Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30246.20ON1079107956010.0
ACR006C6.20ON1071107032870.0
Sklu_YGOB_Anc_6.20b6.20ON1088105322990.0
Sklu_YGOB_Anc_6.20singletonOFF84984418820.0
Kwal_56.224246.20ON1089109016640.0
ZYRO0C07810g6.20ON1099112716640.0
TDEL0G044906.20ON1093108616090.0
KLTH0C11242g6.20ON1097108216020.0
Suva_13.1606.20ON1090108515510.0
Skud_13.1526.20ON1090108915430.0
KLLA0D01133g6.20ON1067108515040.0
Smik_13.1576.20ON1090107514740.0
Kpol_1037.256.20ON1105109612581e-154
TPHA0J003306.20ON1107111012131e-147
CAGL0L07634g6.20ON1130111411621e-140
NCAS0H008206.20ON1146113111451e-137
YML002W6.20ON73771510851e-133
KNAG0M011606.20ON1131110910741e-127
NDAI0D008006.20ON119311989621e-111
TBLA0A072606.20ON120411528721e-98
KAFR0L004006.20ON9428405583e-58
YML003WsingletonOFF2902744073e-43
TDEL0A067806.265ON20089920.014
Skud_9.592.257ON107783880.12
Suva_9.822.257ON114183860.19
YIL112W (HOS4)2.257ON108385850.28
TDEL0G028302.353ON769135791.2
Smik_9.572.257ON108584781.7
TBLA0C062908.876ON50355771.8
NCAS0C019008.582ON45081771.9
KLLA0A00781g3.565ON171111732.5
Kpol_1002.186.265ON20651724.0
Ecym_25953.565ON17097706.0
Smik_13.388.876ON45293726.7
Smik_6.4436.265ON19953708.4
YML097C (VPS9)8.876ON45193718.7
AGR207C8.585ON32082709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3024
         (1079 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...  2162   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...  1270   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   890   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   729   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   645   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   645   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   624   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   621   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   602   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   598   0.0  
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   583   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   572   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   489   e-154
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   471   e-147
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   452   e-140
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   445   e-137
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   422   e-133
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   418   e-127
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   375   e-111
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   340   1e-98
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   219   3e-58
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   161   3e-43
TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {...    40   0.014
Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W ...    39   0.12 
Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W ...    38   0.19 
YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subun...    37   0.28 
TDEL0G02830 Chr7 complement(546686..548995) [2310 bp, 769 aa] {O...    35   1.2  
Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W ...    35   1.7  
TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa] ...    34   1.8  
NCAS0C01900 Chr3 complement(351773..353125) [1353 bp, 450 aa] {O...    34   1.9  
KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}...    33   2.5  
Kpol_1002.18 s1002 (48873..49493) [621 bp, 206 aa] {ON} (48873.....    32   4.0  
Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar ...    32   6.0  
Smik_13.38 Chr13 complement(75428..76786) [1359 bp, 452 aa] {ON}...    32   6.7  
Smik_6.443 Chr6 complement(724235..724834) [600 bp, 199 aa] {ON}...    32   8.4  
YML097C Chr13 complement(78335..79690) [1356 bp, 451 aa] {ON}  V...    32   8.7  
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    32   9.7  

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score = 2162 bits (5601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1055/1079 (97%), Positives = 1055/1079 (97%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            MPYH          AVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPELRKCRVKSY 120
            LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPELRKCRVKSY
Sbjct: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPELRKCRVKSY 120

Query: 121  EVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISENHI 180
            EVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISENHI
Sbjct: 121  EVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISENHI 180

Query: 181  PFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKNFRN 240
            PFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKNFRN
Sbjct: 181  PFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKNFRN 240

Query: 241  YMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPEGTN 300
            YMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPEGTN
Sbjct: 241  YMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPEGTN 300

Query: 301  SFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDAD 360
            SFDL              DCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDAD
Sbjct: 301  SFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDAD 360

Query: 361  TLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGT 420
            TLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGT
Sbjct: 361  TLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGT 420

Query: 421  EKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKE 480
            EKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKE
Sbjct: 421  EKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKE 480

Query: 481  ILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNR 540
            ILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNR
Sbjct: 481  ILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNR 540

Query: 541  SNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFE 600
            SNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFE
Sbjct: 541  SNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFE 600

Query: 601  YVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYA 660
            YVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYA
Sbjct: 601  YVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYA 660

Query: 661  KYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLSADG 720
            KYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLSADG
Sbjct: 661  KYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLSADG 720

Query: 721  IKFEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSILKNIG 780
            IKFEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSILKNIG
Sbjct: 721  IKFEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSILKNIG 780

Query: 781  KPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRTNNFKPRANKDE 840
            KPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRTNNFKPRANKDE
Sbjct: 781  KPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRTNNFKPRANKDE 840

Query: 841  RIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVS 900
            RIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVS
Sbjct: 841  RIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVS 900

Query: 901  NSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELS 960
            NSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELS
Sbjct: 901  NSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELS 960

Query: 961  SLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGE 1020
            SLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGE
Sbjct: 961  SLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGE 1020

Query: 1021 LKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNILQVIEEFRKYNSTKAKN 1079
            LKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNILQVIEEFRKYNSTKAKN
Sbjct: 1021 LKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNILQVIEEFRKYNSTKAKN 1079

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score = 1270 bits (3287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1070 (56%), Positives = 800/1070 (74%), Gaps = 3/1070 (0%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            MPYH          AVFNCP P  SPLKKLFNN K ++FIL+VP T+VLLQYQD  + +P
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPELRKCRVKSY 120
            L+ELCYNY+FVASH L+QLQE++VTE E++T+NG SV+IR Q+GI+ ++P  +KCR++  
Sbjct: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQPSAKKCRIQRC 120

Query: 121  EVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISENHI 180
            E+LR+FNDYL     F LL+IDRPLVG +     L+VFG  E   P + + I   ++  +
Sbjct: 121  ELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQE--QPLQYQRITQTADAPL 178

Query: 181  PFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKNFRN 240
            P E+F+RL+PQLG QLD  F+  ++R+R     L +L+++F +LV  VY +IK DKNFRN
Sbjct: 179  PLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIKLDKNFRN 238

Query: 241  YMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPEGTN 300
            Y+ LL + Q YVELNMYED+W KLVQLNG  EPDRV GY  T+ ISLN ++T +YPE  +
Sbjct: 239  YLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTSIYPEELD 298

Query: 301  SFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDAD 360
             F+L              +CF+KL+LTNSH+EKA+I++STFQ LTTK    ++DP IDAD
Sbjct: 299  KFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDPMIDAD 358

Query: 361  TLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGT 420
            TL+GLM+VV+CR+QVKNLKSHL+YLREFA   DDVKFGL GYSLST+EAV+ YF+ G  +
Sbjct: 359  TLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSS 418

Query: 421  EKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKE 480
             KL++LI+  + N++FW+LI  G+ ++L  ++  LISR+ +CES LS+CI  GR D+  +
Sbjct: 419  IKLERLITQCQRNKIFWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYD 478

Query: 481  ILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNR 540
            I+ NYQ    LED+L DVNQ+N +LLIQAL+ G+ +I E +ID++I+NCTN E Y Y+N+
Sbjct: 479  IIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINK 538

Query: 541  SNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFE 600
             + AGRTV HYLPQ + I++++G ++DW++KD+NMHTPLF +CRAYD   Y E+LS+ F+
Sbjct: 539  CDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQ 598

Query: 601  YVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYA 660
            + F++   RG+ FSF DHEDP+GN+LLHI+K GIQ  LS P  NVNK N +GMTPLM+YA
Sbjct: 599  HCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYA 658

Query: 661  KYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLSADG 720
            KYNRIENIR+IL DKRLI+SK+Q+PQ+LKAIDYVKNP+ILNLIGT +AKNSLYG LS   
Sbjct: 659  KYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHN 718

Query: 721  IKFEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSILKNIG 780
            IK+E+N WYLWIT   S  SY T   ++K+IQ LLQ YNKKHPM+FLPIDH L  LK +G
Sbjct: 719  IKYEENAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLG 778

Query: 781  KPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRTNNFKPRANKDE 840
            K GI+ VINLENS+ L  LT  LS+I QR +Y  V  Y ES+LSTWLR +  K + NK +
Sbjct: 779  KSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWLRASMVKQKPNKRD 838

Query: 841  RIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVS 900
            +IEPEE+ SIQ+FLKF+L+EF+ ++EKFT+L+KL++F+  K+ DIEC+QRI+Y Q EI++
Sbjct: 839  KIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIA 898

Query: 901  NSVGPSVEKTFIGSNE-NYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGEL 959
            + V     +T    NE N  +D F+QA++F+ MCL++L+SKI  VLDSKV+ WW LYGE+
Sbjct: 899  SVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEI 958

Query: 960  SSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSG 1019
            ++L++EYQRNFP   K +  S E+SKGFF SY+E KRQK E KLQ+RL VC   LQ L  
Sbjct: 959  TNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDA 1018

Query: 1020 ELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNILQVIEEF 1069
            ELK  HE LAEEISFF++ KNFAY +F++K Y N  IK H+N+L  IEEF
Sbjct: 1019 ELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIEEF 1068

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1053 (43%), Positives = 669/1053 (63%), Gaps = 19/1053 (1%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            MPYH          +VFNCPTP+TSPLKK+F +++ QRFIL+VP+ ++LL YQDLD+G  
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSK---PELRKCRV 117
            L +LCY Y+FVA+HI+I  ++SK ++QE++TLNG +V+IRSQ GIV++    P  R+C++
Sbjct: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 118  KSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISE 177
             + E+  NFNDYL    YFPL+HID+PL+   V+NDELQVFG    +  S   + +    
Sbjct: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR 180

Query: 178  NHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKN 237
                FE+  RL+PQLG +  G F+  RQ I      LD L+  F     + + +I+ ++ 
Sbjct: 181  EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR 240

Query: 238  FRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPE 297
            F N+ +L      YVELN+Y+DIW ++ QL    E +    Y+  KYI+++ V T  YPE
Sbjct: 241  FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE 300

Query: 298  GTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID--- 354
              + F L              DCF +L+ ++SH+EK KI++ T Q LT   E+   D   
Sbjct: 301  KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED 360

Query: 355  PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYF 414
             TIDADTLIGLM++V+CRSQVKNLKSHL YL+ F+   + +KFG+  Y+LST+EAVL YF
Sbjct: 361  VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF 420

