANETPE------EAYARATKDPEVASI--------LQDPVMQSILSQAQQN 552

Query: 270 PSAMQEMMNNPAIKQMAQNFASGG 293
           P+A+QE M NP + +  Q   + G
Sbjct: 553 PAALQEHMRNPDVFKKIQTLIAAG 576

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           +AE  K EGNK +  + F+ A++KY EA E   N+  +  NRAAA      +E A+    
Sbjct: 254 KAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLT 312

Query: 155 SAV----RINPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
            AV     +   Y   S+ ++R+G + + LG  ++A++ Y+K L
Sbjct: 313 KAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 114/227 (50%), Gaps = 44/227 (19%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AK+++ A++K+T+AIE+   PN+ V Y NR+A Y+S K+F + + DA
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNH-VLYSNRSACYTSKKQFVKGLEDA 63

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
              V+INP++S+GY+R+G A + +G  +EA +AYKK L+++  N                
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSN---------------- 107

Query: 214 EESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNPSAM 273
                 +A   G  Q T    +    PD+            N+P +++  +K   NP   
Sbjct: 108 ------KAAHDGLSQVTRAQEARHSQPDMG------LGKIFNDPNLIENLKK---NPKTA 152

Query: 274 QEMMNNP----AIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316
            EMM +P     I Q  QN  S G      D++ +P +  + G   G
Sbjct: 153 -EMMKDPQLVAKILQYQQNPQSMG-----QDLLTEPRLMTILGVLMG 193

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 95/205 (46%), Gaps = 20/205 (9%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG + F   D+  AVK YTE I   P++A  Y NRAAA S    F EA+ D 
Sbjct: 387 EKAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDC 446

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYK--KVLDIEGDNATEAMKRDYESAKK 211
            +A+  +P++ R Y R   A+ A+     A+E     +  D E +N   + + D      
Sbjct: 447 NTAIEKDPNFIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREID------ 500

Query: 212 KVEESLNLEALPKGEEQQTSEGSSAGGFPDLS---SMXXXXXXXXXNNPQVMQAAQKMMQ 268
                L L+A      QQ  + S+A   P+ +   +M          +P +    Q+   
Sbjct: 501 ----QLYLKA-----NQQRFQPSNANETPEQTYERAMKDPEVAAIMQDPVMQSILQQAQT 551

Query: 269 NPSAMQEMMNNPAIKQMAQNFASGG 293
           NP+A+QE M NP I +  Q   + G
Sbjct: 552 NPAALQEHMKNPEIFKKIQTLIAAG 576

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AKD+  A+  +T+AIE+   PN+ V Y NR+A Y+S KKF +A+ DA
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNH-VLYSNRSACYTSLKKFTDALNDA 63

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
              V+INPS+S+GY+RLG A   LG  ++A   YKK L+++  N
Sbjct: 64  TECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAAN 107

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 20/205 (9%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG + F   D+  AVK YTE I+  P +A  Y NRAAA +    F EA+ D 
Sbjct: 391 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADC 450

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYK--KVLDIEGDNATEAMKRD---YES 208
             A+  +P++ R Y R   A+ A+ +   A+E     +  D E +N   A + D   Y++
Sbjct: 451 NKAIEKDPNFVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKA 510

Query: 209 AKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQ 268
           ++++                Q+  G+ +       +M          +P +    Q+  Q
Sbjct: 511 SQQRF---------------QSGTGNDSPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQ 555

Query: 269 NPSAMQEMMNNPAIKQMAQNFASGG 293
           NP+A+QE M NP + +  Q   + G
Sbjct: 556 NPAALQEHMKNPEVYKKIQTLIASG 580

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 8/103 (7%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAES 155
           A+  K EGNK + A+ FE A++ Y +A EL   +  +  NRAAA      +E A+     
Sbjct: 259 ADKEKAEGNKFYKARQFEEAIEHYNKAWELH-RDITYLNNRAAAEYEKGDYETAIATLTD 317

Query: 156 AV----RINPSY---SRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           AV     +   Y   S+ ++R+G A + LG  ++ ++ Y+K L
Sbjct: 318 AVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSL 360

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 69/103 (66%), Gaps = 1/103 (0%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAI-ELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           AE  K EGN AF AKDF+ AV+ +T AI E    N V Y NR+ AY+S KKF+EA+ DA 
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDAT 63

Query: 155 SAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
             V+I   +S+G++RLG A + LG  +EA E+YKK L+++  N
Sbjct: 64  ECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATN 106

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 99/204 (48%), Gaps = 18/204 (8%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +L+G + F   D+  AVK Y+E I   P++A  Y NRAAA S    F +A++D 
Sbjct: 390 EKAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDC 449

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYK--KVLDIEGDNATEAMKRD--YESA 209
           + A+ I+PS+ R Y R   A+ A+ +   A+E     +  D E +N +   + D  Y  A
Sbjct: 450 DKAIEIDPSFVRAYIRKATAQIAVQEYSAAIETLDVARTKDAEVNNGSSIREIDQLYVKA 509

Query: 210 KKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQN 269
            ++  +  N    P+         + A   P+++S+          +P +     +  QN
Sbjct: 510 TQQRFQPANTNESPE------ETYARAVKDPEVASI--------LQDPVMQSILAQAQQN 555

Query: 270 PSAMQEMMNNPAIKQMAQNFASGG 293
           P+A+QE M NP + +  Q   + G
Sbjct: 556 PAALQEHMKNPEVFKKMQTLIAAG 579

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAY-------SSFKKF 146
           E AE  K EGN+ +  + F+ A+ KY EA  L   +  +  NRAAA        S+ K  
Sbjct: 256 ENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQ-KDITYLNNRAAAEYEKGDYNSAIKTL 314

Query: 147 EEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
            EAV             ++ ++RLG A Y L + ++A+E Y+K L
Sbjct: 315 NEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 73/104 (70%), Gaps = 3/104 (2%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIEL--MPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           A+  K +GN AF AKD+E A + + +AI++   PN+ V Y NR+A Y+S KKF E ++DA
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNH-VLYSNRSACYTSLKKFAEGLKDA 62

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
           E  V+INP +S+GY+R+G A++ L   E+A ++Y+K L+++  N
Sbjct: 63  EECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN 106

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 100/204 (49%), Gaps = 18/204 (8%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+AE  +LEG + F+  D+  AVK YTE I+  P +A  Y NRAAA +    F EA+ D 
Sbjct: 380 EKAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADC 439

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL--DIEGDNATEAMKRD--YESA 209
           + A+  +P++ R Y R   A+ A+ +   A+E    V   D E +N   A + D  Y  A
Sbjct: 440 DRAIEKDPNFIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREIDQLYIKA 499

Query: 210 KKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQN 269
             +  +  ++   P+   Q+  +       P+++++          +P +    Q+  QN
Sbjct: 500 NNQRFQPEDVNENPEQTYQRAMKD------PEVAAI--------MQDPVMQSILQQAQQN 545

Query: 270 PSAMQEMMNNPAIKQMAQNFASGG 293
           P+A+QE M NP + +  Q   + G
Sbjct: 546 PAALQEHMQNPDVFRKIQTLIAAG 569

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (51%), Gaps = 10/127 (7%)

Query: 72  EPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           EP   ++EP     D   P+VA  AE  K EGNK + A+ F+ A++ Y +A EL   +  
Sbjct: 226 EPLKENNEPEPMEVDEKGPQVA--AEEEKAEGNKFYKARKFDEAIEHYNKAWELH-KDIT 282

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAV----RINPSY---SRGYSRLGLAKYALGKPEEAM 184
           +  NRAAA      +E A+    +AV     +   Y   ++ ++R+G A + LG  ++++
Sbjct: 283 YLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSI 342

Query: 185 EAYKKVL 191
             Y+K L
Sbjct: 343 NFYQKSL 349

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 66/113 (58%), Gaps = 2/113 (1%)

Query: 73  PTLSSSEPTGNNTDAHAPE-VAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P  ++ +P  +  D   PE V + A  LK +GN+ F AKDFE A++ YT AI L   + V
Sbjct: 80  PVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPV 138

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184
           FY NR+AAY S   FE+ V D  +A+++ P YS+ + R   A   LG+  +AM
Sbjct: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 1/108 (0%)

Query: 92  VAERAENLKLEGNKAFAAKDFEGAVKKYTEAI-ELMPNNAVFYGNRAAAYSSFKKFEEAV 150
           V+  ++ LK  GNK +  K +E AV  +T A+ +   N  + Y NRAAA+   K + EA+
Sbjct: 4   VSMSSQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEAL 63

Query: 151 RDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
            D ++ V + P++ +GYSR+G+A   L K +EA E +KK L +   N 
Sbjct: 64  EDGKNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNV 111

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 95/203 (46%), Gaps = 17/203 (8%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           ++ E  ++EG + F  +++  A+K YTE I+  P + V + NRAA +       + + D 
Sbjct: 427 QKFEEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDC 486

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           + A+ ++PSY + Y R G A+      +EA+E ++      GD A    K+ + + K ++
Sbjct: 487 DKAISVDPSYIKAYVRKGFAQITERDLDEALETWE-----SGDAAN---KKYHGNEKNEL 538

Query: 214 EESLN---LEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQAAQKMMQNP 270
            ESL+   L  + + + Q T E   A       +M         N+P +     +   NP
Sbjct: 539 LESLHSKVLFEIHRPKRQGTREEIRA------KAMQVPEVVEALNDPVLKDLLMQSQTNP 592

Query: 271 SAMQEMMNNPAIKQMAQNFASGG 293
           SA++E M+N  I    Q     G
Sbjct: 593 SALEEHMDNADIMNKMQTLMRHG 615

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 61/148 (41%), Gaps = 20/148 (13%)

Query: 89  APEVAE---RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKK 145
           +PE  E   RA+  K  GN  +  ++F+ A+  YT+A      +  +  N  AA      
Sbjct: 285 SPEETEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTF-QDITYLNNIGAAQFERGD 343

Query: 146 FEEAVRDAESAV----RINPS---YSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
           +   ++    AV      NP     ++ Y R+G A + +   E A+ AY+  L + G+  
Sbjct: 344 YGNVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGNE- 402

Query: 199 TEAMKRDYESAKKKVEESLNLEALPKGE 226
                   E  KK     +  E + KGE
Sbjct: 403 --------EHKKKLASLRVEFEKVKKGE 422

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 91  EVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAV 150
           E A++A +LK EGNK    K +  AV+ YT+AIEL    ++F+ NRA A      F+  +
Sbjct: 8   EAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCL 67

Query: 151 RDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAK 210
            D  SA+ ++P   + Y R GL++  L   ++A      VL  +  +AT   KR  +  +
Sbjct: 68  DDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDATA--KRALDMCE 125

Query: 211 KKVEE 215
           K + E
Sbjct: 126 KVIRE 130

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 83/184 (45%), Gaps = 15/184 (8%)

Query: 73  PTLSSSEPTGNNTDA-HAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P L   EP  +      AP+    A  LK +GN  F AK F  A+K Y  AIEL PN+ V
Sbjct: 107 PLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPV 166

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S    ++ V     A+ I P +S+   R   A  +LG   +AM     VL
Sbjct: 167 FYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVL 225

Query: 192 DIEGD---NATEAMKRDYESAKKKVEESLNLEALPKGEEQQ-------TSEGSSAGGF-P 240
            + GD    + E M     +  K+  + LN   L  G+++        TS  S  G F P
Sbjct: 226 SLNGDFDGTSIEPMLE--RNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDP 283

Query: 241 DLSS 244
           DL +
Sbjct: 284 DLET 287

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 3/137 (2%)

Query: 93  AERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRD 152
           A +A   K  GN A   +D+ GA++ YTEAI+L    ++++ NRA  +     F+  + D
Sbjct: 9   AAKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGIND 68

Query: 153 AESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKK 212
            + A+ I+P   + Y R G++   L + + A +  K VL  + ++AT   KR  +  +K 
Sbjct: 69  CDKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDATA--KRGLDVCEKF 126

Query: 213 VEESLNLEALPKGEEQQ 229
           + E    +A+  GEEQQ
Sbjct: 127 IREERFKKAI-GGEEQQ 142

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 63/127 (49%), Gaps = 6/127 (4%)

Query: 73  PTLSSSEPTGNNTDAHAPEVAERAE---NLKLEGNKAFAAKDFEGAVKKYTEAIELMPNN 129
           P LS  EP  +        +++R E    LK +GN  F +K+F+ A+K Y  AIEL PN+
Sbjct: 101 PLLSDGEP--DMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPND 158

Query: 130 AVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKK 189
            VFY N +A Y S     + V     A+ I P +S+   R   A  +LG   +AM     
Sbjct: 159 PVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-S 217

Query: 190 VLDIEGD 196
           VL + GD
Sbjct: 218 VLSLNGD 224

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 61/129 (47%), Gaps = 2/129 (1%)

Query: 69  GASEPTLSSSEPTGNNTDAHAPEVAE-RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMP 127
           G   P+L + EP        +P   +  A  LK  GN  F AK+F  A+K Y  AIEL P
Sbjct: 99  GFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDP 158

Query: 128 NNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAY 187
           N  VFY N +A Y S    E+ +     A+ I P +S+   R   A  +LG   +AM   
Sbjct: 159 NEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 218

Query: 188 KKVLDIEGD 196
             VL + GD
Sbjct: 219 -SVLSLNGD 226

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 63/117 (53%), Gaps = 2/117 (1%)

Query: 69  GASEPTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMP 127
           G S P     EP     D  + E  ++ A  LK +GN+ F  K FE A+K Y+ AIE + 
Sbjct: 68  GPSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIE-VK 126

Query: 128 NNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184
            + VFY NR+A Y S  + E+ V D  +A+++ P YS+   R   A  +LGK  +AM
Sbjct: 127 EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAM 183

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%)

Query: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178
           + +A+EL PN A  Y +R   +   ++FE+A +D E A  +N S    Y +L    Y  G
Sbjct: 363 FEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREG 422

Query: 179 K 179
           K
Sbjct: 423 K 423

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 2/123 (1%)

Query: 93  AERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRD 152
            E A + K EGNK    +DF+ A + YT+AIE  P  ++FY NRA A      F  A+ D
Sbjct: 6   TELATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALND 65

Query: 153 AESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKK 212
             +A+ +N S  + Y R GLA   L   + A   +  VL  + ++     K  +++ +K 
Sbjct: 66  CTNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIA--KNGFDTCEKV 123

Query: 213 VEE 215
           + E
Sbjct: 124 IRE 126

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 93  AERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRD 152
           AE A   K EGN    ++D++ A++ YT+AIEL   +++FY NRA A+     F+ A+ D
Sbjct: 9   AEAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHD 68

Query: 153 AESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKK 212
              A++++ +  + Y R GLA   L +  +A      +L  + ++AT   KR  E  +  
Sbjct: 69  CNDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTILLKYKPNDATA--KRGLEMCESF 126

Query: 213 VEE 215
           + E
Sbjct: 127 IRE 129

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 60/113 (53%), Gaps = 2/113 (1%)

Query: 73  PTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P  S+ EP  +  D+   E  ER +  +K +GN+ F  K +E A+K Y+ A+ L   + V
Sbjct: 74  PVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRL-KKDPV 132

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184
           FY NR+A +    K E+ V D  +A+ + P YS+   R   A  +LG   +AM
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 68/150 (45%), Gaps = 22/150 (14%)

Query: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175
           ++ + +A+EL PN++  Y +R   Y   ++FE++ +D + A   NP     Y +L    Y
Sbjct: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421

Query: 176 ALGKPE-----------------EAMEAYKKVLDIEGDNATEAMKRDYESAKK--KVEES 216
              K E                 E    Y ++L  +GD   E+  ++YE A+K    +E 
Sbjct: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGD--LESALKEYEFARKLEDAQEG 479

Query: 217 LNLEALP-KGEEQQTSEGSSAGGFPDLSSM 245
           +++   P  G+    +  S +G F + +++
Sbjct: 480 IHVGVAPLVGKATVLARQSHSGDFAEATAL 509

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 2/122 (1%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+A   K EGN     +++  A++ Y++AIEL P  ++F+ NRA A      F+  + D 
Sbjct: 10  EQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
           + A+R++P   + Y R GL+   L + ++A    + VL  +  +AT   KR     +K +
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDATA--KRALAMCEKVI 127

Query: 214 EE 215
            E
Sbjct: 128 RE 129

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 90  PEVAERAENLKL--EGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFE 147
           P   + AE LKL  EGN     +DF  A+  YT+AI L    ++++ NRA A+     F+
Sbjct: 4   PTSEQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQ 63

Query: 148 EAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYE 207
            ++ D + A++++P  ++ Y R GL+   L + ++A    + VL  +  +AT +  R  +
Sbjct: 64  SSLNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATAS--RALD 121

Query: 208 SAKKKVEESLNLEALPKGEE 227
             +K + E    +A+  G+E
Sbjct: 122 VCEKFIREERFRKAIGGGDE 141

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E AEN K +GN  +  K F  A + YT+ IE+  +    N   Y NRAA    
Sbjct: 69  AYEGEPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLE 128

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            K F   + D ++A+  NP   + Y R+G A  A+ K E A E+ +    I+ DN +
Sbjct: 129 LKNFRSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKS 185

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 59/125 (47%), Gaps = 3/125 (2%)

Query: 73  PTLSSSEPTGNNTDAHAPEVAERAE-NLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P   + EP  +N D    E  E+    LK +GN  F A  FE A+K Y  AIEL   N +
Sbjct: 87  PVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIEL-KENPI 145

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S  K EE ++    A+ + P YS+   R   A   L    +AM     VL
Sbjct: 146 FYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDL-SVL 204

Query: 192 DIEGD 196
            + GD
Sbjct: 205 SLNGD 209

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 63/118 (53%), Gaps = 2/118 (1%)

Query: 68  SGASEPTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELM 126
           + ++ P   + EP  ++ D    E  E+ A  LK +GN+ F  K F+ A+K Y  A+EL 
Sbjct: 73  TASAYPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALEL- 131

Query: 127 PNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184
             + VFY NR+A Y S  + E+ V D  +A+++   YS+   R   A  +LG   +AM
Sbjct: 132 KKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAM 189

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 2/91 (2%)

Query: 89  APEVAERAENL--KLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKF 146
            P  A+RA+ L  K EGN     K F  A++KYTEAI+L    ++++ NRA A+     F
Sbjct: 3   TPTAADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNF 62

Query: 147 EEAVRDAESAVRINPSYSRGYSRLGLAKYAL 177
           + A+ D + A++++P   + Y R  L+  AL
Sbjct: 63  QSALNDCDEAIKLDPKNIKAYHRRALSCMAL 93

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 61/118 (51%), Gaps = 5/118 (4%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV-----FYGNRAAAYS 141
           A+  E  E AEN K +GN  + AK F+ A   Y + I++  N  V      + N+AA   
Sbjct: 67  AYEGEPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACEL 126

Query: 142 SFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
             K F   + D ++A+++NP   + Y R+  A +AL K EEA E+ +  L  + +N +
Sbjct: 127 ELKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKESVEFGLKFDPENTS 184

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 69/134 (51%), Gaps = 2/134 (1%)

Query: 93  AERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRD 152
           A++A   K EGN     +D+  A++KY +AIEL    +V++ NRA  +     F+ A +D
Sbjct: 6   ADKALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQD 65

Query: 153 AESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKK 212
            + A+ ++P   + Y R GLA   L + ++A      VL  +  +A  A KR  +  +K 
Sbjct: 66  CDKALALDPKNVKAYHRRGLACVGLLEFKKARADLTVVLKAKPSDA--AAKRALDICEKV 123

Query: 213 VEESLNLEALPKGE 226
           + E    +A+  G+
Sbjct: 124 IREERFRKAIGGGD 137

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (53%)

Query: 92  VAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVR 151
           +   A   K +GNK  A+KD+  A++ YT+AIEL    ++F+ NRA A     +F+ A+ 
Sbjct: 5   IVPEALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALE 64

Query: 152 DAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
           D+  A+ ++ S  +GY R G+A   L     A    + VL ++   AT
Sbjct: 65  DSSKAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEAT 112

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 89/202 (44%), Gaps = 12/202 (5%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNA----VFYGNRAAAYSS 142
           A+  E  E AEN K +GN  +  K F  A   Y + IE+  ++A    +   NRAA    
Sbjct: 68  AYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELE 127

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA--YKKVLDIEGDNATE 200
            K +   + D   A+++NP   + + R+G A   L K EEA EA  +   +D E +    
Sbjct: 128 LKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTENEALLS 187

Query: 201 AMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVM 260
            +    +  K + E    LE+  K  E+  S   +A    ++  +           P ++
Sbjct: 188 LLSAISKKQKARHEHEQKLESRRKEMERLASILEAAMAIRNIHMI------ASKQRPDLL 241

Query: 261 QAAQKMMQNPSAMQEMMNNPAI 282
           +AA+  + NP  ++  +  PA+
Sbjct: 242 EAAKIKLDNPEDIESQLIFPAM 263

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 63/110 (57%), Gaps = 2/110 (1%)

Query: 76  SSSEPTGNNTDAHAPEVA-ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYG 134
           S+ EP  ++ D+   E   E A  LK +GN+ F    FE A+K Y  A++L  ++ ++Y 
Sbjct: 89  SNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL-KDDPIYYS 147

Query: 135 NRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184
           N +A Y+S  ++E+ +  A  A+++ P++S+   R  LA  A+G   +AM
Sbjct: 148 NISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 32/60 (53%)

Query: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175
           ++ + +A+EL PNN   Y +R  +Y   +++E+A +D +    ++ +    Y +L    Y
Sbjct: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 1/115 (0%)

Query: 85  TDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFK 144
           T   A ++A+  E  K EGN     +++  A++ YT+AIEL PN ++FY NRA A     
Sbjct: 2   TSPTAEDIAKAVE-FKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLD 60

Query: 145 KFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            F+ A  D   A+ ++    + Y R GLA   L + + A      VL  +  +AT
Sbjct: 61  NFQSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVVLKAKPSDAT 115

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAES 155
           A  LK +GN  F  K+F  A+K Y  AIEL PN+ VFY N +A Y S     + +     
Sbjct: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183

Query: 156 AVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGD 196
           A+ I P +S+   R   A  +LG   +AM     VL + GD
Sbjct: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 49/104 (47%), Gaps = 4/104 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNN----AVFYGNRAAAYSS 142
           A+  E  E AEN K +GN  F  K F  A   Y + IE+   N       + NRAA    
Sbjct: 71  AYEGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLE 130

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
            K +   + D + A+ +NP   + Y R+G A Y L   EEA E+
Sbjct: 131 LKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E AEN K +GN  + A+ ++ A + Y + +E+  +    N   + NRAA    
Sbjct: 71  AYEGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELE 130

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
            K     + D + A+R NP   + + R+G A ++L K EEA EA +  L  + +NA
Sbjct: 131 LKNHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNA 186

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 2/90 (2%)

Query: 90  PEVAERAENL--KLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFE 147
           P  A+RA  L  K EGN     K F  A++KYT+AI+L    ++++ NRA A+     F+
Sbjct: 4   PTEADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQ 63

Query: 148 EAVRDAESAVRINPSYSRGYSRLGLAKYAL 177
            A+ D + A++++P   + Y R  L+  AL
Sbjct: 64  SALNDCDEALKLDPKNIKAYHRRALSCMAL 93

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 104 NKAFA---AKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRIN 160
           N+AFA     +F+ A+    EA++L P N   Y  RA +  +  +F++A +D    ++  
Sbjct: 51  NRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVLLKAK 110

Query: 161 PS 162
           P+
Sbjct: 111 PN 112

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (53%), Gaps = 2/117 (1%)

Query: 69  GASEPTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMP 127
           G S P     EP  +N    + E  ++ A  LK +GN+ F  K ++ A++ Y+ AIE + 
Sbjct: 67  GPSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIE-VK 125

Query: 128 NNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184
            + VFY NR+A Y S  + E+ V D  +A+++ P YS+   R   A  +LG   +AM
Sbjct: 126 EDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAM 182

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 57/116 (49%), Gaps = 4/116 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E AEN K + N  +  K F  A + YT+ I++       N   + NRAA    
Sbjct: 76  AYEGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELE 135

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
            K +   V D + A+ INP   + + R+G A  ALGK +EA +A    L I+ +N 
Sbjct: 136 LKNYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENV 191

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 64/125 (51%), Gaps = 3/125 (2%)

Query: 73  PTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P  S+ EP  +  D+ + E+ E+ A  LK +GN  F  +DFE A+K Y  A+ L   + V
Sbjct: 81  PVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTL-KQDPV 139

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S  + E+ V  +  A+++   YS+   R   A  +L    +AM     VL
Sbjct: 140 FYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDL-SVL 198

Query: 192 DIEGD 196
            + GD
Sbjct: 199 SLNGD 203

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158
           LK +GN+ F  + +E A+K Y  A++L   + VFY NR+A Y    K E+ V D  +A++
Sbjct: 98  LKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156

Query: 159 INPSYSRGYSRLGLAKYALGKPEEAM 184
           + P YS+   R   A  +LG   +AM
Sbjct: 157 LKPDYSKCLLRRATANESLGNYADAM 182