Query: 415  EAGDGTEKLKKLISLSEANRVFWDLIRSGVAVS---LSSYKNSLISRSSNCESSLSICIH 471
            E  + + K++ L      N+ FWD + S  AVS   L SY++ L  R++  ES LS+CI 
Sbjct: 421  EDAENSGKIRSLEFNCRRNKQFWDHL-SCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQ 479

Query: 472  AGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTN 531
             G    I+ +L N++ ++ LED+L D     STLL+Q LETG+  +A++L++++  +CT 
Sbjct: 480  KGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTI 539

Query: 532  NEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHY 591
            NE  EY+NR N   RT AHYL Q   + +KIG++ DW  KD++ HTPLF I R+YD   Y
Sbjct: 540  NELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDY 599

Query: 592  SEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIK 651
            ++M++ +F    ++   RGE+F+F+ H+D  GN+LLH+MK  I+ +L Q NI+VN+ N K
Sbjct: 600  AQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKK 659

Query: 652  GMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNS 711
            G+TPLM+Y KYNR++N++ IL D RLI+ K Q    L   DYVKNP+I   +G H A+ +
Sbjct: 660  GLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKT 719

Query: 712  LYGLLSADGIKFEDNCWYLWITVKFSD--NSYSTLRQSVKNIQGLLQFYNKKHPMNFLPI 769
             +G + A   +FE+N W+LWIT+K  D    + T++ +++ IQGLLQ Y +++PM+FLPI
Sbjct: 720  KFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPI 779

Query: 770  DHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRT 829
            D +L  L  IGK G++ V  LE   FL  LT +L +I Q+ E+   L    SDL  W+R 
Sbjct: 780  DAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRE 839

Query: 830  NNFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQ 889
            +  + R N   RIEPEE++SIQSFL+FNLSE S I++K +IL+KL +F  LKAQDI  A+
Sbjct: 840  SG-RKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQAR 898

Query: 890  RIIYQQ---MEIVSNSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLD 946
             +++ Q   +E  + S    +       +E+ S       I+F+  C   L  KI  +L 
Sbjct: 899  CMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQ 958

Query: 947  SKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQAR 1006
             K+T WW+LY EL   R +Y +NFP+  K      +++KG F +Y+EGKR K E+KL A+
Sbjct: 959  GKLTRWWKLYAELLDARNQYNKNFPNSVKP---HLDDNKGLFGTYVEGKRSKLEEKLSAQ 1015

Query: 1007 LRVCITKLQTLSGELKKDHENLAEEISFFVTFK 1039
            ++ C+ +LQTL+ E+K++HE LAEE+S ++ FK
Sbjct: 1016 IKSCLERLQTLTYEVKQEHEALAEELSIYLEFK 1048

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/844 (43%), Positives = 537/844 (63%), Gaps = 12/844 (1%)

Query: 1   MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
           MPYH          +VFNCPTP+TSPLKK+F +++ QRFIL+VP+ ++LL YQDLD+G  
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSK---PELRKCRV 117
           L +LCY Y+FVA+HI+I  ++SK ++QE++TLNG +V+IRSQ GIV++    P  R+C++
Sbjct: 61  LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 118 KSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISE 177
            + E+  NFNDYL    YFPL+HID+PL+   V+NDELQVFG    +  S   + +    
Sbjct: 121 TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR 180

Query: 178 NHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKN 237
               FE+  RL+PQLG +  G F+  RQ I      LD L+  F     + + +I+ ++ 
Sbjct: 181 EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR 240

Query: 238 FRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPE 297
           F N+ +L      YVELN+Y+DIW ++ QL    E +    Y+  KYI+++ V T  YPE
Sbjct: 241 FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE 300

Query: 298 GTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID--- 354
             + F L              DCF +L+ ++SH+EK KI++ T Q LT   E+   D   
Sbjct: 301 KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED 360

Query: 355 PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYF 414
            TIDADTLIGLM++V+CRSQVKNLKSHL YL+ F+   + +KFG+  Y+LST+EAVL YF
Sbjct: 361 VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF 420

Query: 415 EAGDGTEKLKKLISLSEANRVFWDLIRSGVAVS---LSSYKNSLISRSSNCESSLSICIH 471
           E  + + K++ L      N+ FWD + S  AVS   L SY++ L  R++  ES LS+CI 
Sbjct: 421 EDAENSGKIRSLEFNCRRNKQFWDHL-SCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQ 479

Query: 472 AGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTN 531
            G    I+ +L N++ ++ LED+L D     STLL+Q LETG+  +A++L++++  +CT 
Sbjct: 480 KGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTI 539

Query: 532 NEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHY 591
           NE  EY+NR N   RT AHYL Q   + +KIG++ DW  KD++ HTPLF I R+YD   Y
Sbjct: 540 NELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDY 599

Query: 592 SEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIK 651
           ++M++ +F    ++   RGE+F+F+ H+D  GN+LLH+MK  I+ +L Q NI+VN+ N K
Sbjct: 600 AQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKK 659

Query: 652 GMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNS 711
           G+TPLM+Y KYNR++N++ IL D RLI+ K Q    L   DYVKNP+I   +G H A+ +
Sbjct: 660 GLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKT 719

Query: 712 LYGLLSADGIKFEDNCWYLWITVKFSD--NSYSTLRQSVKNIQGLLQFYNKKHPMNFLPI 769
            +G + A   +FE+N W+LWIT+K  D    + T++ +++ IQGLLQ Y +++PM+FLPI
Sbjct: 720 KFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPI 779

Query: 770 DHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRT 829
           D +L  L  IGK G++ V  LE   FL  LT +L +I Q+ E+   L    SDL  W+R 
Sbjct: 780 DAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRE 839

Query: 830 NNFK 833
           +  K
Sbjct: 840 SGRK 843

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/1090 (35%), Positives = 588/1090 (53%), Gaps = 38/1090 (3%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            MPY+          AVFNCPTP  S LKK+F+ ++  RF+L+ P T++LL+Y+DL+SGLP
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPEL---RKCRV 117
            L +LCY   FV+ HI++      + E+EY+TL+G ++++RSQ GI+ +       R+CR+
Sbjct: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120

Query: 118  KSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVF---GSYEMHNPSKSKTINT 174
            +  E+L NFN+YL     FP++H+D PL G L R DE Q F    + E  N  K+    +
Sbjct: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180

Query: 175  ISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKE 234
              +N+I  E+ +R+ P+ G  L+   +  R  + + V     L   F         V++ 
Sbjct: 181  HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240

Query: 235  DKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATIL 294
               F+    L     EY+ELN+Y+D W +L       E +  S YS  K+IS++ V + L
Sbjct: 241  YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300

Query: 295  YPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID 354
            YP     FDL              + F K+++TN H+ KAK+++ T Q L+  +      
Sbjct: 301  YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA 360

Query: 355  PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYF 414
             TIDADTL+ L +VV+C +QVK+L+SHL YL+EF    + V FG+  Y +ST+EAVL YF
Sbjct: 361  VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF 420

Query: 415  EAGDGTEKLKKLISLSEANRVFWDLIRSGV----AVSLSSYKNSLISRSSNCESSLSICI 470
            E+    EK+  L     AN   W  I  G     A +     + L  R+S+ +S L++C+
Sbjct: 421  ES---PEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCL 477

Query: 471  HAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCT 530
               R +  + I    +    LEDLL D     S LLI  LE+G D +A +LI+ +ISNCT
Sbjct: 478  QHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCT 537

Query: 531  NNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLH 590
             +E   ++N +N   R+  HYL  A  +I+ +G  L+W ++D N HTPLF I RAYD+  
Sbjct: 538  KDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPD 597

Query: 591  YSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNI 650
            Y +M+S ++       + R   F  ++H D  GN+LLH++K  +  +L+ P I+VN +N 
Sbjct: 598  YFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNA 657

Query: 651  KGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKN 710
            KG+TPLM+Y +YNRI N+R IL+D+RLI+ K Q+   L   DYVKNP +L  +G + +  
Sbjct: 658  KGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYL 717

Query: 711  SLYGLLSADGIKFEDNCWYLWITVKFSDNS--YSTLRQSVKNIQGLLQFYNKKHPMNFLP 768
                 ++   +K E + W LWITV   +        ++S++ IQ  L  ++  HPM F+P
Sbjct: 718  PFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVP 777

Query: 769  IDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLR 828
            +D +L  L+ + +  IL +  ++   FL   +  LS++ Q  E +    + +S+L+    
Sbjct: 778  VDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQ--ERLFADAFTDSNLNLSSS 835

Query: 829  ---------TNNFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQS 879
                     T N K        +EPEEV SIQS LKFNLSE S +K    +++KL VF+ 
Sbjct: 836  RGLGSSESFTQNMK-------MMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEG 888

Query: 880  LKAQDIECAQRIIYQQMEIVSNSVGPSVEKTFIGSNEN-YSLDSFQQAIEFIAMCLETLS 938
            LK +D+  A      + + V+     S +        N +  +     I    +C   L 
Sbjct: 889  LKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLC 948

Query: 939  SKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQK 998
              I  VL+  +  WW  YGEL SLRREY+++FP D     VS  E+ G F SYIE KR K
Sbjct: 949  KHIGQVLNDDIPKWWHTYGELLSLRREYKKSFP-DANRPHVS--ENSGLFGSYIETKRTK 1005

Query: 999  TEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKH 1058
             E    AR+     +L  +S ++ +D+E LA E++ F+ FKN   +S  +K +A+  IK 
Sbjct: 1006 LEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKS-AIKEHADTNIKR 1064

Query: 1059 HRNILQVIEE 1068
             R  L   EE
Sbjct: 1065 LREQLVCSEE 1074

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1127 (34%), Positives = 624/1127 (55%), Gaps = 78/1127 (6%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            M YH          +VFNC  P+ S  KKLF  +K +RFILLVP T+ LL + D +SG  
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   LSELCYNYDFVASHILIQLQES--------KVTEQEYRTLNGNSVIIRSQAGIVMSK--- 109
            +++LC NYDFVASHIL+  Q++          ++ EY+TLN   V +RS +G +++    
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120

Query: 110  PELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQ---VFGSYEMHNP 166
            P  R+ R+++ E++ NFNDYL+    F L+HID PL+G L+R  ++      G++   + 
Sbjct: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDA 180