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 95/202 (47%), Gaps = 12/202 (5%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E AEN K +GN  +  K F  A + Y++ I++       N   Y NRAA    
Sbjct: 72  AYEGEPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELE 131

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN-ATEA 201
            K +   + D + A+++NP   + Y R+  A  AL + +EA+E+ +    I+  N + + 
Sbjct: 132 IKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKT 191

Query: 202 MKRDYESAKKKVE-ESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVM 260
           +K   E+ + ++E   L LE   K  E      +SA    +++++            +++
Sbjct: 192 LKLHIETKQLEIEARRLKLENEKKERENYQFILNSAIELRNITNIKTSKPA------ELL 245

Query: 261 QAAQKMMQNPSAMQEMMNNPAI 282
           + A   ++NP  ++  +  PA+
Sbjct: 246 REASIKLENPLELESQLIIPAV 267

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 63/117 (53%), Gaps = 4/117 (3%)

Query: 90  PEVAER--AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFE 147
           P  A+R  A   K EGN     K F  A++KYTEAI+L     +++ NRA ++     F+
Sbjct: 4   PTEADRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQ 63

Query: 148 EAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN--ATEAM 202
            A+ D + A++++P   + Y R  L+  AL + ++A      +L ++ ++  AT A+
Sbjct: 64  SALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVLLKVKPNDPAATRAL 120

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 2/91 (2%)

Query: 89  APEVAERAENL--KLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKF 146
            P  ++ A+ L  K EGN     K F  A++KYTEAI+L    ++++ NRA A+     F
Sbjct: 3   TPTASDCAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNF 62

Query: 147 EEAVRDAESAVRINPSYSRGYSRLGLAKYAL 177
           + A+ D + A++++P   + Y R  L+  AL
Sbjct: 63  QSALNDCDEAIKLDPKNIKAYHRRALSCMAL 93

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 104 NKAFA---AKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRIN 160
           N+AFA     +F+ A+    EAI+L P N   Y  RA +  +  +F++A +D    ++  
Sbjct: 51  NRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVLLKAK 110

Query: 161 P 161
           P
Sbjct: 111 P 111

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 73  PTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P  +S EP  +  D++ PE  E  A  LK +GN+ F  K  E A+K Y  A+E    + V
Sbjct: 82  PITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPV 140

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSR 169
           FY N +A Y S   FE+ + +   A+ + P YS+   R
Sbjct: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLR 178

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 57/117 (48%), Gaps = 4/117 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E AEN K + N  + AK F+ A + Y + IE+  N    N   + N AA    
Sbjct: 69  AYDGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELE 128

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            K F   +   + A++ NP   + Y R+  A Y L K +EA E+ K  L I+ +N +
Sbjct: 129 IKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKS 185

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKF 146
           A   E  E A  LK  GN  F  KD+E A+  Y  A++L  N+ VFY N AA Y S +  
Sbjct: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHN 135

Query: 147 EEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184
           +EA+     A+ +NP YS+   +       +GK  +A+
Sbjct: 136 KEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%)

Query: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178
           + +AI+L PN A  Y +R       +K+E+A  D + A   +P+    Y +L    Y  G
Sbjct: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREG 413

Query: 179 KPEEA 183
             ++ 
Sbjct: 414 HFDDC 418

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E A  LK +GN  F  KDFE A+K YT A+ L   + V+Y N +A YSS   +E+ +  A
Sbjct: 93  EWAGALKEKGNALFKKKDFENAIKYYTFALSL-KEDPVYYSNISACYSSLLNYEKVIEMA 151

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184
             A+ + P YS+   R   A   LG   +AM
Sbjct: 152 TKALALRPDYSKVLVRRANAYEKLGNFGDAM 182

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E AEN K +GN+ +  K ++ A + Y + IE+  +    N   + NRAA    
Sbjct: 69  AYDGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELE 128

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
            K +   V D   A++ NP+  + + R+  A + L K E+A EA +  L ++ ++A
Sbjct: 129 LKNYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA 184

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 51/104 (49%), Gaps = 4/104 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAI----ELMPNNAVFYGNRAAAYSS 142
           A+  E  E AEN K +GN+ + AK F+ A + YT+ I    E    N   + NRAA    
Sbjct: 74  AYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELE 133

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
            K +   + D   A+ INP   + Y R   A ++L K EEA  A
Sbjct: 134 LKNYRRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEAKSA 177

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 76/156 (48%), Gaps = 18/156 (11%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAES 155
           A + K +GN+     D++ A++ Y++AI L    ++++ NRA A+     F  AV D ++
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 156 AVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL-----DIEGDNATE---------- 200
           A++++P   + Y R GL+   + +  +A      VL     DI   NA +          
Sbjct: 72  ALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENFIREER 131

Query: 201 ---AMKRDYESAKKKVEESLNLEALPKGEEQQTSEG 233
              A+    ++AK  + ++LNLE+     + +T +G
Sbjct: 132 FKNAIGGSGDNAKSNICQTLNLESFNANADLKTYKG 167

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 92/200 (46%), Gaps = 8/200 (4%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E A N K +GN  + AK F+ A + Y + IE+  +    N   Y NRAA    
Sbjct: 69  AYEGEPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELE 128

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAM 202
            K +   + D ++A++ NP   + Y R+G A  AL   EEA ++ +  L ++  N     
Sbjct: 129 IKNYRRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVDSSNKPLQS 188

Query: 203 KRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQA 262
             D    K++ ++  N +   K +E+Q  EG       +   +          +P++++ 
Sbjct: 189 LLDIVLKKQEAKKEQNSK---KEQEKQIREGMQI-ILENAMKLRKIINVKSNESPEIVRD 244

Query: 263 AQKMMQNPSAMQEMMNNPAI 282
           A+  +++P   +  +  PA+
Sbjct: 245 AKVSLEDPVDCESQLIFPAL 264

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158
           LK +GNK F AKD+  A+K Y  A++L   + +FY N +A Y S  + ++ +  +  A+ 
Sbjct: 125 LKDKGNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQLDKVIESSTKALE 183

Query: 159 INPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGD 196
           +NP+YS+   R   A  +L    +A+     VL + GD
Sbjct: 184 LNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 74/158 (46%), Gaps = 8/158 (5%)

Query: 93  AERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRD 152
           A  A + K EGN+   AKD+  AV+ YT AIE     ++F+ NRA A     +F+ A+ D
Sbjct: 35  AATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALED 94

Query: 153 AESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKK 212
           +  A+ ++    + Y R GLA   L +   A    + V  +      EA++R  E  ++ 
Sbjct: 95  SARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVV--VRAKPGDEAVRRALEVCERM 152

Query: 213 V-EESLNLEALPKGEEQQ-----TSEGSSAGGFPDLSS 244
           +  E         G+E+Q     T   +S  G  DL+S
Sbjct: 153 LRRERFERAIRADGDEEQRRLCKTLSLASFAGNADLAS 190

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 52/101 (51%)

Query: 91  EVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAV 150
           E   +A   K +GN     K+F  A + Y++AIEL    ++++ NRA A+     F+ A+
Sbjct: 7   EDVNKALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTAL 66

Query: 151 RDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
            D   A+ ++P   + Y R GL+   L +  +A +  K VL
Sbjct: 67  NDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVL 107

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 104 NKAFA---AKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRIN 160
           N+AFA     +F+ A+    +AIEL P N   Y  R  +Y    +F +A +D +  +R  
Sbjct: 51  NRAFAHLKLDNFQTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAK 110

Query: 161 PS 162
           P+
Sbjct: 111 PN 112

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 62/125 (49%), Gaps = 3/125 (2%)

Query: 73  PTLSSSEPT-GNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P  S+ EP   N  +  A E  + A  LK +GN+ F  K ++ A+K Y  A+EL   + V
Sbjct: 75  PVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KEDPV 133

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S    ++ V  +  A+ + P YS+   R   A   LGK  +AM     VL
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDL-SVL 192

Query: 192 DIEGD 196
            + GD
Sbjct: 193 SLNGD 197

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 87/200 (43%), Gaps = 8/200 (4%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E A N K +GN  +  K ++ A   Y++ IE+       N   Y NRAA    
Sbjct: 70  AYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELE 129

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAM 202
            + F   + D + A+  N    + + R+G A + L K EEA  +   +  ++ D+   A+
Sbjct: 130 LRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSV--LFGLKLDSQNNAL 187

Query: 203 KRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQA 262
               ++  K+ EE  N+    +  +QQ  +   A    +  S          N P V+Q 
Sbjct: 188 VSLLDTIVKQ-EEKANVLEESRFRDQQEKD-LHASKLKEALSWRKITEFKTANPPAVLQN 245

Query: 263 AQKMMQNPSAMQEMMNNPAI 282
           +  M+  P  ++  ++ PA+
Sbjct: 246 STLMLSEPEDIESQLSFPAM 265

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 50/104 (48%), Gaps = 4/104 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAI----ELMPNNAVFYGNRAAAYSS 142
           A+  E  E AEN K +GN+ + AK F+ A + Y++ +    E    N   Y NRAA    
Sbjct: 74  AYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELE 133

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
            K +   + D   A+ INP   + Y R   A + L K EEA  A
Sbjct: 134 LKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSA 177

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 12/123 (9%)

Query: 73  PTLSSSEPTGNNTDAHAPEV-----------AERAENLKLEGNKAFAAKDFEGAVKKYTE 121
           P L  S P  +  D    E+           ++ A+ LK +GN+ F +KD E A+K Y  
Sbjct: 124 PILKPSYPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEY 183

Query: 122 AIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPE 181
           A+ L   + VFY N +A Y +  + ++ +  +  A+ + P YS+   R   A  ALG  +
Sbjct: 184 ALRL-DQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNK 242

Query: 182 EAM 184
           EA+
Sbjct: 243 EAL 245

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 52/104 (50%), Gaps = 4/104 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAI----ELMPNNAVFYGNRAAAYSS 142
           A+  E  E AEN K +GN+ + AK F+ A + YT+ +    E    N   + NRAA    
Sbjct: 74  AYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELE 133

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
            K + + V D   A+ INP   + Y R+  + + L K EEA  A
Sbjct: 134 LKNYRKCVEDCGKALTINPKNIKCYYRISKSFFQLRKLEEAKSA 177

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 62/125 (49%), Gaps = 3/125 (2%)

Query: 73  PTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P  S+ +P  +N      E  +R A  LK +GN+ F  K ++ A+K Y  A+EL  ++ V
Sbjct: 75  PVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPV 133

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S    ++ V  +  A+ + P YS+   R   A   LG   +AM     VL
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVL 192

Query: 192 DIEGD 196
            + GD
Sbjct: 193 SLNGD 197

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 3/125 (2%)

Query: 73  PTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P   + EP   N +  + E+ E  A  LK  GN+ F  KD++ A+K Y  A+ ++  + V
Sbjct: 77  PVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPV 135

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S  + ++ V ++  A+ + P YS+   R   A  +L    +AM     VL
Sbjct: 136 FYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDL-SVL 194

Query: 192 DIEGD 196
            + GD
Sbjct: 195 SLNGD 199

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 68  SGASEPTLSSSEPTGNNTDAHAPEVAE-----------RAENLKLEGNKAFAAKDFEGAV 116
           + ASEP  S       N D   P++A             A  LK +GN  F  K FE A+
Sbjct: 54  ATASEPATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAI 113

Query: 117 KKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYA 176
           + Y  AI+L   + VF+ N +A Y S    ++ V  +  A+ + P YS+   R   A   
Sbjct: 114 EFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYEN 172

Query: 177 LGKPEEAMEAYKKVLDIEGD 196
           +G+ ++AM     VL + GD
Sbjct: 173 MGRYQDAMFDI-SVLSLNGD 191

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 90/202 (44%), Gaps = 12/202 (5%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNN----AVFYGNRAAAYSS 142
           A+  E  E AEN K +GN+A+  K +  A   Y   IE+  NN     + + N+AA    
Sbjct: 65  AYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELE 124

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT--E 200
            K +   + D + A+  NP   + Y R+  A  A+ K +E+ E+ +  L ++  N++   
Sbjct: 125 MKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSSLLN 184

Query: 201 AMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVM 260
            +K   +  ++K    L LE      E+Q  EG       +   +         + P ++
Sbjct: 185 LLKTIIKKQEEKTAYRLKLE-----REKQEKEGKMI-ILENAIKLRNIKIINTDSAPDLL 238

Query: 261 QAAQKMMQNPSAMQEMMNNPAI 282
           + A+  +++P   +  +  PAI
Sbjct: 239 KEAKFSLEDPMDFESQLIFPAI 260

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 60/125 (48%), Gaps = 3/125 (2%)

Query: 73  PTLSSSEPT-GNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P  ++ EP      D  A E  + A  LK +GN+ F  K ++ A+K Y  A+EL   + V
Sbjct: 75  PVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPV 133

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S    ++ V  +  A+ + P YS+   R   A   LG   +AM     VL
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVL 192

Query: 192 DIEGD 196
            + GD
Sbjct: 193 SLNGD 197

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 58/115 (50%), Gaps = 5/115 (4%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           +A   K +GN     +DF  A + YT+AIEL    ++F+ NRA A+     F+ ++ D +
Sbjct: 11  KALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCD 70

Query: 155 SAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL-----DIEGDNATEAMKR 204
            A+ ++    + Y R GL+   L + ++A    K VL     D+  D A +  ++
Sbjct: 71  KALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 10/201 (4%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIEL----MPNNAVFYGNRAAAYSS 142
           A+  E  E A N K +GN  +  K F+ A   Y +A+++    +  N   Y N AA    
Sbjct: 61  AYEGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELE 120

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAM 202
            K +   +     A+++N    + + R+G A   LG+ E+++EA +  L ++ +N   A+
Sbjct: 121 IKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENG--AL 178

Query: 203 KRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQ-VMQ 261
           K     A +K++    LE     ++Q+  E      F DL+             P  +++
Sbjct: 179 KSIQSKATEKLKRKKELENRTLAQKQKEKELQE---FLDLAVQIRNITLVDTKQPAGLLK 235

Query: 262 AAQKMMQNPSAMQEMMNNPAI 282
             +  ++NP+  +  +  PA+
Sbjct: 236 DTKLTLENPTDFESQLIFPAM 256

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 60/125 (48%), Gaps = 3/125 (2%)

Query: 73  PTLSSSEPT-GNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P  S+ EP      +  A E  + A  LK +GN+ F  K ++ A+K Y  A+EL   + V
Sbjct: 75  PVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPV 133

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S    ++ V  +  A+ I P YS+   R   A   LG   +AM     VL
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVL 192

Query: 192 DIEGD 196
            + GD
Sbjct: 193 SLNGD 197

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 53/104 (50%)

Query: 91  EVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAV 150
           E A++A   K +GN     K +  AV+ Y++AIEL    ++F+ NRA +      F  A+
Sbjct: 7   EAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTAL 66

Query: 151 RDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIE 194
            D   ++ ++P   +   R GL+   L +  +A +  K +L ++
Sbjct: 67  EDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVK 110

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 4/117 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E A N K +GN  +  K F  A + Y +AI++  +    N   Y NRAA    
Sbjct: 65  AYEGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELE 124

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            K +   + D + A+ +NP   + Y R+  A  A+ K ++  EA +  L  + +N +
Sbjct: 125 LKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 3/125 (2%)

Query: 73  PTLSSSEPTGNNTDAHAPEVAERAEN-LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131
           P     EP  +N    + E  E     LK +GN+ F  KD++ A+K Y  A+ L   + V
Sbjct: 82  PVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPV 140

Query: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           FY N +A Y S  + ++ V ++  A+ + P YS+   R   A  +L    +AM     VL
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDL-SVL 199

Query: 192 DIEGD 196
            + GD
Sbjct: 200 SLNGD 204

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 91/200 (45%), Gaps = 8/200 (4%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E AEN K +GN  + AK ++ A + Y   I++  +    N   + NRAA    
Sbjct: 69  AYEGEPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELE 128

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAM 202
            K +   V D + A++ N    + Y R+  A   L K E+A +A +  L ++ +N  +A+
Sbjct: 129 LKNYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPEN--QAL 186

Query: 203 KRDYESAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSMXXXXXXXXXNNPQVMQA 262
               ++  KK +++   EA  K  ++QT              +         N P++++ 
Sbjct: 187 NALRQNVDKKKQDADAFEA--KKLKEQTERERLETILEASMILRNFKNVDTANPPELLEE 244

Query: 263 AQKMMQNPSAMQEMMNNPAI 282
           A+  ++N   M+  +  PA+
Sbjct: 245 AKICLENKEDMESQLIFPAM 264

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158
           LK +GN+ F  KD+E A+K Y  A+ ++  + VFY N +A Y S  + ++ +  +  A+ 
Sbjct: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169

Query: 159 INPSYSRGYSRLGLAKYALGKPEEAM 184
           + P YS+   R   A   L    +AM
Sbjct: 170 LKPDYSKALLRRATANEQLENYSDAM 195

>TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {ON}
           Anc_3.395 YPR088C
          Length = 536

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 256 NPQVMQAAQ-KMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPNLGDMMK---DPNIKDMA 311
           +PQ+MQ AQ ++ QNP  M+ MMN            S GG PN+ DMMK   DP +++MA
Sbjct: 472 SPQMMQQAQQRLRQNPGMMENMMNMFGGAGGMPGMGSAGGMPNMNDMMKMMQDPKMQEMA 531

Query: 312 GKF 314
            +F
Sbjct: 532 RQF 534

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E A N K  GN+ +  K +  A + YT+ I++  +    N   Y NRAA    
Sbjct: 65  AYEGEPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELE 124

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            K F + + D + A+  N    + Y R+G A  ++ + +E+ E+ +  L I+ +N +
Sbjct: 125 LKNFRKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKS 181

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E+A  LK EGNK    K +  A + YT+AIE  P N + Y NRA        F+ ++ DA
Sbjct: 11  EKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDA 70

Query: 154 ESAVRINPSYSRGYSRLGLAKYAL 177
           + A+ ++ +  + Y R  ++   L
Sbjct: 71  KRAIELDNNNLKAYHRRAMSYIGL 94

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 3/69 (4%)

Query: 97  ENLKLEGNKAFA---AKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           EN  L  N+AF      +F+ ++     AIEL  NN   Y  RA +Y    +F +A +D 
Sbjct: 45  ENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDL 104

Query: 154 ESAVRINPS 162
              ++  P+
Sbjct: 105 IIVLKFKPN 113

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158
           LK +GN+ F  + +E A+K Y  A++L   + VFY N +A Y S    E+ V  +  A+ 
Sbjct: 102 LKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALE 160

Query: 159 INPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGD 196
           + P YS+   R   A   L    EAM     VL + GD
Sbjct: 161 LKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGD 197

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 2/137 (1%)

Query: 91  EVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAV 150
           E A++A   K +GN     K ++ AV+ Y++AIEL    ++++ NRA +      F  A 
Sbjct: 5   EAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQ 64

Query: 151 RDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAK 210
            D + A+ ++P   +   R GL+   L +  +A +  + VL ++  N   A+K   E  +
Sbjct: 65  EDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVVLQVK-PNEQSALKA-LEVCE 122

Query: 211 KKVEESLNLEALPKGEE 227
           K + E    +A+  G++
Sbjct: 123 KFIREEKFRKAIGGGDD 139

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 66/135 (48%), Gaps = 15/135 (11%)

Query: 101 LEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRIN 160
           + G   +A  DF+  ++ + E++++ PN+ V +    A+ ++  K E+A++    A+ + 
Sbjct: 436 IRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLK 495

Query: 161 PSYSRGYSRLGLAKYALGKPEEAMEAYKKVL---DIEG-------DNATEAMKR-----D 205
           PS+ R    L +A   +G  +EA E    VL    +EG       +N  E +KR     D
Sbjct: 496 PSFVRARYNLAVASMNIGCYKEAGEHLLTVLRMHQVEGVNNVETDNNVLEILKRVLMGMD 555

Query: 206 YESAKKKVEESLNLE 220
            E   +KV   ++L+
Sbjct: 556 REDLLEKVYPGMDLK 570

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 7/90 (7%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESA 156
           E +K +GN AF   +F  A + Y + I L P N + Y NRA A    +KF E +   +  
Sbjct: 5   ETVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRG 64

Query: 157 V-------RINPSYSRGYSRLGLAKYALGK 179
           +       +  P   +   RL LA+ +L K
Sbjct: 65  LGKLEDNEKDEPIRKKLLYRLHLAQESLNK 94

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESA 156
           ++ K EGN+ F   ++  A+K Y + IE+ P N + Y N+A A     K +EAVR  +  
Sbjct: 4   DHFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDG 63

Query: 157 VR 158
           ++
Sbjct: 64  LK 65

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 4/104 (3%)

Query: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPN----NAVFYGNRAAAYSS 142
           A+  E  E A   K +GN+ + AK F+ A + Y + + +       N   + N+AA    
Sbjct: 74  AYEGEPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELE 133

Query: 143 FKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
            K +   + D   A+ INP  ++ Y R   A + L K EEA  A
Sbjct: 134 LKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEAKSA 177

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAV 150
           E AE+LK++GN  F   D+E A+  Y +A  L  +N +++ N A A    ++++EAV
Sbjct: 39  ETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAV 95

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 55/119 (46%), Gaps = 19/119 (15%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +A  DF   +  +  A+++ PN+ + +    AA ++  + EE+++    A+++ PS+ R 
Sbjct: 457 YANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVRA 516

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVL---DIEG----------------DNATEAMKRDY 206
              L ++   +G  +EA+E     L   ++EG                DN  E +KR +
Sbjct: 517 RYNLAVSSMNIGCYKEAVEHLLTALSMHEVEGLRQKDKDSHHYSNYNNDNILETLKRAF 575

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 45/88 (51%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           ++  DF+  ++ +  A+++ PN+ + +    A+ ++  + EEA++    A+ + PS+ R 
Sbjct: 452 YSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRA 511

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVLDIE 194
              L +A   +G  +EA      VL + 
Sbjct: 512 RYNLAVASMNIGCYQEAAGHLLTVLKMH 539

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 38/67 (56%)

Query: 128 NNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAY 187
           N+A F       + S   F++ +   ++A++INP+    ++RLG +     + EEA++AY
Sbjct: 439 NDAEFQLCLGLLHYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAY 498

Query: 188 KKVLDIE 194
            K ++++
Sbjct: 499 HKAINLK 505

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 12/63 (19%)

Query: 256 NPQVMQAAQ-KMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPNLGDMMK---DPNIKDMA 311
           +PQ+MQ AQ ++ QNP  MQ M N            +GGG P++ +MMK   DPN++ MA
Sbjct: 527 SPQMMQQAQQRLRQNPGMMQNMQNMFG--------GAGGGMPDMNEMMKMMQDPNMQKMA 578

Query: 312 GKF 314
            +F
Sbjct: 579 QQF 581

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 57/123 (46%), Gaps = 13/123 (10%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G   +A ++F   +  +  A+E+ PN+ + +    A+ ++  + EEA++    A+ + PS
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKKVLD-------------IEGDNATEAMKRDYESA 209
           + R    L ++   +G  +EA E+    L              ++ +N  E +KR + + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMHEVENVPITGSVVQSNNILETLKRSFVAM 542

Query: 210 KKK 212
            ++
Sbjct: 543 DRR 545

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 48/115 (41%), Gaps = 30/115 (26%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIEL-----------------MPNNAV-------------F 132
           G   F ++DF  A + +T+AIEL                 +P   V              
Sbjct: 14  GTTYFKSEDFFKASQLFTKAIELARSYSDEELENLRLKSGLPKRCVNGQGKPWHPKYIKL 73

Query: 133 YGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAY 187
             NRAA++    K ++A++DA++ +R+ P   + Y R G     L K +EA   Y
Sbjct: 74  LDNRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESA 156
           E LK +GN +F    +  A+  Y   I + P+N + Y N+A A     +F+EA+   E  
Sbjct: 4   EELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKG 63

Query: 157 VRI 159
           +++
Sbjct: 64  LQL 66

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 32/61 (52%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESA 156
           E LK +GN  +  +D+ GA++ Y + +E    N + + NRA       + +EA +  ++ 
Sbjct: 5   ERLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAG 64

Query: 157 V 157
           +
Sbjct: 65  L 65

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN     KD E A+K + +A ++ PN A  Y  +   +SS   F+ A      A+  +P 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
           +   Y  LG++   LG+ +EA+  ++K   I   N 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV 637

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +A  +F+  +  +  A+++ PN+ + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 435 YANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRA 494

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVL---DIEGDNATEAMKRDYESAKKK 212
              L ++   +G  +EA E     L   D+EG+   ++ + +  S+  K
Sbjct: 495 RYNLAVSSMNIGCYKEAAEHLLTALSMHDVEGEFEVQSTRSNSISSADK 543

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E  + LK +GN  F   D+E AV  Y +AI   P+N + Y N A      +K+ EAV   
Sbjct: 2   EDFDTLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDAC 61

Query: 154 ESAVRI 159
              +++
Sbjct: 62  NKGLKM 67

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A + + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 301 DYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPYISEVWYDL 360