Query: 167  SKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVI 226
              S   +   ++   FE  +RL+P     L+GYF R R     E        ++F+ +V 
Sbjct: 181  KGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTE----GPYEELFRMIVK 236

Query: 227  DVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYIS 286
             V+  +  D+ FR    L ++  +YVELN+++D+W+++V      E D        K++S
Sbjct: 237  QVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDT----EPLKFLS 292

Query: 287  LNNVATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTT 346
            +N + T LY +    F L              + F  L LT++H EKA  +++T Q L+ 
Sbjct: 293  INELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSN 352

Query: 347  ----KMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGY 402
                 M+  ++  T+DADTLI   ++V+CR+QVKN+KSHL YL++F+   + +KFG+ GY
Sbjct: 353  TREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGY 412

Query: 403  SLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIR---SGVAV-SLSSYKNSLISR 458
            ++ST+EAV+ YF+   GT+KL+KL   S   +  + LI    +G AV  +S ++++L  R
Sbjct: 413  AISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQFRSNLEFR 472

Query: 459  SSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIA 518
            +   ES LS CI   +  L+ E+L NY++   LED+L D     STLLIQAL+  + E A
Sbjct: 473  TPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEAA 532

Query: 519  ELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTP 578
            +++++V+ ++CT  E  EYVNR++   RTVAHYL    +I+E IG Y++W+ +D N HTP
Sbjct: 533  QMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHTP 592

Query: 579  LFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSIL 638
            LF I R YDQ +Y  M+S +F     + +  GEDF F+DHED  GN+LLHI+K  +  +L
Sbjct: 593  LFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILL 652

Query: 639  SQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPM 698
               N+++N +N KG+TPLM+Y +YNR +N++ I+ D+R+I+ K+Q+P  L + DY +NP+
Sbjct: 653  DYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNPL 712

Query: 699  ILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKF---SDNSYSTLRQSVKNIQGLL 755
            +L  + +   K + + L     +K+E   W+  ITVK    +D  Y T++  +K +Q L 
Sbjct: 713  VLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNLF 772

Query: 756  QFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAV 815
            Q   K H  +FLP++  L  L N+ K  +  +  LE   F  +LT    V+  R++ +  
Sbjct: 773  QVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVL-LRHDNLNK 831

Query: 816  LRYNESDLSTWLRTNNFK----PRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKF--- 868
            L   ES L +W+R+ + K     +  K + +EPEE+  + SFL+FN  E S +K K    
Sbjct: 832  LVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKLMTM 891

Query: 869  -----------TILRKLVVFQSLKAQDIECAQ-RIIYQQMEIVSNSVGPSVEKTFIGSNE 916
                       T L     F SL   +   AQ R++++ +EI   + G     TF+    
Sbjct: 892  KKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMTFV---- 947

Query: 917  NYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKS 976
                    + I F+  C   L  +++ +L   +  WW+LYG++  + + Y++ FP+   S
Sbjct: 948  --------REIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPN--IS 997

Query: 977  SDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFV 1036
             + SG    G   S+ EGKR+K E KL + L  C  +++ +   +   HE LAEE+S ++
Sbjct: 998  RNDSG---TGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYM 1054

Query: 1037 TFKNFAYESFVMKTYANICIKHHRNILQ-VIEEFRK---YNSTKAKN 1079
             FK+    +F +       ++ + NIL+  + E RK   Y S K +N
Sbjct: 1055 EFKS----NFFINGILRRAVRENINILKGRLVEMRKRALYRSRKGEN 1097

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/1086 (34%), Positives = 598/1086 (55%), Gaps = 45/1086 (4%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            MPYH          AVFNCP P+TS LKKLF+N+K ++FILLVP  D LL   D  SG P
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   LSELCYNYDFVASHILI-------QLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPEL- 112
            L ELCY+Y+FVASH+L+        +  +  ++ ++ TLNG  VI+RSQ  I+++     
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120

Query: 113  --RKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVF-----GSYEMHN 165
              ++C +   ++  NFN+YL     FP+L ID P+    VR   +Q+      G  E  +
Sbjct: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180

Query: 166  PSKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLV 225
             S S T+++   +   F+  +R++P    + +  F   R     +    D  I++F D++
Sbjct: 181  GS-SPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGD----DPHIELFHDII 235

Query: 226  IDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYI 285
               Y  ++ D  F +  +L ++  +YVELN+Y+DIW+++       E +     +  +Y+
Sbjct: 236  RRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVES----NGLRYL 291

Query: 286  SLNNVATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILT 345
            SL+ + T LYP+    F+L              + F++L L ++H +KA  ++ T + L+
Sbjct: 292  SLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS 351

Query: 346  -TKMEYTSIDP-TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYS 403
                    + P  I ADTL+ L ++V+CR+Q++NLK  L YL+ FA     + FG+ GY+
Sbjct: 352  RVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYA 411

Query: 404  LSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRS-GVAVSLSSYKNSLISRSSNC 462
            +ST+EA + YF+   G++K+ +L S  E  R   D + S   +V+L  Y+ +L  R+   
Sbjct: 412  ISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSESSSVNLIHYQKTLSYRTEQG 471

Query: 463  ESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLI 522
            ES LSICI  G+ D+++E LL+ +    LED+L D      TLL+Q+L+ G+ + A L++
Sbjct: 472  ESLLSICIANGKNDILQE-LLSDERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIV 530

Query: 523  DVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFII 582
            D++ S+CT  E + Y NRS+   RT AHYL    +I+E+IG + DW  KD + HT LF I
Sbjct: 531  DLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTI 590

Query: 583  CRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPN 642
             R+YDQ +Y +M+  SF    E+   R   F FT HED   N+LLHI+K  I  +L   +
Sbjct: 591  FRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYES 650

Query: 643  INVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNL 702
            ++VN  N KG+TPLM+YAKYNR++N + IL DKR+I+ KIQ+P  L +IDY KNP+IL+ 
Sbjct: 651  VDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHE 710

Query: 703  IGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFS-DNSYSTLRQSVKNIQGLLQFYNKK 761
            I    A ++ +G      +K+E + W + ITV+     ++ T+   +K +Q   +   + 
Sbjct: 711  IAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRT 770

Query: 762  HPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNES 821
             PM FLP+D  L+ L ++GK  +  +  LE   +L  LT   +V+    E    +  NES
Sbjct: 771  CPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANES 830

Query: 822  DLSTWLRTNNFKPRANK-----DERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVV 876
             L +W++   +K   N       +++EPEE+S IQ FL+FN +E S ++ K  +++KL +
Sbjct: 831  KLLSWIKV-QYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAI 889

Query: 877  FQSLKAQDIECAQRIIYQQMEIVSNSVG---PSVEKTFIGSN--ENYSLDSFQQAIEFIA 931
            F  LK+ D+E +  ++   + + S  +G   P  +  F  +    N S+    + I+ + 
Sbjct: 890  FLRLKSSDVEQSVELL---LPLGSEGMGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLML 946

Query: 932  MCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESY 991
             C   L   I  +L  K+  WW+LYGEL + R++Y +NFP   K+ + S +   G     
Sbjct: 947  KCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTD--AGIIGKI 1004

Query: 992  IEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTY 1051
            +EGK++K E +L   +      +      +  DHE+LAE++S F+ FK       V+K +
Sbjct: 1005 LEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRW 1064

Query: 1052 ANICIK 1057
                IK
Sbjct: 1065 VRENIK 1070

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/1082 (33%), Positives = 575/1082 (53%), Gaps = 20/1082 (1%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            MPY+          AVFNCPTP  SPL+K+F  ++ QRF L+ P+ ++LL+Y+DL+SG  
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPEL---RKCRV 117
            L +LCY+  FV+ HIL+        E+EY+TL+G ++ +R+Q   + +       R+C+V
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120

Query: 118  KSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNP---SKSKTINT 174
               E+L NFN+Y      +P++H+D PL G L R DE   F +Y   +    S + ++  
Sbjct: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTSANSSLAA 180

Query: 175  ISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKE 234
             +E     E+ +R +P  G +L    +  R  + +     D L   F          I+E
Sbjct: 181  STEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240

Query: 235  DKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATIL 294
            D++FR +  L     EYVE+N+Y+D W +L       E +  S +S  + IS++ V + L
Sbjct: 241  DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300

Query: 295  YPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID 354
            YP     FD+              +C  +L +TNSH+ KAK++V T Q ++  +E     
Sbjct: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360

Query: 355  PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYF 414
             ++DADTL+ L++VV+C+++VK+LKSHL YL+EFA   + + FG+  Y +ST+EAVL+YF
Sbjct: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420

Query: 415  EAGDGTEKLKKLISLSEANRVFWDLIRSGV----AVSLSSYKNSLISRSSNCESSLSICI 470
            E+    EKLK L     +N  +W+ +  G     +++ S  K+ L +R+    S LSIC+
Sbjct: 421  ES---REKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICL 477

Query: 471  HAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCT 530
               + +L   +   ++    LEDLL D     S LLIQ L+ G   ++   I+++  +CT
Sbjct: 478  QNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCT 537

Query: 531  NNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLH 590
              E   ++N  N   R+  HYL  A  +I K+G +++W ++D N HTPLF I R YD   
Sbjct: 538  KTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTD 597

Query: 591  YSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNI 650
            Y  M+  +++    +C  +G+ F  + H+D  GN+LLH++K  +  +L  P +NVN  N 
Sbjct: 598  YDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNK 657

Query: 651  KGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKN 710
            KG+TP+M+YA+YNR++NI+ IL DKRLI+ K QN   L   DY+KNP++L  +G H    
Sbjct: 658  KGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFL 717

Query: 711  SLYGLLSADGIKFEDNCWYLWITVKFS--DNSYSTLRQSVKNIQGLLQFYNKKHPMNFLP 768
                 + A  IKFE + W LW+T+  S  +     +++S+K IQ  L  ++K + M F+P
Sbjct: 718  PQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIP 777

Query: 769  IDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLR 828
             + +   L  + K  I+ +  LE   FL   + +LS+I ++ E+  +       L     
Sbjct: 778  AESLAEELSLLAKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAAE 837

Query: 829  TNNFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECA 888
                +   +    IEPEEV+SIQ  +KFN +E   IK    +L+KL +F  LK +D+E +
Sbjct: 838  HVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERS 897