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDNA 198
           G L +    +  +A++AYK+   +E DN 
Sbjct: 361 GTLYETCNNQLTDALDAYKQAARLEPDNT 389

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 8/129 (6%)

Query: 71  SEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNA 130
           S+ ++ SSE   +N     P + E    L   GN     K+   A+K + +A ++ P  A
Sbjct: 511 SKLSILSSELITSN-----PRIPETWCCL---GNFLSLQKNHHEAIKAFEKATQVDPKFA 562

Query: 131 VFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKV 190
             Y  +   Y+S   F+ A R    A+  +P +   Y  LG+    LG+ EEA+  ++K 
Sbjct: 563 YAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKA 622

Query: 191 LDIEGDNAT 199
             I   N  
Sbjct: 623 RSINPINVV 631

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 47/115 (40%), Gaps = 30/115 (26%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIEL------------------------------MPNNAVF 132
           G + F  +D++GA + ++++++L                               P   V 
Sbjct: 13  GIQCFQGEDYKGAAELFSKSLQLARSYTDRSLEGIREKVGLPKRCLHDPSRVYHPRFFVL 72

Query: 133 YGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAY 187
             NRAA +    K + A+ DA   + ++    +GY R G     LG+ EEA++ Y
Sbjct: 73  LDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQVY 127

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G    A KDF  A +   +A+     N +F+ +    Y    +  +A+     A+R+NP 
Sbjct: 421 GRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPY 480

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDN 197
            S  +  LG L +    +  +A+++Y++ L ++ +N
Sbjct: 481 ISEVWYNLGTLYETCNDQITDALDSYERALSLDPEN 516

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/121 (19%), Positives = 56/121 (46%), Gaps = 15/121 (12%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +A  +F+  +  +  A+ + PN+   +    A+ ++  + EEA++    A+++ P++ R 
Sbjct: 432 YANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVRA 491

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVL---DIEG------------DNATEAMKRDYESAKK 211
              L ++   +G  +EA E     L   ++EG             N  E +KR + + ++
Sbjct: 492 RYNLAVSSMNIGCYKEAAEQLLTALSMHEVEGVVMSAGSGTVPSSNILETLKRAFMALER 551

Query: 212 K 212
           +
Sbjct: 552 R 552

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 44/88 (50%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +   DF+  +  +  A+++ PN+ + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 468 YTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRA 527

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVLDIE 194
              L ++   +G  +EA      VL + 
Sbjct: 528 RYNLAVSSMNIGCLKEAAGYLLSVLSMH 555

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 44/88 (50%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +   DF+  +  +  A+++ PN+ + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 468 YTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRA 527

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVLDIE 194
              L ++   +G  +EA      VL + 
Sbjct: 528 RYNLAVSSMNIGCYKEAAGYLLTVLSMH 555

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           + E     GN     KD + A+K + +A +L PN A  Y  +   +SS    + A     
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 603

Query: 155 SAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            A+  +P +   Y  LG +   LG+ EEA+  ++K   I   N  
Sbjct: 604 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 648

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           + E     GN     KD + A+K + +A +L PN A  Y  +   +SS    + A     
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 591

Query: 155 SAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            A+  +P +   Y  LG +   LG+ EEA+  ++K   I   N  
Sbjct: 592 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 636

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 44/88 (50%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +   DF+  +  +  A+++ PN+ + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 469 YTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRA 528

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVLDIE 194
              L ++   +G  +EA      VL + 
Sbjct: 529 RYNLAVSSMNIGCFKEAAGYLLSVLSMH 556

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           + E     GN     KD + A+K + +A +L PN A  Y  +   +SS    + A     
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 598

Query: 155 SAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            A+  +P +   Y  LG +   LG+ EEA+  ++K   I   N  
Sbjct: 599 KALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVV 643

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 10/129 (7%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 320 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 379

Query: 171 GLAKYALGKP-EEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQ 229
           G       K   +A++AYK+   ++ DN    ++   ES  ++++        P   +QQ
Sbjct: 380 GTLYETCNKQLNDALDAYKQAARLDPDNV--HIRERLESLAQQLQN-------PNNAQQQ 430

Query: 230 TSEGSSAGG 238
             +   A G
Sbjct: 431 AGQHPGAPG 439

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 49/116 (42%), Gaps = 13/116 (11%)

Query: 89  APEVAERAENLKLEGNKAFAA--------KDFEGAVKKYTEAIELM--PNNAVFYGNRAA 138
           A E+ ERA ++  E +  +A          D + A   Y +A+  +  PN    +     
Sbjct: 108 AAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNSYQQALYYLSNPNVPKLWHGIGI 167

Query: 139 AYSSFKKFEEAVRDAESAVRINPSYSRG---YSRLGLAKYALGKPEEAMEAYKKVL 191
            Y  +   E A       + ++P++ +    Y RLG+     GK  +A+E ++ +L
Sbjct: 168 LYDRYGSLEYAEEAFAKVLELDPNFDKANEIYFRLGIIYKHQGKWTQALECFRYIL 223

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN     +D + A+K   +A  L P  A  Y  +   YS+   F+ A      A+ INP+
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
           +   +  LG++   LG+ +EA+  ++K   I   N 
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 540

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 50/104 (48%)

Query: 101 LEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRIN 160
           L+G++      F+ A   Y +A+ + PN+   +     +     +++EA+   E A  IN
Sbjct: 477 LQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSIN 536

Query: 161 PSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKR 204
           P         G+A   LG+ E+A++ Y+   +++ +++    K+
Sbjct: 537 PVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 54/118 (45%), Gaps = 3/118 (2%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 297 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 356

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNL 219
            S  +  LG L +    +  +A++AYK+   ++ +N    ++   E+  K++E   N+
Sbjct: 357 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNI 412

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D + A   Y   ++  P++A    + A  Y S   F+ A    E A+ +NP  S  ++ L
Sbjct: 55  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 114

Query: 171 GLAKYALGKPEEAMEAYKKVL 191
           G     L   + A  AY++ L
Sbjct: 115 GHCYLMLDDLQRAYNAYQQAL 135

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 54/118 (45%), Gaps = 3/118 (2%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 305 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNL 219
            S  +  LG L +    +  +A++AYK+   ++ +N    ++   E+  K++E   N+
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNM 420

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D + A   Y   ++  P++A    + A  Y S   F+ A    E A+ +NP  S  ++ L
Sbjct: 63  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 122

Query: 171 GLAKYALGKPEEAMEAYKKVL 191
           G     L   + A  AY++ L
Sbjct: 123 GHCYLMLDDLQRAYNAYQQAL 143

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/112 (20%), Positives = 52/112 (46%), Gaps = 3/112 (2%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 372

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKV 213
            S  +  LG L +    +  +A++AYK+   ++ +N    +++  ES  +++
Sbjct: 373 ISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENV--HIRKRLESLTQQL 422

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 43/88 (48%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +   DF+  +  +  A+ + PN+ + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 468 YTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRA 527

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVLDIE 194
              L ++   +G  +EA      VL + 
Sbjct: 528 RYNLAVSSMNIGCFKEAAGYLLSVLSMH 555

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 311 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 370

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNL 219
           G L +    +  +A++AYK+   ++ +N    ++   E+  K++E   N+
Sbjct: 371 GTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNI 418

 Score = 33.1 bits (74), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D + A   Y   ++  P++A    + A  Y S   F+ A    E A+ +NP  S  ++ L
Sbjct: 61  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 120

Query: 171 GLAKYALGKPEEAMEAYKKVL 191
           G     L   + A  AY++ L
Sbjct: 121 GHCYLMLDDLQRAYNAYQQAL 141

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 64/137 (46%), Gaps = 21/137 (15%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +A  +F+  +  +  A+ + PN+ + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 407 YADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVRA 466

Query: 167 YSRLGLAKYALGKPEEAME---AYKKVLDIEG-------------DNATEAMKR-----D 205
              L ++   +G  +EA E   +  K+ ++EG             +N  E +KR     D
Sbjct: 467 RYNLAVSSINIGCYKEAAEYLLSALKMHEVEGVSQNGTANPVSGNNNILETLKRAFVAMD 526

Query: 206 YESAKKKVEESLNLEAL 222
                +KV+  ++LE  
Sbjct: 527 RRDLLEKVQPGMDLEQF 543

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 15/121 (12%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +A +DF+  +  +  A+ + P++   +    A+ ++  + EEA++    A+++ P++ R 
Sbjct: 428 YANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRA 487

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVL---DIEG------------DNATEAMKRDYESAKK 211
              L ++   +G   EA E     L   ++EG             N  E +KR + +  +
Sbjct: 488 RYNLAVSSMNIGCYREAAEHLLTALSMHEVEGVAMAPGSGNVPSSNILETLKRAFIAMDR 547

Query: 212 K 212
           +
Sbjct: 548 R 548

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%)

Query: 100 KLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAV 157
           K EGN+ F   D+  A K Y   I   P N + Y N+A +    + F++A+R   + +
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 44/102 (43%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESA 156
           E     GN     KD E ++K +  + +L P+    Y  +   YSS   F+ A+     A
Sbjct: 410 ETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKA 469

Query: 157 VRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
           +  NP +   +  LG+    LG+ EE +  ++K   I   N 
Sbjct: 470 LGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNV 511

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 58/120 (48%), Gaps = 14/120 (11%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +A +D++  +  +  A+ + P++ + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 433 YANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRA 492

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVL---DIEG-----------DNATEAMKRDYESAKKK 212
              L ++   +G  +EA E     L   ++EG            N  E +KR + + +++
Sbjct: 493 RYNLAVSSMNIGCYKEAAEYLLTALSMHEVEGVPVASGGSIPSTNILETLKRAFIAMERR 552

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESA 156
           E  K  GN  F   ++  AV+ Y + IE+ P N + Y N A +     K+ EA+    + 
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 157 VR-INPSYSRGYSRLGLAKYALGKPE 181
           ++ +N + S+ Y +L   +Y L   E
Sbjct: 64  LKYVNDADSQVYKKLQY-RYNLADTE 88

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN+ F   +++ A+++Y + I L P NAV Y N A AY   +  +E    A++A  +  S
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDE----AKTACEMGLS 97

Query: 163 YSR 165
           Y +
Sbjct: 98  YCK 100

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 318 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 377

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDN 197
            S  +  LG L +    +  +A++AYK+   ++ +N
Sbjct: 378 ISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPEN 413

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 52/113 (46%), Gaps = 3/113 (2%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 307 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 366

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVE 214
            S  +  LG L +    +  +A++AYK+   ++ +N    ++   E+  K++E
Sbjct: 367 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNI--HIRERLEALTKQLE 417

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D + A   Y   ++  P++A    + A  Y S   F+ A    E A+ +NP  S  ++ L
Sbjct: 65  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 124

Query: 171 GLAKYALGKPEEAMEAYKKVL 191
           G     L   + A  AY++ L
Sbjct: 125 GHCYLMLDDLQRAYNAYQQAL 145

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN     +D + A+K   +A  L P  A  Y  +   YS+   F+ A      A+ INP+
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
           +   +  LG++   LG+ +EA+  ++K   I   N 
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 559

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 50/104 (48%)

Query: 101 LEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRIN 160
           L+G++      F+ A   Y +A+ + PN+   +     +     +++EA+   E A  IN
Sbjct: 496 LQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSIN 555

Query: 161 PSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKR 204
           P         G+A   LG+ E+A++ Y+   +++ +++    K+
Sbjct: 556 PVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/118 (19%), Positives = 57/118 (48%), Gaps = 12/118 (10%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           ++  D++  V  +  A+ + P++ + +    A+ ++  + EEA++    A+++ P++ R 
Sbjct: 437 YSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRA 496

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVL---DIEG---------DNATEAMKRDYESAKKK 212
              L ++   +G  +EA E     L   ++EG         +N  E +KR +   +++
Sbjct: 497 RCNLAVSCMNMGCYKEAAEYLLTALSMHEVEGILPSETPASNNLIETLKRAFIGMERR 554

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 41/88 (46%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +   D++  +  +  A+ + PN+ + +    A+ ++  + EEAV     A+ + PS+ R 
Sbjct: 504 YTTADYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVRA 563

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVLDIE 194
              L ++   +G  +EA E     L + 
Sbjct: 564 RYNLAVSSINIGCFKEAAEHLLTALSMH 591

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 319 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 378

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDN 197
           G L +    +  +A++AY++   ++ DN
Sbjct: 379 GTLYETCNNQLTDALDAYRQASRLDPDN 406

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 6/88 (6%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESA 156
           E  K +GN  F    +  AV  Y + I   P N V Y N+A A     ++ +A++  +  
Sbjct: 5   EKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQG 64

Query: 157 VRINPS------YSRGYSRLGLAKYALG 178
           +R   +       S+   RL LA+ A+G
Sbjct: 65  LRYTSTAEHVAIRSKLQYRLELAQGAVG 92