Query: 889  QRIIYQQMEIVSNSVGPS--VEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLD 946
              +        +  +G S  V  +   S               + +    L  KI  +L+
Sbjct: 898  HTMFQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKIDKILN 957

Query: 947  SKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQAR 1006
              +  WW+ YGEL SLR EY +NFP D +       E+ GF  SYIE KR + E  L  R
Sbjct: 958  HDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVA---ENTGFISSYIETKRVRLEQGLVGR 1014

Query: 1007 LRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNILQVI 1066
            +      L   S  L++ +E+LA E++ F+ FK   + S  +K +A + IK  +  L  +
Sbjct: 1015 INRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCL 1074

Query: 1067 EE 1068
            EE
Sbjct: 1075 EE 1076

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/1085 (32%), Positives = 583/1085 (53%), Gaps = 44/1085 (4%)

Query: 3    YHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62
            YH          A+FNCP P  SPLKKLF N++ +RFILL P + +LL Y D+ + LPL 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   ELCYNYDFVASHILIQLQESKVT----EQEYRTLNGNSVIIRSQAGIVMSK---PELRKC 115
            ELCYN DF+ SHIL+  + S +     +  Y TL+G +V+++ +  ++ +    P  R+ 
Sbjct: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123

Query: 116  RVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTI 175
            ++   ++L NFNDY     YF +L+ID+PL    V ND L  F SYE  + +     N +
Sbjct: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAPNLL 183

Query: 176  SEN----HIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGV 231
             +        FE  + ++P    QL   F   R+   N+    D   K+F++LV   +  
Sbjct: 184  MDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALND----DPSKKMFEELVEQAFDG 239

Query: 232  IKEDKNFRNYMELLNVTQEYVELNMYEDIWLKL-VQLNGSKEPDRVSGYSSTKYISLNNV 290
            +K D  F+N+  L ++  +Y ELN+YEDIW +L +   G +         + +Y S+N +
Sbjct: 240  MKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYE-----VNTENCEYFSVNQL 294

Query: 291  ATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEY 350
             T  Y +   SF L                F KL+L++S+ EK+KI+V T Q L+   + 
Sbjct: 295  LTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDM 354

Query: 351  TSIDP---------TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTG 401
             S  P         T+DADTLI L ++V+CRS+ K+++SHL YL+ F+      KFG+ G
Sbjct: 355  GSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILG 414

Query: 402  YSLSTIEAVLAYFEAGDGTEKLKKLISL-SEANRVFWDLIR----SGVAVSLSSYKNSLI 456
            Y++ST+EAV+ YFE  +         +L     R   D +     +     L++YK+ L 
Sbjct: 415  YAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDILA 474

Query: 457  SRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDE 516
             R+   +S LS+CI   + D++ ++L  Y+    +ED+L D     STLLI++++ G+ E
Sbjct: 475  YRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLE 534

Query: 517  IAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMH 576
              ++LI +M+ NCT+ E   YVN+++   R+VAHYL     I++ IG Y++W++K+ +  
Sbjct: 535  ATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQ 594

Query: 577  TPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQS 636
            TPLF I R+YDQ +Y EM+  +F     + +R    F ++DH D  GNSLLH++K  +  
Sbjct: 595  TPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSI 654

Query: 637  ILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKN 696
            +L    +N+N  N KG+TPLM+Y KY R+ NI  I +D RLI+ K+QN       DY K+
Sbjct: 655  LLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKD 714

Query: 697  PMILNLIGTHIAKNSLYGLLSADGIKFED-NCWYLWITVKFSDNSYSTLRQSVKNIQGLL 755
             ++L+ IG   A +S++GL+    +++ + N      +V  ++  + T   ++K IQGLL
Sbjct: 715  RLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLL 774

Query: 756  QFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAV 815
            +   K +P  FLPID+ +  + ++ +  +  +   +    L  LT   +V+    +    
Sbjct: 775  RSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQN 834

Query: 816  LRYNESDLSTWLRTNNFK-----PRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTI 870
            L  +E+ +  W+R N  +     P  +  + +EPEE++ IQSFL+FN  E    K    I
Sbjct: 835  LFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNI 894

Query: 871  LRKLVVFQSLKAQDIECAQRIIYQQMEIVSNSVGPSVEKTFIGSNENY---SLDSFQQAI 927
            LRK+++F SLK+ D E A   + +    V+N        T I +++ +   SLD   + +
Sbjct: 895  LRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHV 954

Query: 928  EFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGF 987
            +F+  C   L + IQ +L  ++  WW+ YGE  +L + Y++ FPS  K    +G  S   
Sbjct: 955  QFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIP 1014

Query: 988  FESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFV 1047
               +IE KR+++E +L  +++     L+ L  E+   HENLAEE+S ++ F+    +   
Sbjct: 1015 LGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRT 1074

Query: 1048 MKTYA 1052
            +  +A
Sbjct: 1075 IVAFA 1079

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/1089 (33%), Positives = 582/1089 (53%), Gaps = 44/1089 (4%)

Query: 3    YHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62
            YH          A+FNCP P  SPLKKLF N+K +RFILL P    LL Y D+ + LPL 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63

Query: 63   ELCYNYDFVASHILIQLQES----KVTEQEYRTLNGNSVIIRSQAGIVMSK---PELRKC 115
            ELCYN DF+ SHIL+  + S     + +  Y TL+G +V+I+ +  I+ +    P  ++ 
Sbjct: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123

Query: 116  RVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTI--- 172
            ++   +VL NFNDY      F +L ID+PL   +  ND L+ F SYE   P  ++++   
Sbjct: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYE-EVPKNAQSVSNL 182

Query: 173  --NTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYG 230
              N+  +    F+  + ++    AQL   F   R+   N+    D   K+F+D+V   + 
Sbjct: 183  PVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPND----DPSKKMFEDIVQQSFD 238

Query: 231  VIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNV 290
             +K D  F+N+  L ++  +Y ELN+Y+DIW +LV      E D        KY S+N +
Sbjct: 239  GMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDT----EKYKYFSVNQL 294

Query: 291  ATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEY 350
                + +    F L                F KL+LT+S+ EK+KI+V T Q L+   E 
Sbjct: 295  LADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEI 354

Query: 351  TSIDP---------TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTG 401
            +S            T+DADTL+ L ++V+CRS+ K+LKSHL YL+ F+  P   KFG+ G
Sbjct: 355  SSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILG 414

Query: 402  YSLSTIEAVLAYFEAGD-GTEKLKKLISLSEANRVFWDLIRSGVAVS----LSSYKNSLI 456
            Y++ST+EAV+ YFE  D   E L K     +  R   D + S    +    L++Y+++L 
Sbjct: 415  YAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQ 474

Query: 457  SRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDE 516
             R+   +S LSICI   +  ++ ++L  Y++   +ED+L D     STLLI++++TG+ E
Sbjct: 475  YRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIE 534

Query: 517  IAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMH 576
             A++LI +M+ NC+  E   YVN+++   RTVAHYL     I++ IG Y+DW++K+ +  
Sbjct: 535  AAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQ 594

Query: 577  TPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQS 636
            TPLF I R YDQ +Y EM+  +F     + ++    F + DH D  GNSLLHI+K  +  
Sbjct: 595  TPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSI 654

Query: 637  ILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKN 696
            +L    +++N  N KG+TPLM+Y KY RI NI  I +D RLI+ K+QN       DY K+
Sbjct: 655  LLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKD 714

Query: 697  PMILNLIGTHIAKNSLYGLLSADGIKFED-NCWYLWITVKFSDNSYSTLRQSVKNIQGLL 755
              +L+ IG   A++SL+GL+    +++ + N      T   +D  + T   ++K IQGLL
Sbjct: 715  HSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINMKTIQGLL 774

Query: 756  QFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAV 815
            +   K +   FLP++  +  + ++ +  +  +   +    L  LT   +V+    +    
Sbjct: 775  RSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQN 834

Query: 816  LRYNESDLSTWLRTNNFK-----PRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTI 870
            L  +E+ +  W+R N  K     P  +  + +EPEE++ IQSFL+FN  E S  K    I
Sbjct: 835  LFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNI 894

Query: 871  LRKLVVFQSLKAQDIECAQRIIYQQ-MEIVSNSVGPSVEKTFIGSN--ENYSLDSFQQAI 927
            LRK+++F SLK+ D E     + +   +I++     +  + F   N   + +L    + +
Sbjct: 895  LRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHV 954

Query: 928  EFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGF 987
             F+  C   LS+ +Q +L  K+T WW+ YGE  +L++ Y++ FPS  K    +   S   
Sbjct: 955  SFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIP 1014

Query: 988  FESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFV 1047
              S+IE KR+++E +L  +++     L+ L  E+   HE LAEE+S ++ F+    +   
Sbjct: 1015 LGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRT 1074

Query: 1048 MKTYANICI 1056
            +  +A   I
Sbjct: 1075 IVAFATTNI 1083

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/1085 (33%), Positives = 599/1085 (55%), Gaps = 49/1085 (4%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            MPYH          A+FNCP+P TS LK++F+ +  +RF +LVPST+ LLQ+QDL+SGL 
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 61   LSELCYNYDFVASHILIQLQESK-VTEQ------EYRTLNGNSVIIRSQAGIVMSK---P 110
            L+ELCY+YDFVASHI++    +K V +Q      ++ TLNG  + IR +   +++     
Sbjct: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120

Query: 111  ELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSK 170
            E RK  +K   +L  FNDYL    Y P+LHI  PL G LV  DELQVF     +  SK +
Sbjct: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180

Query: 171  ----TINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLV- 225
                  +   +  + FE+ I+    +  ++   F   + RI+  +     +I I  + + 
Sbjct: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAIS----VIGIRTEWLN 236

Query: 226  --IDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTK 283
                +  +I  DK   +  +L  +  +YVEL ++ DI  +L ++   +E +    + + +
Sbjct: 237  TRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALR 296

Query: 284  YISLNNVATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQI 343
             ISLN V T  YP+   SF L              +    + L  +H+ K +++ +T ++
Sbjct: 297  SISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRL 356

Query: 344  LTTKMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYS 403
            L+ ++   S D    ADTL+ L ++++CRSQV  L   L YL  F      +KFGL GY 
Sbjct: 357  LSREINGISTD----ADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYV 412

Query: 404  LSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLISRSSNCE 463
            LST EA L++F   D  + L K  +   +N+  W  I+    V      ++L  R+ + E
Sbjct: 413  LSTFEAALSFFHQ-DTVDSLTKKCA---SNKKIWASIQKHSKVEAELLSSNLRIRTDSGE 468

Query: 464  SSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLID 523
            S LSICI +   +++  +L N++ +  LED+L D + A STLLIQAL+  + + A +L +
Sbjct: 469  SLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSE 528

Query: 524  VMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIIC 583
            +++ +CT +E   Y+N  N   R  AHY+ Q  S++E +G Y +W  KD+N HTPLF + 
Sbjct: 529  IILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVF 588

Query: 584  RAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNI 643
            R+YD ++Y E++++  + V ++     + F+F  HEDP GN+LLH+MK GI+S+L  P++
Sbjct: 589  RSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDV 648

Query: 644  NVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLI 703
            NVNK + KG+TPLM+Y++YNRI NI  I++D+RL+   +Q P  + ++D+ KNP +   I
Sbjct: 649  NVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTI 708

Query: 704  GTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHP 763
                       + S   ++FE+  W + I   FS+  +   + S+  IQ  L++    +P
Sbjct: 709  LDATFNREPVVIHS---LRFEERKWKIGI---FSEGIFK--KYSLDLIQYYLRYLKIMYP 760

Query: 764  MNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDL 823
             +F P+  + + L+ +G  G+  V+ L++      L  L S +  R +    L  +E +L
Sbjct: 761  CSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLW--LGKDEEEL 818

Query: 824  STWLRTNNFKPRANKDER---IEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSL 880
               L      P  ++ ER   +EPEE++ IQ+FLK+NL+EF +++    IL+KL + Q +
Sbjct: 819  KVLLDVPT--PYLSESERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQI 876

Query: 881  KAQD-IECAQRIIYQQMEIVSNSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSS 939
            K +D I      +    ++    V  S E T    + + S   F + +E++   + TL +
Sbjct: 877  KHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLN 936

Query: 940  KIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKT 999
              + +L +K TLWW+ +GEL  L++E+++NFP+D K+   S   ++ F ++YIEGKR K 
Sbjct: 937  NFESLL-AKTTLWWKHFGELMELKKEWKKNFPND-KAPPSSA--NRNFIDTYIEGKRSKF 992

Query: 1000 EDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHH 1059
             +KL  +L++    L+ + GE+K  HE++A  I+ F+ FK   Y   ++K+  +  I+ +
Sbjct: 993  RNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQRIREN 1052

Query: 1060 RNILQ 1064
            + I+Q
Sbjct: 1053 KQIMQ 1057

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/1075 (33%), Positives = 575/1075 (53%), Gaps = 74/1075 (6%)

Query: 15   AVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLSELCYNYDFVASH 74
            A+FNCP P  SPLKKLF  +K  RFILL P ++ LL Y D+ + LPL ELCYN +F+ SH
Sbjct: 16   AIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHELCYNAEFINSH 75

Query: 75   ILIQLQESKVT----EQEYRTLNGNSVIIRSQAGIVMSKPEL---RKCRVKSYEVLRNFN 127
            IL+  + S +     +  Y TL+G +V+I+ +  ++ +       R+ ++   ++L NFN
Sbjct: 76   ILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLKILGTKILPNFN 135

Query: 128  DYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYE--------MHNPSKSKTINTISENH 179
            DY      F +++I++PL    V ND LQ F SY+        +HN S    +++  +  
Sbjct: 136  DYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLS----LDSSQQER 191

Query: 180  IPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKNFR 239
              FE  + ++P    QL   F   R    ++    D   KIF+ +V   +  +K D  F+
Sbjct: 192  SSFENILHIHPTRLTQLGEMFSNYRTLAPSD----DPSEKIFECIVQQAFEGMKSDSLFK 247

Query: 240  NYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPEGT 299
             +  L ++  EY ELN+Y+DIW +L     S E     G    KY S+N++    Y +  
Sbjct: 248  KFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYE----VGTEEYKYFSINHLLADFYSKDF 303

Query: 300  NSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQIL--TTKMEYTSIDP-- 355
              F L                F KL+LT+S+ EK+KI+V T Q L  TT M    +D   
Sbjct: 304  REFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPG 363

Query: 356  -----TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAV 410
                  +DADTLI L ++V+CRS+ K+LKSHL YL+ F+      KFG+ GY++ST+EAV
Sbjct: 364  RLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYAVSTLEAV 423

Query: 411  LAYFE-----------AGDGTEKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLISRS 459
            + YFE           A    +K K+L+++     V      +    +L++YK+ L  R+
Sbjct: 424  VCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENV------TNKVENLATYKDILPYRN 477

Query: 460  SNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAE 519
               +S LSICI   +  ++ +IL  Y     LEDLL D     STLLI+++++G+ E A+
Sbjct: 478  GQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAK 537

Query: 520  LLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPL 579
            +LI +M+ NCT  E   Y+NR++   RTVAHYL     I++ IG Y+DW++K+    TPL
Sbjct: 538  ILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPL 597

Query: 580  FIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILS 639
            F I R+YDQ +Y  M+  +F     + R++   F + DH D  GN LLH++K     +L 
Sbjct: 598  FSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQ 657

Query: 640  QPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMI 699
               +++N  N KG+TPLM+Y KY R+ NI  I++D+RL++ KIQ        DY K+  +
Sbjct: 658  LTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTV 717

Query: 700  LNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWIT-VKFSDNSYSTLRQSVKNIQGLLQFY 758
            L+ +G   AK+SL+GL+    +++ +    + IT    ++  +S    ++K IQGLL+  
Sbjct: 718  LSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSI 777

Query: 759  NKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRY 818
             K +P  FLP++  +  +  + +  +  +   +    L  L+   +V+    +    L  
Sbjct: 778  LKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFT 837

Query: 819  NESDLSTWLRTNNFK-----PRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRK 873
            +E+ +  W+R N  K     P     + +EPEE++ IQSFL+FN  E S  K   +ILRK
Sbjct: 838  DEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRK 897

Query: 874  LVVFQSLKAQDIECAQRIIYQQMEIVSNSVGPSVEKTFIG--SNEN----YSLDSFQQAI 927
            +++F SLK+ D +     + +  + + N+        F G  +N N    YSL    + +
Sbjct: 898  ILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADA---FAGNLTNHNMFNDYSLAKLLEHV 954

Query: 928  EFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFK---SSDVSGEES 984
             F+  C   LS+ +Q +L  K+  WW+ YGEL +L + Y++ FPS  K   ++D SG   
Sbjct: 955  RFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQ 1014

Query: 985  KGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFK 1039
             G F   IE KR+++E +L  +++V    L+ L  E+   HE LAEE+S ++ F+
Sbjct: 1015 LGGF---IETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFR 1066

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  489 bits (1258), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 327/1096 (29%), Positives = 570/1096 (52%), Gaps = 71/1096 (6%)

Query: 1    MPYHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60
            + YH          AVFNCP P  SPL+KLF  +K + F+L+VP  ++LL Y+D + GL 
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   LSELCYNYDFVASHILIQLQES------------KVTEQEYRTLNGNSVIIRSQAGIVM- 107
            L ELCY ++FVASHI++    S            +  +  Y++LN N ++I++   I + 
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLD 123

Query: 108  --SKPELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVF--GSYEM 163
              +  + +K ++   ++L NFN+YLS    + +++ D P   + +   E++ F     E 
Sbjct: 124  FNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183

Query: 164  HNPSKSKTINTIS--------ENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLD 215
            +N   ++  N  S        +    F   I ++ +     D Y        +N+   L 
Sbjct: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIID----FKNKQLNLT 239

Query: 216  KLIKIFKDLVIDVYGVIKEDKNFRNYM-ELLNVTQEYVELNMYEDIWLKLVQLNGSKEPD 274
             L   F+++V   Y  +K ++ F ++  +L N+  EY+E + Y  IW     ++ +   +
Sbjct: 240  SLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIW---DHIDRNMIDN 296

Query: 275  RVSGYSSTKYISLNNVATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKA 334
            +        ++S++ +   LY +    F+L              D F K+  + SH+EK 
Sbjct: 297  QFLHTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKC 356

Query: 335  KIVVSTFQILTTKMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDD 394
            +I++   Q LT+  +       +DADTL+ L L+V+CRS+V  L++HL YL+ F+   ++
Sbjct: 357  QILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENN 416

Query: 395  VKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRSGVAVS---LSSY 451
            VKFGL GY +ST EA L Y +     EK  K +     N+     I S    S   +  Y
Sbjct: 417  VKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVKLY 476

Query: 452  KNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALE 511
            K+    R+   ES L++CI   + + + EILLN+++   LED+L D +   +TLL++AL+
Sbjct: 477  KDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKALK 536

Query: 512  TGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKK 571
              ++  A+L++DV+ S+C+ +E  +Y NR+++  R  AHY+     ++++IGL+ +W+ K
Sbjct: 537  VENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIK 596

Query: 572  DVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMK 631
            D   +TPL  ICR YDQ  Y +M+  +F    ++   R +  +F DH D   N+LLHI+K
Sbjct: 597  DDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILK 656

Query: 632  GGIQSILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAI 691
              IQ +L   NIN+N  N+K +TPLM Y KYNR+ NI++I+ D+RLI+ K Q    L   
Sbjct: 657  CDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCY 716

Query: 692  DYVKNPMILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFSD-NSYSTLRQSVKN 750
            D+VKN +I   +G    +NS++ L SA  ++ E++ W L+ T K ++ +SY T   S+K 
Sbjct: 717  DFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLKI 776

Query: 751  IQGLLQFYNKKHPMNFLPIDHIL----SILKNIGKPGILPVINLENSIFLGLLTQLLSVI 806
            +  +++ YNK +P++F+P   +L     I+KN    GI     L+N  FL L++     +
Sbjct: 777  LFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQK---LKNRAFLNLISNYFGTL 833

Query: 807  GQRNEYMAVLRYNESDLSTWLRTNNFK-PRANKDERIEPEEVSSIQSFLKFNLSEFSEIK 865
             + +++   L  N   L+ W++    K  + N  +R+  ++++ I+SF++FN++E  ++ 
Sbjct: 834  IETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLN 893