>YCR014C Chr3 complement(139185..140933) [1749 bp, 582 aa] {ON}
           POL4DNA polymerase IV, undergoes pair-wise interactions
           with Dnl4p-Lif1p and Rad27p to mediate repair of DNA
           double-strand breaks by non-homologous end joining
           (NHEJ); homologous to mammalian DNA polymerase beta
          Length = 582

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 3/100 (3%)

Query: 84  NTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIEL-MPNNAVFYGNRAAAYSS 142
           N      E+A+R   L  E     A KD E  V  +T        ++ +   +R   ++ 
Sbjct: 276 NCYGIGSEIAKRWNLLNFESFCVAAKKDPEEFVSDWTILFGWSYYDDWLCKMSRNECFTH 335

Query: 143 FKKFEEAVR--DAESAVRINPSYSRGYSRLGLAKYALGKP 180
            KK ++A+R  D E  V +  SY+RGYS+ G       KP
Sbjct: 336 LKKVQKALRGIDPECQVELQGSYNRGYSKCGDIDLLFFKP 375

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 322 GRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 381

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDN 197
            S  +  LG L +    +  +A++AYK+   ++ +N
Sbjct: 382 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPEN 417

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D + A   Y   ++  P++     + A  Y S   F+ A    E A+++NP  S  ++ L
Sbjct: 80  DADRAALAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYERALQVNPELSDVWATL 139

Query: 171 GLAKYALGKPEEAMEAYKKVL 191
           G     L   + A  AY++ L
Sbjct: 140 GHCYLMLDDLQRAYNAYQQAL 160

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%)

Query: 127 PNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
           P     Y N +A Y   ++ ++A   +   + I P   +GY R+G      GK  EA + 
Sbjct: 68  PKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKC 127

Query: 187 YKK 189
           YKK
Sbjct: 128 YKK 130

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 319 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 378

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDN 197
           G L +    +  +A++AYK+   ++ +N
Sbjct: 379 GTLYETCNNQLTDALDAYKQAARLDPEN 406

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN     KD E ++K +  + +L P+    Y  +   YSS   F+ A+     A+  N  
Sbjct: 417 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQ 476

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKKVLDI 193
           +   Y  LG+    LG+ EE +  ++K   I
Sbjct: 477 HYNAYYGLGMCSLKLGQYEECLLHFEKARSI 507

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 39/88 (44%)

Query: 112 FEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLG 171
           +E  +  + +A  + P N +       A       E A+++ + A  + P  S    +  
Sbjct: 494 YEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPMSSLALFKRA 553

Query: 172 LAKYALGKPEEAMEAYKKVLDIEGDNAT 199
               A+GK   A+E+++K++ I  D AT
Sbjct: 554 QLLLAMGKYNYALESFEKLVKIAPDEAT 581

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 313 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 372

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDN 197
           G L +    +  +A++AYK+   ++ +N
Sbjct: 373 GTLYETCNNQLSDALDAYKQAARLDPEN 400

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%)

Query: 137 AAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
           A  Y S   F++A    E A+++NP  S  ++ LG     L   + A  AY++ L
Sbjct: 89  AHLYRSRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 143

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 291 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 350

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDN 197
           G L +    +  +A++AYK+   ++ +N
Sbjct: 351 GTLYETCNNQLTDALDAYKQAARLDPEN 378

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 55/142 (38%), Gaps = 16/142 (11%)

Query: 127 PNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
           P       NRAA +      ++A++DA  A R  P   + Y R G     L    +A+E 
Sbjct: 68  PRLVKLLDNRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALEN 127

Query: 187 YKKVLDIEGDNATEAMKRDYE-SAKKKVEESLNLEALPKGEEQQTSEGSSAGGFPDLSSM 245
           Y+     EG  A   M R Y     KK+ E+L        E Q+        G P  +S+
Sbjct: 128 YE-----EGVKAIRDMTRKYHLDPPKKLYEAL--------EYQKNLVSRRLKG-PK-TSV 172

Query: 246 XXXXXXXXXNNPQVMQAAQKMM 267
                      PQVMQ  +K M
Sbjct: 173 ASKSERKRTLLPQVMQPTEKKM 194

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 41/77 (53%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           ++  +F+  +  +  A+++ PN+ + +    A+ ++  + EEA++    A+ + PS+ R 
Sbjct: 461 YSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVRA 520

Query: 167 YSRLGLAKYALGKPEEA 183
              L ++   +G  +EA
Sbjct: 521 RYNLAVSSINIGCYKEA 537

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 37/64 (57%), Gaps = 8/64 (12%)

Query: 131 VFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKV 190
           +FY N         +F++ +   ++A++++P+    ++RLG +     + EEA++AY K 
Sbjct: 459 LFYSN--------NEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKA 510

Query: 191 LDIE 194
           L+++
Sbjct: 511 LNLK 514

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N  F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 327 DYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 386

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDN 197
           G L +    +  +A++AYK+ + ++ +N
Sbjct: 387 GTLYETCNNQLSDALDAYKQAVRLDPNN 414

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 300 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 359

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDN 197
           G L +    +  +A++AYK+   ++ +N
Sbjct: 360 GTLYETCNNQLTDALDAYKQAARLDPEN 387

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 5/82 (6%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESA 156
           E  K EGN+ F    ++ A + Y + +++ P N + Y N+A A     ++ E V      
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKG 63

Query: 157 VRINPS-----YSRGYSRLGLA 173
           +   P+     Y +   RL +A
Sbjct: 64  LTFTPNTTDTVYKKLNYRLEMA 85

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 47/108 (43%)

Query: 91  EVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAV 150
           E  ++ E     GN     KD + A++ + +A +L PN    Y  +   Y S   ++ A 
Sbjct: 585 EFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAK 644

Query: 151 RDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
                A+  +  +   Y  +G+    LG+ E+A+  ++K   I   NA
Sbjct: 645 TFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNA 692

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 4/106 (3%)

Query: 101 LEGNKAFAAKDFEGAVKKYTEAI--ELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158
           L+G++  +   ++ A   Y +AI  +L   NA +YG    +     ++E+A+   E A  
Sbjct: 629 LQGHEYLSMDSYDTAKTFYRKAISNDLHHYNA-YYGMGMCS-MKLGEYEQALVYFEKARS 686

Query: 159 INPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKR 204
           INPS +      G+    LG  E+A+  Y+    I+  ++    KR
Sbjct: 687 INPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKFKR 732

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 97  ENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEA 149
           E  K++GN A+   +F  AV  Y +AI   P N V Y N A A      + +A
Sbjct: 5   EEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N  F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 373 DYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPYISEVWYDL 432

Query: 171 G-LAKYALGKPEEAMEAYKKVLDIEGDNA 198
           G L +    +  +A++AYK+   ++ +N 
Sbjct: 433 GTLYETCNNQVNDALDAYKQAARLDPNNV 461

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 43/96 (44%), Gaps = 1/96 (1%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   + +A+     N  F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 315 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 374

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDN 197
            S  +  LG L +    +  +A++AYK+   ++ +N
Sbjct: 375 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPNN 410

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN     KD + A+  + +AI+L P  A  Y  +   YS+   F+ A      A+ I  +
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKK 189
           +      LG+    LGK EEA+  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 113 EGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGL 172
           E A+  Y  A EL PN+++    ++    +  ++  A+ + E    + P  +  +  LG 
Sbjct: 611 ERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLESLTPDEAHVHFLLGN 670

Query: 173 AKYALGKPEEAMEAYKKVLDIEGDNAT---EAMKRDYE 207
               +GK ++AM  Y   ++++   +    EAM++ +E
Sbjct: 671 LYQIVGKKQDAMNQYTIAMNLDPKGSQLIKEAMEKCHE 708

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 23/118 (19%), Positives = 56/118 (47%), Gaps = 12/118 (10%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           ++  D++  V  +  A+ + P++ + +    A+ ++  + EEA++    A+++ P++ R 
Sbjct: 430 YSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRA 489

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVL---DIEG---------DNATEAMKRDYESAKKK 212
              L ++   +G  +EA E     L   ++EG          N  E +KR +   +++
Sbjct: 490 RCNLAVSCMNMGCFKEAAEYLLTALSMHEVEGILPSETPASSNLIETLKRAFIGMERR 547

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   +  A+     N  F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 323 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 382

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDN 197
            S  +  LG L +    +  +A++AYK+   ++ +N
Sbjct: 383 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNN 418

>Smik_3.99 Chr3 complement(139083..140828) [1746 bp, 581 aa] {ON}
           YCR014C (REAL)
          Length = 581

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 45/110 (40%), Gaps = 23/110 (20%)

Query: 84  NTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYG--------- 134
           N     PE+A+R   L  E         F  A KK  E  E + + +V +G         
Sbjct: 276 NCYGIGPEIAKRWNLLNFES--------FYIAAKKNPE--EFISDWSVLFGWSYYDDWVH 325

Query: 135 --NRAAAYSSFKKFEEAVR--DAESAVRINPSYSRGYSRLGLAKYALGKP 180
             +R   ++  KK +  +R  D E  V +  SY+RGYS+ G       KP
Sbjct: 326 KMSRNECFAHLKKVQNTLREIDPECKVELQGSYNRGYSKCGDIDLLFFKP 375

>ZYRO0F16544g Chr6 (1360946..1364032) [3087 bp, 1028 aa] {ON}
           similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 52/138 (37%), Gaps = 9/138 (6%)

Query: 67  KSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELM 126
           K G  +P     +P         PEVA+    L  E N+AF   D + A + Y E I+  
Sbjct: 99  KDGKPKP-----QPRARRNHVMEPEVAQ----LLSEANEAFVRSDLQVAERVYNEVIKKD 149

Query: 127 PNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
             N V Y      Y    +  +       A  +N S    +  + +    LG   +A+  
Sbjct: 150 AKNFVAYETLGDIYQLQGRLNDCCNSWFLAAHLNSSDWEFWKIVAVLSADLGHIRQAIYC 209

Query: 187 YKKVLDIEGDNATEAMKR 204
           Y +V++I  +      +R
Sbjct: 210 YSRVININHEEWECIYRR 227

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 43/96 (44%), Gaps = 1/96 (1%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   + +A+     N  F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 385 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 444

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDN 197
            S  +  LG L +    +  +A++AYK+   ++ +N
Sbjct: 445 ISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPNN 480

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           G       D+  A   +  A+     N  F+ +    Y    ++ +A+     A+R+NP 
Sbjct: 319 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 163 YSRGYSRLG-LAKYALGKPEEAMEAYKKVLDIEGDN 197
            S  +  LG L +    +  +A++AYK+   ++ +N
Sbjct: 379 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNN 414

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           D+  A   + +A+     N +F+ +    Y    ++ +A+     A+R+NP  S  +  L
Sbjct: 328 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 387

Query: 171 G-LAKYALGKPEEAMEAYKK 189
           G L +    +  +A++AYK+
Sbjct: 388 GTLYETCNNQLSDALDAYKQ 407

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 135 NRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIE 194
           NRAA +    + E+A+RDA     I P   + + R G     L K ++A   YK  L   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 195 GDNATEAMK 203
            + AT+++K
Sbjct: 158 ANFATDSLK 166

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           + E     GN     KD + A+K + +A +L PN A  Y  +   +SS    + A     
Sbjct: 550 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 609

Query: 155 SAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
            A+  +  +   Y  LG +   LG+ EEA+  ++K   I   N  
Sbjct: 610 KALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 654

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%)

Query: 93  AERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRD 152
           A  +++L+ +GN  ++  ++E AV  Y  A    P+N V   N + A    +++E+A+  
Sbjct: 5   ARNSDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSA 64

Query: 153 AESAVRI 159
            + A+ I
Sbjct: 65  CDRALEI 71

>KNAG0B01290 Chr2 (244938..246551) [1614 bp, 537 aa] {ON} Anc_3.395
           YPR088C gene spans a gap in the genome sequence
          Length = 537

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 9/63 (14%)

Query: 256 NPQVMQAAQ-KMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPNLGDMMK---DPNIKDMA 311
           +PQ+MQ AQ ++ QNP  M+ MM+              GG PN+ DMMK   DP ++ MA
Sbjct: 474 SPQMMQQAQQRLKQNPGMMKNMMD-----MFGGANGGAGGMPNMNDMMKMMQDPKMQQMA 528

Query: 312 GKF 314
            +F
Sbjct: 529 QQF 531

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/79 (20%), Positives = 41/79 (51%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           ++  +F+  +  +  A+ + P + + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 442 YSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVRA 501