Query: 866  EKFTILRKLVVFQSLKAQDIE------------CAQRIIYQQMEIVSNSVGPS-VEKTFI 912
                IL+KL  F +LK  D+               Q+ I  QM+ +   + P   +  F+
Sbjct: 894  RTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFL 953

Query: 913  GSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPS 972
                   LD     I F+ +C   +S     ++ + +  W  ++  LS+L+++Y+R+F S
Sbjct: 954  -----ILLDQ----ISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDF-S 1003

Query: 973  DFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEI 1032
            DF S +   E        Y + KR+  E ++   +    T    ++  +   HENLAEE 
Sbjct: 1004 DFDSRNGLNE---NILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEF 1060

Query: 1033 SFFVTFKNFAYESFVM 1048
            + F+TFK+  ++  ++
Sbjct: 1061 NKFLTFKSRFFKDVIL 1076

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  471 bits (1213), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 335/1110 (30%), Positives = 563/1110 (50%), Gaps = 82/1110 (7%)

Query: 15   AVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLSELCYNYDFVASH 74
            AVFNCP P  SP KKL+N ++ + F+LLVP+  +LL Y+D  S +   ELCY YDFVA+H
Sbjct: 15   AVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFRELCYTYDFVAAH 74

Query: 75   ILIQLQES----------KVTEQEYRTLNGNSVIIRSQAGI-VMSKPELRKCRVKSYEVL 123
            ILI  + S          K  +   ++LNG  V++R    I +      RK +++   +L
Sbjct: 75   ILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSLCIPIKGYFSKRKSQMRDATLL 134

Query: 124  RNFNDYLSNVIYFPLLHIDRPL-VGALVRNDELQVFGS-----YEMHNPSKSKTINTISE 177
             NFNDYL    +F ++HID PL V      DEL+ F       +   +  K   +    E
Sbjct: 135  TNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHSQDKDKPGLLQRTEE 194

Query: 178  NHIPFEKFIRLYPQ---LGAQLDGYFQRDR-----QRIRNEVDQLDKLIKIFKDLVIDVY 229
            N     KFI+L+ +      +L+ Y ++ +     Q I +E         +F D+V  +Y
Sbjct: 195  NKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSE---------LFHDIVNMIY 245

Query: 230  GVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNN 289
              +KE++ F+ +  L ++  EY+E  +Y+DIW KL +       D++  +     +SL+ 
Sbjct: 246  NTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQE----HYRDKILDFRLVSQLSLDM 301

Query: 290  VATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKME 349
            + T  Y     +F L                F  +   NS+++K  ++  T  I+T K  
Sbjct: 302  LDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNS 361

Query: 350  YTSID-------PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGY 402
              +I        P IDADTL+ L  ++LCR+ V+++  H++YL+ F    + VKFG  GY
Sbjct: 362  DDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGY 421

Query: 403  SLSTIEAVLAYF-EAGDGTE---KLKKLISLSEANRVFWDLIRS--GVAVSLSSYKNSLI 456
            +LSTIEA L+YF E  +  E   +L+KL  L +    F   IRS     + ++ +K+   
Sbjct: 422  TLSTIEATLSYFYELSNSDESRIQLQKLSLLED----FLIKIRSQHDDLIPINQFKDYFR 477

Query: 457  SRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDE 516
             R+   ES LS+ I   + + + E LLN+++   L+DLL+D + + STLLI+ L+  + E
Sbjct: 478  YRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLE 537

Query: 517  IAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMH 576
             AE+LI++  ++CTN+E   Y N+++   RT+AHY+     I+EKIG Y++W  KD+   
Sbjct: 538  AAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKGR 597

Query: 577  TPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQS 636
            T LF I R+YDQ  YS  +  + +    + +     F  +DH D  G+SLLHI+K  +  
Sbjct: 598  TALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSL 657

Query: 637  ILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKN 696
            +L   ++++N  N+KGMTPLM Y KYNRI+NI+ ILED RLI+ K+Q  + L  +DY KN
Sbjct: 658  LLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGKN 717

Query: 697  PMILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQ 756
              + NL+   ++K+ ++        ++E + WYL I+V+  D  Y+T    +K    L+ 
Sbjct: 718  FTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYTTNIIKLKKYYNLIN 777

Query: 757  FYNKKHPMNFLPIDHILSILKNIGKP-GILPVINLENSIFLGLLTQLLSVIGQRNEYMAV 815
               K +  +F+P   +L  LK I +   ILP+  L+   +L  L+  LS +    +   +
Sbjct: 778  AMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPL 837

Query: 816  LRYNESDLSTWLRTNNFKPRANKDER-----IEPEEVSSIQSFLKFNLSEFSEIKEKFTI 870
               +E+ +  W+ +   +   + D+      +  E++++I++F  F+  E  +       
Sbjct: 838  TLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQS 897

Query: 871  LRKLVVFQSLKAQDIECAQRIIYQQMEIVSN-----------SVGPSVEKTFIGSNENYS 919
              KL +F  +K  D+  +  I+ +     SN           S+ P V  + +     Y 
Sbjct: 898  FLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVHSSMVY----YE 953

Query: 920  LDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDV 979
            L    Q I F+  C   L+SK+   +  K+++W +   +L   R+EY   F    + +  
Sbjct: 954  L---SQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGN 1010

Query: 980  SGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFK 1039
              E +  F  ++    R++ E +L+  +      L+ L  E++  HE LAEE S +V  K
Sbjct: 1011 LSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMK 1070

Query: 1040 NFAYESFVMKTYANICIKH---HRNILQVI 1066
            +    + +++ + ++ + H     N++Q I
Sbjct: 1071 SKFNSNLLVRKFVSLNLAHLKEQSNLVQRI 1100

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  452 bits (1162), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 330/1114 (29%), Positives = 555/1114 (49%), Gaps = 90/1114 (8%)

Query: 15   AVFNCPTPTTSPLKKLFNNV-KGQRFILLVPSTDVLLQYQDLDSGLPLSELCYNYDFVAS 73
            A+ NC  P +SPLKKL+  + K  ++++LVP T++LL Y D +S   L +LCY  +F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HILI------------------------QLQESKVTEQEYRTLN-GNSVIIRSQAGIVMS 108
            HIL+                         +   K  +Q ++ +N  N VI          
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 109  KPELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLV-GALVRN--DELQVFGSYEMHN 165
            K   +   ++S  +  N+     N I   +++ID   + G L  N   ++ +  S  M +
Sbjct: 139  KNRAKILDIESIPIFNNYMKTTDNTI--TIMYIDDVFLNGTLECNLRSDIDLLRSPSMRS 196

Query: 166  PSKSKTINTI---------SENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDK 216
               +K  + I         S++   F+  +R+     ++ + +FQ+     R   +Q D 
Sbjct: 197  IPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQK----FRLLANQDDL 252

Query: 217  LIKIFKDLVIDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRV 276
             I +F +++ +++  +  D  F+N ++L N+  EYVELN+++DIW  ++++N   E D +
Sbjct: 253  PIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEID-L 311

Query: 277  SGYSSTKYISLNNVATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKI 336
            + + +   IS+  V +       + F L                  K+   +++  KA I
Sbjct: 312  NPFGN---ISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANI 368

Query: 337  VVSTFQILTTKME---YTSIDP---------TIDADTLIGLMLVVLCRSQVKNLKSHLEY 384
            ++ T + LT   E   Y+S +           IDAD L+ L ++V CR+Q+KNLK HL Y
Sbjct: 369  LILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSY 428

Query: 385  LREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRS-- 442
            L+ F     D KFG+ GY+LST+EAV+ YFE     E  +KLI    +N     ++ S  
Sbjct: 429  LQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTK 488

Query: 443  -----GVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFD 497
                      L  Y+ SL  R S  +S L++CI  GR D +  IL  Y+    +EDLL D
Sbjct: 489  KYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLAD 548

Query: 498  VNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFS 557
             +   STLLIQA++  +   A LL++++  NCT  E   Y+NR +   RT  H+L     
Sbjct: 549  ESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELE 608

Query: 558  IIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTD 617
            +++ +G Y++W +KD    TPLF I R+YDQ +Y EM+S+S EY   +    G++F++ D
Sbjct: 609  VLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLD 668

Query: 618  HEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRL 677
            H D  GN+LLHI+K  +  +L+  +INVN +N  G TPLM   +Y R ENIRD+L D RL
Sbjct: 669  HVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRL 728

Query: 678  IVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFS 737
             V   Q    L A D+ K+  I +L+G H   NS +  + A  +K+ ++ W L +TVK  
Sbjct: 729  RVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKLK 788

Query: 738  DNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLG 797
            D +  T   ++K ++G+L+   K +   FLP+  ++  L +  +     ++ ++    L 
Sbjct: 789  D-APKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLP 847

Query: 798  LLTQLLSVIGQRNEYMAVLRYN----ESDLSTWLRTN-NFKPRANKDERIEPEEVSSIQS 852
             ++  LS +     ++ VL  N    E +   W++ N +   + N+   I PE++S IQ+
Sbjct: 848  FISFCLSALV----HIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQN 903

Query: 853  FLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVSNSVGPSVEKTFI 912
            FLKFN++E    K K  I  KL +F  LK++D+  +       + IVS         T  
Sbjct: 904  FLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNE---NYVTIVSQLSSKRFRSTLK 960

Query: 913  GSNENYSLDSFQ------QAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREY 966
             S E+  L S +        I ++ +C + L + I  +  + ++ WW +YGEL +  + Y
Sbjct: 961  YSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHY 1020

Query: 967  QRNFPSDFKSSDVSGEESKGFFESYIEG-KRQKTEDKLQARLRVCITKLQTLSGELKKDH 1025
             R FP   + ++V+ E         I   KR K E++L  +++    +L ++  ++K+ H
Sbjct: 1021 TRAFP---ELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMH 1077

Query: 1026 ENLAEEISFFVTFKNFAYESFVMKTYANICIKHH 1059
            E  AEE+S F+  K      + +++Y  I  + H
Sbjct: 1078 ELAAEEVSRFIDLKTKFTLEYALQSYLTISKQEH 1111

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  445 bits (1145), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 327/1131 (28%), Positives = 568/1131 (50%), Gaps = 100/1131 (8%)

Query: 3    YHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62
            YH          ++FNCP P+ SPLKKL+ ++K + FILLVP T+ LL Y D  + + L 
Sbjct: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63