Query: 167 YSRLGLAKYALGKPEEAME 185
              L ++   +G  +EA E
Sbjct: 502 RYNLAVSSINIGCYKEAAE 520

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 131 VFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKV 190
           +FY N         +F++ +   ++A+ I+P     ++RLG +     +PEEA++AY K 
Sbjct: 440 LFYSN--------NEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKA 491

Query: 191 LDIE 194
           L ++
Sbjct: 492 LQLK 495

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 82/194 (42%), Gaps = 35/194 (18%)

Query: 21  KDVQEEYVDSLNVAIDCI-AEA-FEIEREDSNE-IVSKAYNGRGLVDLVKSGASEPTLSS 77
           K++++E  ++LN+  D I +EA  E E  D NE +V + Y         K+   E   S 
Sbjct: 194 KELEKEVSENLNINDDEIESEAVIETEMNDMNEEVVEEKY---------KNAFQEAWDSI 244

Query: 78  SE------PTGNNTDAHAPEVAERAEN-LKLEGNKAFA-AKDFEGAVKKYTEAIELMPNN 129
           S+      P G N DA   E      + L   G+ +FA   +F      Y     LM N 
Sbjct: 245 SKDAEDLLPDGLNPDAWETEHQHYFHSKLNQTGDYSFAKTNEFLHNPNAYEIGCMLMENG 304

Query: 130 AVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKK 189
           A              K  EA    E+A++ +PS+   + +LGL +    K    + A +K
Sbjct: 305 A--------------KLSEAALSFEAALQDDPSHVDAWLKLGLVQIQNEKEIHGISALEK 350

Query: 190 VLDIEGDNATEAMK 203
            L ++  N  +AMK
Sbjct: 351 CLQLDPKN-LDAMK 363

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN     +D + A++ + +A E+ P+ A  Y  +   +SS    + A      A+  +P 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
           +   Y  LG+    LG+ EEA+  ++K   I   N 
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV 611

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 35/77 (45%)

Query: 95  RAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAE 154
           R+E++++     +   D         E +E  P+    + +    YS  +  +EA+R  E
Sbjct: 474 RSEDIEVFSTLLWHIHDKINLSHLSNELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFE 533

Query: 155 SAVRINPSYSRGYSRLG 171
            A  ++P ++ GY+  G
Sbjct: 534 KATEVDPHFAYGYTLQG 550

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 2/70 (2%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR--IN 160
           GN  F    +  AV  Y + I   P N V Y N+A A     ++  A++  +  +R  + 
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALG 74

Query: 161 PSYSRGYSRL 170
           P ++   S+L
Sbjct: 75  PEHAAIRSKL 84

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/120 (17%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 107 FAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRG 166
           +    F+  +  +  A+ +  N+ + +    A+ ++  + EEA++    A+++ PS+ R 
Sbjct: 437 YVDDQFDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVRA 496

Query: 167 YSRLGLAKYALGKPEEAMEAYKKVLD--------------IEGDNATEAMKRDYESAKKK 212
              L ++   +G  +EA E     L               ++ +N  E +KR + +  ++
Sbjct: 497 RYNLAVSSINIGCYKEAAEHLLTALSMHEVSGGATNPSMTVDSNNILETLKRAFVAMDRR 556

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 41/96 (42%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN     KD + A+K + +A +L P     Y  +   YSS   F+ A      A+  N  
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
           +      LG+    LG+ EE++  ++K   I   N 
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNV 516

>KLTH0F02508g Chr6 complement(214785..217952) [3168 bp, 1055 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1055

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 4/108 (3%)

Query: 90  PEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEA 149
           PEVA+    L  E N+AF   D + A   Y E I+    N   Y      Y    +F + 
Sbjct: 150 PEVAQ----LLSEANEAFVRNDIQVAEHLYNEVIKKDVKNFAAYKTLGDIYQLQGRFNDC 205

Query: 150 VRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
                 A  +NPS    +  +      LG   +A+  Y + L +  D+
Sbjct: 206 CNSWFLAAHLNPSDWEFWKVVATLSSDLGHIRQAIYCYTRALRMNSDD 253

>TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3.32
           YNL313C
          Length = 914

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 115 AVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYS-RGYSRLGLA 173
           A + ++  + L   NA+ + N +AAY +  K +EA      A R +   + R +    + 
Sbjct: 665 AAEAFSRCVSLDDTNAMAWSNLSAAYVNQGKLKEAFSCLNRATRTDSQKNWRIWENYMIV 724

Query: 174 KYALGKPEEAMEAYKKVLDIEGDNATE 200
            + L + +E + + KK++DI  D A E
Sbjct: 725 AFKLREWDEVLLSCKKLIDINKDRAGE 751

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 98  NLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRA 137
           +LK EGN  F   D+  A   Y + I+L P N + Y N+A
Sbjct: 5   DLKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKA 44

>CAGL0K07986g Chr11 complement(792641..794239) [1599 bp, 532 aa]
           {ON} highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088c
          Length = 532

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 43/93 (46%), Gaps = 6/93 (6%)

Query: 228 QQTSEGSSAGGFPDLSSMXXXXXX--XXXNNPQVMQAAQ-KMMQNPSAMQEMMNNPAIKQ 284
           Q    G   GG P + +M             PQ+MQ AQ K+ QNP  M+ MMN      
Sbjct: 436 QNAKMGKQGGGMPGMPNMTGMPNMPGMPKMTPQLMQQAQQKLRQNPGLMKNMMNMFGGAG 495

Query: 285 MAQNFASGGGTPNLGDMMK---DPNIKDMAGKF 314
                   GG P++ +MMK   DP ++DMA +F
Sbjct: 496 GMGGMGGPGGMPDMNEMMKMMQDPQMQDMARQF 528

>Kpol_2000.60 s2000 (119866..122967) [3102 bp, 1033 aa] {ON}
           (119866..122967) [3102 nt, 1034 aa]
          Length = 1033

 Score = 34.3 bits (77), Expect = 0.43,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 48/115 (41%), Gaps = 5/115 (4%)

Query: 90  PEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEA 149
           PEVA+    L  E N+AF   D   A + + E I+  P N   Y      Y    +  + 
Sbjct: 115 PEVAQ----LISEANEAFVRNDLVVAERLFNEIIKKDPRNFAAYETLGDIYQIQGRLNDC 170

Query: 150 VRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKR 204
                 A  +N S    +  +      LG   +A+  Y +V++I  D+ TEA+ R
Sbjct: 171 CNSWFIAAHLNSSDWEFWRVVAALSADLGHARQAIYCYSRVINIHHDD-TEAVYR 224

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 127 PNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEA 186
           P   +   NRAA++       +A+ DA+  ++++    +GY R G     + + +EA+  
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 187 YKKVLDIEGDNATEAMKRDYESAKKKVEE 215
           Y++ L      A EA +  +E    K  E
Sbjct: 127 YREGL----SKAKEAYQLHFEKPPSKFVE 151

>NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa]
           {ON} Anc_3.395 YPR088C
          Length = 539

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 256 NPQVMQAAQ-KMMQNPSAMQEMMNNPAIKQMAQNFASGGGTPNLGDMMK---DPNIKDMA 311
            PQ+MQ AQ K+ QNP+ M+ MMN              GG P++ +MMK   DP +++MA
Sbjct: 472 TPQLMQQAQQKLSQNPNLMKNMMNMFGGAGGMPGMGGAGGMPDMNEMMKMMQDPGMQEMA 531

Query: 312 GKF 314
            +F
Sbjct: 532 KQF 534

>Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa]
           {ON} YGR047C (TFC4) - transcription factor tau (TFIIIC)
           subunit 131 [contig 117] FULL
          Length = 1052

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 41/102 (40%), Gaps = 4/102 (3%)

Query: 90  PEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEA 149
           PEVA+    L  E N+AF   D + A + Y E I+    N   Y      Y   ++F + 
Sbjct: 149 PEVAQ----LLSEANEAFVRNDIQVAEQLYNEVIKKDVKNFAAYKTLGDIYQLQQRFNDC 204

Query: 150 VRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVL 191
                 A  +NPS    +  +      LG   +++  Y + L
Sbjct: 205 CNSWFLAAHLNPSDWEFWKVVATLSADLGHIRQSIYCYTRAL 246

>Kpol_520.6 s520 (15903..16781) [879 bp, 292 aa] {ON} (15903..16781)
           [879 nt, 293 aa]
          Length = 292

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 60/150 (40%), Gaps = 19/150 (12%)

Query: 57  YNGRGLVDLV---KSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFE 113
           YN   L  L+   K  + E T SS E   + +     +    AE     GN  F    F+
Sbjct: 117 YNTDSLSYLLLQKKLLSMELTTSSQEIVLDKSLKLVEKFPLDAELWWFIGNLYFKLGQFD 176

Query: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKK---------------FEEAVRDAESAVR 158
            A   Y E + L P N V +  R +    +K                 +E++ +A  ++ 
Sbjct: 177 QAKHCYEEVVLLQPFNYVAFV-RISEILYYKVIRLNKKISKSERTQILQESLNNALRSIE 235

Query: 159 INPSYSRGYSRLGLAKYALGKPEEAMEAYK 188
           +N  + +G+S + +   A+G  ++ +E  K
Sbjct: 236 LNEMFLKGWSLIAIVSKAMGTKKDILEVSK 265

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPS 162
           GN     +D E A+K + +A ++  N A  Y  +   +SS    + A      A+  +P 
Sbjct: 489 GNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRALACDPQ 548

Query: 163 YSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNA 198
           +   Y  LG+    LG+ ++A+  ++K  +I   N 
Sbjct: 549 HYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV 584

>KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 389

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMP-----------NNAVF-------YGN 135
           E AE +K  G+  F  +DF  A+ KY +A++              +N  F       Y N
Sbjct: 234 EAAETIKESGSLLFKKRDFRNALFKYKKALKYTTAYTPEVDIDKFHNEKFTIQKHKLYLN 293

Query: 136 RAAAYSSFKKFEEAVRDAESAV---RI-NPSYSRGYSRLGLAKYALGKPEEAMEAYK 188
                   K++ E+++ +   V   R+ N   ++ Y R G   YAL + E A+  YK
Sbjct: 294 ICLMLFYLKEYHESIKYSTFLVDDDRVGNKDKAKAYLRRGNCLYALNRFEAALTDYK 350

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 29/44 (65%)

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDN 197
           +SA+R++P+    +  LG A  A G+ E +M+ ++K ++++G +
Sbjct: 693 QSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGSH 736

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 22/115 (19%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAI----ELMPNNAV--------------FYGNRA 137
           A  +K  G + F  KDF+ A  KY +A+    E +P+  V               Y N +
Sbjct: 279 ANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAELKMKLYLNIS 338

Query: 138 AAYSSFKKFEEAVRDAESAVRIN--PSY--SRGYSRLGLAKYALGKPEEAMEAYK 188
               + KK++ A+  A   + +   P+   ++ Y R G    A  + EEA++ YK
Sbjct: 339 LVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYK 393

>NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}
           Anc_5.689 YOR080W
          Length = 698

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 51/128 (39%), Gaps = 31/128 (24%)

Query: 92  VAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELM------------------------- 126
           + E+A +L   G   F ++ +  A+K + +AIEL                          
Sbjct: 10  LVEKALSL---GTTYFQSEKYTKAIKIFQKAIELTKSYSKNDIIELRRKHNLHSYPESAN 66

Query: 127 ---PNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEA 183
              P       NRAA +    + E A+RD++    I P   + Y R G     LGK ++A
Sbjct: 67  AYHPKYIKLLDNRAACWEKLGELERALRDSQKMCYIEPYNLKCYLRRGRLLQRLGKDKDA 126

Query: 184 MEAYKKVL 191
            + YK+ L
Sbjct: 127 YKNYKEAL 134

>SAKL0B08646g Chr2 complement(734944..736512) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088C SRP54 Signal recognition particle
           (SRP) subunit (homolog of mammalian SRP54) contains the
           signal sequence-binding activity of SRP interacts with
           the SRP RNA and mediates binding of SRP to signal
           receptor contains GTPase domain
          Length = 522

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 229 QTSEGSSAGGFPDLSSMXXXXXX--XXXNNPQVMQ-AAQKMMQNPSAMQEMMNNPAIKQM 285
           QTS+ +  GG P + +M             PQ+MQ   QK+ QNP+ MQ MM+       
Sbjct: 433 QTSKAAQQGGVPGMPNMPGMPNIPGMPKMTPQMMQQGMQKLKQNPNLMQSMMSRFG---- 488

Query: 286 AQNFASGGGTPNLGD 300
               A  GG PN+ +
Sbjct: 489 --GAAPEGGMPNMNE 501

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%)

Query: 94  ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDA 153
           E A+   + GN     KD + A+K + +A EL P  A  Y  +   Y+S + F+ A    
Sbjct: 492 EAAQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFY 551