Query: 63   ELCY-NYDFVASHILIQLQESK--------------VTEQEYRTLNGNSVIIRSQAGIVM 107
            +LCY N DF+ +HIL+  ++S                + +++ TLNG++++++ +   ++
Sbjct: 64   DLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLV 123

Query: 108  ---SKPELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVR-NDELQVFGSYEM 163
                 P  +K +++  +VL NFNDYL    YF L+HID+PL+  ++R NDEL+ F +  +
Sbjct: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183

Query: 164  HN------PSKSKTINTISENHIP-FEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDK 216
            H+      P     I  +S++    FE  I        +   +    +     E    + 
Sbjct: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAE----EP 239

Query: 217  LIKIFKDLVIDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRV 276
               +FK +V   Y  +K +K F+ +  L  +  EY+E+N+Y+ +WL++  L      D  
Sbjct: 240  NETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALD--DET 297

Query: 277  SGYSSTKYISLNNVATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKI 336
             G +  K IS+  +    Y      F L              +   KL+  NS NEK++ 
Sbjct: 298  KG-TRIKNISIEEIDDKFYE----MFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSEN 352

Query: 337  VVSTFQILTT---------KMEYTSIDPTIDADTLIGLMLVVLCRSQVK--NLKSHLEYL 385
            +++T QILT          +      +  IDADTLI L+++++CRS++   +LK ++ YL
Sbjct: 353  LIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYL 412

Query: 386  REFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRSGVA 445
            ++F    + + FG+  Y++ST E V+  FE     +KLK    + E      DL +    
Sbjct: 413  KKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEKLIKVDDLKKVPKT 472

Query: 446  VSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTL 505
            +    +   L  RS   ES L  CI   + +   ++L++Y+E   ++++L D N   +TL
Sbjct: 473  IKWEQF---LTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTL 529

Query: 506  LIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLY 565
            L+QAL   + +I+ +LI++++ NC+N +  EY+N+ +   R V HYL     I++ IG Y
Sbjct: 530  LMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKY 589

Query: 566  LDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNS 625
            ++W+++D+   TPLF I R YDQ +Y E++S  F+    +    G  F  +DH D   NS
Sbjct: 590  VNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNS 649

Query: 626  LLHIMKGGIQSILSQPN-----INVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVS 680
            +LHI++  I  + +        I++NK N KG TPLM+Y KY+R+ N++ IL D RL+ +
Sbjct: 650  ILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFN 709

Query: 681  KIQNPQTLKAIDYVKNPMILNLIGTH-IAKNSLYGLLSADGIKFEDN---CWYLWITVKF 736
            + Q        DY  +  I N +G H +  N+++G +    +K   +    + L   +  
Sbjct: 710  RYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPD 769

Query: 737  SDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSIL-----KNIGKPGILPVINLE 791
             +N   T+   VK I  LL+   KK  ++ LP+D I+ +L     K   K  +  +  L 
Sbjct: 770  KENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLR 829

Query: 792  NSIFLGLLTQLLSV-----IGQRNEYMAVLRYNESDLSTWLRTNNFKPRAN------KDE 840
            N   L  LT  L       IG   +Y++++  +E+ L  W+   N K + N      + +
Sbjct: 830  NQSLLRRLTDCLDTLLFFDIGI--DYLSLIT-DETKLLGWVTNENTKLKHNVNKTHGEKK 886

Query: 841  RIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVS 900
             ++PE+++ IQSFLKFN+ E   +      L KL+ F  LK+ D++ ++      ++ + 
Sbjct: 887  SLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIK 946

Query: 901  N---------SVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTL 951
            N         S+ P +E   +  N+ Y+    +  ++F+  C   L+  I+ +L +++  
Sbjct: 947  NDQIAQATNRSLEPIIEMQSL-ENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPN 1005

Query: 952  WWRLYGELSSLRREYQRNFPSDF----------KSSDVSGE-ESKGFFESYIEGKRQKTE 1000
            WW+LYGEL  L + Y + FP +            S++VS +  + G F   IE +R K  
Sbjct: 1006 WWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAV 1065

Query: 1001 DKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTY 1051
             KL+  +      L+ L  E+ + HE LAEE++ ++ FK   ++  +++ +
Sbjct: 1066 KKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNW 1116

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  422 bits (1085), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 245/715 (34%), Positives = 403/715 (56%), Gaps = 14/715 (1%)

Query: 356  TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFE 415
            T+DADTLI L ++V+CRS+ K+LKSHL YL+ F+      KFG+ GY++ST+EAV+ YFE
Sbjct: 16   TMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFE 75

Query: 416  A-GDGTEKLKKLISLSEANRVFWDLIR----SGVAVSLSSYKNSLISRSSNCESSLSICI 470
                 T  + K  +L E  +   D +     +     L++YK+ L  R+   +S LSICI
Sbjct: 76   DFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSICI 135

Query: 471  HAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCT 530
               +  ++ +IL  Y+    +EDLL D     STLLI++++ G+ E A++LI +M+ NCT
Sbjct: 136  TNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNCT 195

Query: 531  NNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLH 590
              E   Y+N+++   RTVAHYL     I++ IG Y+DW++K+ +  TPLF I R+YDQ +
Sbjct: 196  EEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPN 255

Query: 591  YSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNI 650
            Y EM+  +F+    + R+    F + DH D  GNSLLH++K  I  +L    +++N+ N 
Sbjct: 256  YEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEENY 315

Query: 651  KGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKN 710
            KG+TPLM+Y KY R+ NI  I +D+RLI+ K+QN       DY K+  +L+ IG    K+
Sbjct: 316  KGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVKD 375

Query: 711  SLYGLLSADGIKFED-NCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPI 769
            SL+GL+    +++ + N      +V  ++  ++T   ++K IQGLL+   K +P  FLP+
Sbjct: 376  SLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLPL 435

Query: 770  DHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRT 829
            +  +  + ++ +  +  +   + +  L  LT   +V+    +    L  +E+ +  W+R 
Sbjct: 436  NTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMRI 495

Query: 830  N----NFKPRANKDER-IEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQD 884
            N    N KP   ++ + +EPEE++ IQSFL+FN  E S  K    ILRK+++F +LK+ D
Sbjct: 496  NTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSDD 555

Query: 885  IECAQRIIYQQMEIVSNSVGPSVEKTFIGSNENY---SLDSFQQAIEFIAMCLETLSSKI 941
             E A + + +    + NS   S  K  I ++  +   SL +  + + F+  C   LSS +
Sbjct: 556  FEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLEQCTIQLSSFV 615

Query: 942  QYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTED 1001
            Q +L  K+  WW+ YGE  +L + Y++ FP+  K    S   S+     +IE KR+++E 
Sbjct: 616  QIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETKREQSEQ 675

Query: 1002 KLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICI 1056
            +L  +++     L+ L  E+   HE LAEE+S ++ F+    +   +  +A   I
Sbjct: 676  RLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNI 730

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  418 bits (1074), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 313/1109 (28%), Positives = 546/1109 (49%), Gaps = 83/1109 (7%)

Query: 15   AVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLSELCYNYDFVASH 74
            AVFNC     SPL+K+++++    FILLVP T  L  Y D ++  PL ELC++ +FV+SH
Sbjct: 11   AVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHELCHSPEFVSSH 70

Query: 75   ILIQLQES-------------KVTEQEYRTLNGNSV--IIRSQAGIVMSKPELRKCR-VK 118
            IL +                  V E ++ T NG  +  +   Q+         R  R + 
Sbjct: 71   ILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDGFSFRSTRRIL 130

Query: 119  SYEVLRNFNDYLSNVIYFPLLHIDRPLVGA--LVRNDELQVFGSYEMHNPSKSKTINTIS 176
             YE L +F +YL     F L++ID+PL+    L++ ++L  F +  ++    ++++  +S
Sbjct: 131  KYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTTPSTRSLANLS 190

Query: 177  ENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDK-LIKIFKDLVIDVYGVIKED 235
               +P ++   L   + AQ +  F+   Q  R E+ Q +  LI  F+  +  +Y  +  D
Sbjct: 191  SAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGFRKTIDKIYDGL--D 248

Query: 236  KNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSST--KYISLNNVATI 293
             +F     +  + QEYVE N+Y+D+W  L+  N ++        SS   ++ISL+ + T 
Sbjct: 249  NSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDIFRFISLDQLDTD 308

Query: 294  LYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTS- 352
             Y    + F L                F  LS+T+++ EK +++V T QIL+  ++    
Sbjct: 309  FYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETLQILSKPVKRVGG 368

Query: 353  IDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLA 412
                I ADTL+ L ++++ R+++KN++ HL YL+ F    + +KFGL GY++ST+EAV+ 
Sbjct: 369  YQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAVIC 428

Query: 413  YFEAGDGTEKLKKLISLSEAN-RVFWDLIRSGVAVS-----LSSYKNSLISRSSNCESSL 466
            Y E  +  ++    I  ++AN   F  L+     VS     LS Y ++   R+ +  S+L
Sbjct: 429  YLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKYSHNFRYRNGDGNSTL 488

Query: 467  SICIHAGRLDLIKEILL-NYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVM 525
            S+CI   + D+  E+L  NY+     EDLL D     +TLL+Q+L+  + EI E L D+M
Sbjct: 489  SLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEITEYLTDIM 548

Query: 526  ISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRA 585
            + N T  E Y Y  + +   R + HY+    ++++KIG Y+ W  KD    TPL +I R+
Sbjct: 549  LKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQTPLCVIFRS 608

Query: 586  YDQLHYSEMLSRSFEYVFE-YCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNIN 644
            YDQ  Y  M+  SF    E Y   +   F F DH D  GN+LLHI+K  I  +L  P+++
Sbjct: 609  YDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISFLLQSPDVD 668

Query: 645  VNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKI----QNPQTLKAIDYVKNPMIL 700
            +NK N +G++PL   A Y+R EN+  +L+D RLI S      Q P T  A      P++ 
Sbjct: 669  INKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFDFLKQYPNTKSA------PILS 722

Query: 701  NLIGTHIAKNSLYGLLSADGIKFE-DNCWYLWITVKFSDNSYSTLRQ---SVKNIQGLLQ 756
            +     +   + +  + A    F   N   + +T +  +++   +      +KN++ L +
Sbjct: 723  HYC---LDNEAPFRNIIASHFDFRISNKRSVVLTSRSKEDAQELIGSEAFELKNLKALFR 779