Query: 154 ESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKK 189
             A+  +  +   Y  LG      G  + ++  ++K
Sbjct: 552 RKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEK 587

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 44/86 (51%)

Query: 109 AKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYS 168
            +++E A+K Y  A +L PN+A+    +A    S  ++  AV   E  ++++      + 
Sbjct: 609 VRNYELALKYYDFASKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNLHY 668

Query: 169 RLGLAKYALGKPEEAMEAYKKVLDIE 194
            LG     +G+ ++A++ Y   ++++
Sbjct: 669 MLGKIYQTMGRKKDAVKEYTVAMNLD 694

>Ecym_2033 Chr2 complement(51082..53811) [2730 bp, 909 aa] {ON}
           similar to Ashbya gossypii ADL177C
          Length = 909

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 46/99 (46%), Gaps = 1/99 (1%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINP- 161
           G     +   E A + ++  + L   +A+ + N +AAY+   KF+EA    + AV  +  
Sbjct: 648 GCIGLESAKMELAAEAFSRCVSLDETHALSWSNLSAAYTELGKFKEAHSCLKRAVSSDAQ 707

Query: 162 SYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATE 200
           S  R +    L    + + ++ + A K+++ I+ D   E
Sbjct: 708 SNWRIWENYMLVSAKIDQWDDVLVACKRLVQIKRDKTGE 746

>NDAI0D02190 Chr4 complement(510934..512685) [1752 bp, 583 aa] {ON}
           Anc_5.152 YGR194C
          Length = 583

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 58/143 (40%), Gaps = 14/143 (9%)

Query: 90  PEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEA 149
           P ++  AE+ +   +       F+G+    +E +   PN A F G  +   S  +KF + 
Sbjct: 444 PLLSSDAEHSRETSDNIHTKVKFDGSELPLSEYLNKRPNRAFFVGGASKNDSIVRKFAQV 503

Query: 150 VRDAESAVRINP--------SYSRGYSRLGLAKYALGKPEEAMEAY--KKVLDIEGDNAT 199
           +   E+  R++          +   +S L +     G+ ++    Y     L  E D   
Sbjct: 504 IGAKEANYRLDTPNSCALGGCFKAIWSHLVVT----GRIDDPFSVYLEAHFLWDELDRFY 559

Query: 200 EAMKRDYESAKKKVEESLNLEAL 222
           E  +  +E   KK+E   NLEAL
Sbjct: 560 EPDQEAWEMYNKKIEAMSNLEAL 582

>KAFR0D00470 Chr4 (70746..73901) [3156 bp, 1051 aa] {ON} Anc_1.88
           YGR047C
          Length = 1051

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 5/115 (4%)

Query: 90  PEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEA 149
           PEVA+    L  E N+AF   D   A + Y E I+  P N   Y      Y    +  + 
Sbjct: 141 PEVAQ----LLSEANEAFVRNDLVVAERLYNEIIKKDPRNFAAYETLGDIYHLQGRLNDC 196

Query: 150 VRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKR 204
                 A  IN S    +  + +    L    +A+  + +V++I  +   EA+ R
Sbjct: 197 CNSWFLAAHINSSDWEFWKIVAILSADLEHYRQAIYCFSRVININHEEW-EALYR 250

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNN----AVFYGNRAAAYSSFKKFEEAVRDAESAVR 158
           G + F A D+  A ++Y +++  +P N     V Y N  AA     +++  + D ESA+ 
Sbjct: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339

Query: 159 INP 161
           + P
Sbjct: 340 MFP 342

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 31.2 bits (69), Expect = 4.4,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 79/178 (44%), Gaps = 17/178 (9%)

Query: 18  TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGRGLVDLVKSGASEPTLSS 77
           ++  D+   Y    + A  C  +AF++   D+ +  +  Y       + ++ AS+P   +
Sbjct: 624 STLGDIYCHYYKDHSRAFKCYFKAFDL---DAGDYTAAKY-------ITETYASKPNWQA 673

Query: 78  SEPTGNNTDAHAPEVAE-RAEN--LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYG 134
           +    +         AE R+ N   ++ G      ++   +++ +  A+ + PN+   + 
Sbjct: 674 ASSIASRLIKGEKAKAEIRSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWV 733

Query: 135 NRAAAYSSFKKFEEAVRDAESAVRINPS--YSRGYSRLGLAKYALGKPEEAMEAYKKV 190
               AY +  + E +++  + A+ + PS  Y+R +  L L    +G+  E++E  +KV
Sbjct: 734 GLGQAYHACGRIEASIKVFDKAIELQPSHTYARYFRALSLCD--MGEYLESLETLEKV 789

>Kwal_55.20943 s55 complement(620378..624070) [3693 bp, 1230 aa] {ON}
            YER008C (SEC3) - SEC3 encodes the 144 kD and 91 kD
            components of the Exocyst complex; the 91 kD component is
            a C-terminal proteolytic breakdown product of full length
            Sec3p [contig 136] FULL
          Length = 1230

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 79/191 (41%), Gaps = 40/191 (20%)

Query: 14   QFLSTSTKDVQEE----YVDSLNVAIDCIAEAFE------IEREDSN-----EIVSKAYN 58
            Q +  ST DVQ +    YV   +  I  I + F       IE  DS      EI+ ++Y+
Sbjct: 963  QAIERSTFDVQVKHPSPYVVGFSSFIGDIEDIFSFLESHMIENSDSTSSASREILEESYS 1022

Query: 59   --GRGLVDLVKSGASEP----TLSSSEPTGNNTDAHAP---------EVAERAENLKLEG 103
              G  ++ L+   A  P     +SS+  +G+  D+ AP         E     EN  L G
Sbjct: 1023 RLGDSVLRLLGRNAESPAKSAIMSSTIASGSAADS-APMLINCNWLIETLPLFENRGLVG 1081

Query: 104  NKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSY 163
                A K F+   ++Y+E +     N ++         SF     A+ +A  A R+NPS 
Sbjct: 1082 CFQGAKKLFDIEKERYSEGLLRSSMNHLY---------SFVDGAYALTEARQAQRVNPSQ 1132

Query: 164  SRGYSRLGLAK 174
               YSR  L K
Sbjct: 1133 WTAYSRQNLNK 1143

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 23/128 (17%)

Query: 84  NTDAHAPEVAERAENL-KLEGNKAFAAKDFEGAVKKYTEAI----ELMPN---------- 128
           N D  + E A R   + K  G+  F  KDF+ A+ KY +A+    E +P           
Sbjct: 229 NFDKESAEDAYRVTTIIKNSGSLLFKQKDFQNALFKYKKALRYVNEFIPEIEVDEAYNKK 288

Query: 129 ----NAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYS----RGYSRLGLAKYALGKP 180
                A  Y N +    + K++EEA+      + I  + S    + Y R G   +A  + 
Sbjct: 289 FIELKAKLYLNLSLVMFNLKRYEEAITYTTYLLEIPEASSIDKAKAYYRSGNCHFAKKRY 348

Query: 181 EEAMEAYK 188
           ++A+  +K
Sbjct: 349 DKALSDFK 356

>ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {ON}
           similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 397

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 56/131 (42%), Gaps = 29/131 (22%)

Query: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAI----ELMPNNAVFYGNRAAAYSSFKKFEEAVR 151
           A  +K  G   +  KDF+ A  KY +++    E +P                   EE+V 
Sbjct: 239 ANTIKESGTLLYKKKDFQNAYYKYIKSLRYVNEFIP-------------------EESVD 279

Query: 152 DAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIE----GDNATEAMKR-DY 206
            A     IN   S+ Y  L L  Y L   +E+++    +L++E     D A    +R + 
Sbjct: 280 KANRINFINLK-SKLYLNLSLVLYYLQNYDESIKYATYLLEMENIPDADQAKALYRRGNS 338

Query: 207 ESAKKKVEESL 217
            SAK+K EE+L
Sbjct: 339 YSAKRKWEEAL 349

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 3/91 (3%)

Query: 43  EIEREDSNEIVSKAYNGRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLE 102
           E +RE  ++IV      R LV+ +KS      L S +P  +     +  V + AE++K+E
Sbjct: 21  EDQRELEDQIVEIERQKRDLVERLKSKRQ---LKSKDPNFDAIQVESSPVKKPAESIKVE 77

Query: 103 GNKAFAAKDFEGAVKKYTEAIELMPNNAVFY 133
            ++     D E   +K  E+   +P N   Y
Sbjct: 78  PSRTKRVLDIENLNEKKVESRSQIPANTTSY 108

>TDEL0C06130 Chr3 (1108534..1111611) [3078 bp, 1025 aa] {ON}
           Anc_1.88 YGR047C
          Length = 1025

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 45/115 (39%), Gaps = 4/115 (3%)

Query: 90  PEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEA 149
           PEV++    L  E N+AF   D + A + Y E I+    N   Y      Y    +  + 
Sbjct: 118 PEVSQ----LLSEANEAFVRNDLQVAERLYNEVIKKDARNFAAYETLGEIYQLQGRLNDC 173

Query: 150 VRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKR 204
                 A  +N S    +  + +    LG   +A+  Y +V+++  +      +R
Sbjct: 174 CNSWFLAAHLNSSDWSFWKIVAILSADLGHIRQAIYCYSRVINMNHEEWECVYRR 228

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 26/59 (44%)

Query: 100 KLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158
           K +GN  F    +  AV  Y   I   P N V Y N+A A     +  +A++  +  ++
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

>TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {ON}
           Anc_1.456 YJR032W
          Length = 408

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 55/135 (40%), Gaps = 29/135 (21%)

Query: 92  VAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVR 151
           V E A  +K  G   F  KDF+ A  KY +++  +                     E + 
Sbjct: 236 VYEAANTIKESGTLLFKKKDFQNAFFKYKKSLRYIT--------------------EYIP 275

Query: 152 DAESAVRINPSYS----RGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYE 207
           D E     N  Y+    + Y  + L  + + K EEA++    ++++E     +  K  Y 
Sbjct: 276 DMEMDKENNIKYTNLKIKLYLNMCLMMFDMQKYEEAIQYATYIIEMENVPKLDVAKAYYR 335

Query: 208 S-----AKKKVEESL 217
           S     AKK++E++L
Sbjct: 336 SGNCYLAKKRLEDAL 350

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 16/85 (18%)

Query: 110 KDFEGAVKKYTEAIELMPNNAV---------FYGNRAAAYSSFKKFE-------EAVRDA 153
           KDF+ A+  + E + +MP N V         +Y  ++ ++SS  K E       +++ +A
Sbjct: 178 KDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVELRKEIVQKSMNNA 237

Query: 154 ESAVRINPSYSRGYSRLGLAKYALG 178
             ++ ++  Y +G+S + +    LG
Sbjct: 238 LRSIELSGLYLKGWSMVAITSQELG 262

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR189W
            (SKI3)
          Length = 1390

 Score = 30.0 bits (66), Expect = 9.1,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 11/131 (8%)

Query: 112  FEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRI-----NPSYSRG 166
             E   +K  +  EL+ N  +     A       KFE A+ DA  A+ I      P   R 
Sbjct: 1124 LENRFEKSQDERELI-NYGIIKTQLARTQLGLAKFENAIEDASLALGILEGNDTPDAKRA 1182

Query: 167  ----YSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEAL 222
                Y  LGL  Y  G  ++A+E +K +L   G+++   +           EE++++ AL
Sbjct: 1183 LLSNYIVLGLGHYFSGDFDQALEFFKILLSDYGNSSEVTLMISRTIYNFGGEEAIDI-AL 1241

Query: 223  PKGEEQQTSEG 233
             +  E +T+ G
Sbjct: 1242 QELSEYRTTHG 1252

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 41/89 (46%)

Query: 111 DFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRL 170
           +FE A+  + +A  + P+N +       A+      E+A+   E A ++ PS S    + 
Sbjct: 648 EFEHALLYFEKARSINPSNVILICCCGVAFEKLSYPEKALSYYELACQVQPSSSLAKFKR 707

Query: 171 GLAKYALGKPEEAMEAYKKVLDIEGDNAT 199
               Y++     A+E ++++  +  + AT
Sbjct: 708 AHLLYSMANYPLALECFEELTKLAPEEAT 736

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/76 (18%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNA----VFYGNRAAAYSSFKKFEEAVRDAE 154
            +  G + F   D++ A+ +Y +++  +P       + Y N  AA     ++ ++V+D +
Sbjct: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608

Query: 155 SAVRINPSYSRGYSRL 170
            A+ + P   + +++ 
Sbjct: 609 VALELFPKNDKQWTQF 624

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,042,718
Number of extensions: 1320243
Number of successful extensions: 5718
Number of sequences better than 10.0: 299
Number of HSP's gapped: 5479
Number of HSP's successfully gapped: 379
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)