Query: 757  FYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEY---- 812
               K+HP  F P++ +L  L  + K      + +++S    +L +L   +    E     
Sbjct: 780  LLLKQHPFTFFPLEELLDELSVVEKTASSRSL-MKSSFCSKVLKKLTYCLDSMVEMELLP 838

Query: 813  ------MAVLRYNESDLSTWLRTNNFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKE 866
                  +A+L  + +     +     K R+ KD++++PE + +I +FLK+ L    ++K 
Sbjct: 839  TAALQSVALLERHIAKEKVTVDEEKLKRRS-KDKKMQPESIGTITTFLKYILESLLKLKG 897

Query: 867  KFTILRKLVVFQSLKAQDIECAQRIIYQ-QMEIVSNSVG------PSVEKTFIGSNENYS 919
                LRK  +   LK++DI  ++ I+     E+ S  +G       +++  F+G  +++ 
Sbjct: 898  TIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKKIGRAMVRYSTIDNKFLGE-QSFD 956

Query: 920  LDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGEL--------SSLRREYQR--- 968
            L  FQ  I F   CL ++ + I ++L  K+  WW+ YG+L        S L RE      
Sbjct: 957  LLVFQ--IHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQT 1014

Query: 969  -NFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHEN 1027
             N  ++  +S        G   ++IEGKR K +++ +A +     +L+ L  E+  ++  
Sbjct: 1015 PNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTL 1074

Query: 1028 LAEEISFFVTFKNFAYESFVMKTYANICI 1056
            +  E   F+ F++    S +++ +  + I
Sbjct: 1075 VVIEYCIFINFQSKFIHSAMLEKWVKLNI 1103

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  375 bits (962), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 345/1198 (28%), Positives = 569/1198 (47%), Gaps = 174/1198 (14%)

Query: 3    YHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62
            YH          AVFNCP P+ SP KKLF  +K Q+FILLVP T  LL Y D    L L+
Sbjct: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63

Query: 63   ELCY-NYDFVASHILI------QLQESKVT--EQEYRTLNGNSVIIRSQAGIVMSKPEL- 112
            ELCY N DF+ SHIL         ++S  T  ++E+  LNGN  II+ +  I+ ++    
Sbjct: 64   ELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFS 123

Query: 113  --RKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPL-VGALVRNDELQVF-------GSYE 162
              ++ ++     L NFNDY      F L+ ID+P+ V +L+ ND L+          S E
Sbjct: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183

Query: 163  MHNP--------SKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQL 214
               P        SKS   N +++N     KF       G   + Y        + E  +L
Sbjct: 184  KETPLVQDLSQQSKSSFENDLNKNEAWNLKF-------GILSNNY--------KIESSEL 228

Query: 215  DKLIKIFKDLVIDVYGVIKEDKNFRNYM-----ELLNVTQEYVELNMYEDIWLKL--VQL 267
            +   K+F++LV + +  I   K F+        +L  +T +Y+E ++Y++IW ++  + +
Sbjct: 229  EPNHKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMM 288

Query: 268  NGSKE-PDRVSGYSSTKYISLNNVATILYPEGTNSFDLXXXXXXXXXXXXXXDCFAKLSL 326
            N  K   D        K+ S+  +     P   + F L               C  KL  
Sbjct: 289  NSVKNYADDQKAQHLIKHFSIVEID----PNFYDIFPLKFVPMLEKNLKHSVTCINKLKS 344

Query: 327  TNSHNEKAKIVVSTFQILTTK-------MEYTSIDPTIDADTLIGLMLVVLCRSQV--KN 377
            T S+ EK+ I++ + QI+T          +       IDAD L+ L+ +V+ +S +   +
Sbjct: 345  TKSYTEKSTILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHD 404

Query: 378  LKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFW 437
            LK++L YL+ F+       FG+  Y+++T   V    E     ++LK+   L E      
Sbjct: 405  LKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIE------ 458

Query: 438  DLIRSGVAVSLSSY-----KNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLE 492
            +LI +    +LSS      K  L+ R+SN ES L++ I   +     + L+ Y++ + ++
Sbjct: 459  ELIMTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMD 518

Query: 493  DLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNN-EFYEYVNRSNSAGRTVAHY 551
             +  D +  +STLL+QA+ + + E A +L+ ++  NC N  E   Y+N+ +   R + HY
Sbjct: 519  IISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHY 578

Query: 552  LPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGE 611
            L    +I++ IG +++W++KDVN  TPLF I R+YDQ +Y E++ + F+   ++      
Sbjct: 579  LVINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNL 638

Query: 612  DFSFTDHEDPMGNSLLHIMKGGIQSILSQPN-----INVNKSNIKGMTPLMLYAKYNRIE 666
             F   DH+D  GNSLLHI++  I  +L         IN+NK N KG TPLM+Y KY R +
Sbjct: 639  KFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYD 698

Query: 667  NIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNS-LYGLLSADGIKFED 725
            NIR I+++++LI +K Q+P  +   DY  +  I+N IG  +  N  L+G +    +K + 
Sbjct: 699  NIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQM 758

Query: 726  NC-------WYLWITVKFSDNSYSTLRQSVK--NIQGLLQFYNKKHPMNFLPIDHIL--- 773
            +         Y+  T+   +   STL +++K  ++   L+   +K+ ++FLP+D +L   
Sbjct: 759  STVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNES 818

Query: 774  -SIL----KNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLST--- 825
             S L    KN      +P+  +E       L +L + +        +L +++S ++T   
Sbjct: 819  QSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLD------VLLHFDDSTIATPLL 872

Query: 826  --------W-------LRTNNFKPRANKD----------ERIEPEEVSSIQSFLKFNLSE 860
                    W       LR ++  P A             + ++PE ++ IQ+FLKFNL+E
Sbjct: 873  LSETELLEWISIEESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNE 932

Query: 861  FSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVSNSVGPS-VEKTF-------I 912
             + I     +L KLV+F +LK  DI  AQ      ++ ++N   PS +EK+F        
Sbjct: 933  LNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRY 992

Query: 913  GSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFP- 971
              ++   L+S  + I F   C   L   ++ ++  K+  WW+LYGEL  L + Y +NFP 
Sbjct: 993  DDDKGVLLESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPN 1052

Query: 972  -------SDFKS-------------------------SDVSGEESKGFFESYIEGKRQKT 999
                   +D  S                         S+     + G F + IE ++ K 
Sbjct: 1053 CVVHARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKL 1112

Query: 1000 EDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIK 1057
            E K    +   I+ L++L   L   HE+LAEE++ ++ FKN  +   +MK +    IK
Sbjct: 1113 ERKTSHHIDETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  340 bits (872), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 304/1152 (26%), Positives = 537/1152 (46%), Gaps = 168/1152 (14%)

Query: 43   VPSTDVLLQYQDLDS-----------GLPLSELCYN-YDFVASHILIQLQESKVTEQE-- 88
             P TD+LL Y D  +             PL +LC N YDF+ASHIL  L +SKV + +  
Sbjct: 42   APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHIL--LYDSKVIKNDQC 99

Query: 89   -YRTLNGNSVIIRSQAG-----------IVMSK----PELRKCRVKSYEVLRNFNDYLSN 132
               ++NG ++ I+   G           I  SK    P+ +  ++   ++  NFN YL  
Sbjct: 100  VMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPK-KMLKIIKMDLWHNFNSYLQG 158

Query: 133  VIYFPLLHIDRPLVGALVRNDELQVFGS--------YEMHNPSKSKTINTISENHIPFEK 184
            +  +P+ +ID PL   +++N+ L  F           ++  P       T  +NH     
Sbjct: 159  MENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNH-KIRN 217

Query: 185  FIRLYPQLGAQLDGYFQR----DR---QRIRN-------------------EVDQLDKLI 218
              +L P +     G F +    DR   Q + N                   + +Q D  I
Sbjct: 218  ISKLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNI 277

Query: 219  KIFKDLVIDVYGVIKEDK--NFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRV 276
            ++ +D+  D++  +K++K  NF ++  L+ +  E++E+ +++DIW ++      K  +  
Sbjct: 278  EMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRI----SFKFTESD 333

Query: 277  SGYSSTKYISLNNVATILYPEGT-NSFDLXXXXXXXXXXXXXXDCFAKLSLTNSHNEKAK 335
              +S    IS+N +    Y      +F L                F K     +  EK+ 
Sbjct: 334  FDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKST 393

Query: 336  IVVSTFQILTTKMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDV 395
             ++ T QILT       I+   DADTLIGL+ +V+CR +V+NLKSHL YL+ FA  P+ +
Sbjct: 394  ALIKTLQILT-------INKLTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTI 446

Query: 396  KFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSL 455
            KFG+ GYS+ST+EA+  YF+    + K   LI+  +     +D I + +     S  N +
Sbjct: 447  KFGILGYSISTLEAITYYFDHISHSHK-ADLIAFCDKLHNLYDTILNNIK----SLDNDI 501

Query: 456  IS-RSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGH 514
            +S RS N ES LS+CI   ++D+  E+L  Y+    +ED+L D +   S+LL+QA +  +
Sbjct: 502  LSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNN 561

Query: 515  DEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHY--LPQAFSIIEKIGLYLDWRKKD 572
               +E+L+ ++ ++C   E   ++N+++   R+VAHY  +  +  I+ + G  +DW  KD
Sbjct: 562  YVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKD 621

Query: 573  VNMHTPLFIICRAYDQLHYSEMLSRS-FEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMK 631
            +   TPL  I + + +++Y+E   +  F  V  + +   + F+   H D  GN+LLH+MK
Sbjct: 622  IKKLTPLLTIFKVH-KVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMK 680

Query: 632  GGIQSILSQP----NINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQT 687
              I  ++  P     IN+N +N KG++P M+Y K NR +NIR IL++  LI S+ Q P  
Sbjct: 681  DYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFL 740

Query: 688  LKAIDYVKNPMILNLIGTHIAKNSLYGLLSADGIKFEDN---------CWYLWITVKFSD 738
            + + + + N  + +L+ TH  +   +  +    ++F D           W + I++   +
Sbjct: 741  ITSTN-LYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKE 799

Query: 739  NSYSTLRQSV--------KNIQGLLQFYNKKHPMNFLPIDHILSILKNIGK--------- 781
            + + T   S+        K I+ LL  + +K+  + LP+   L    ++ K         
Sbjct: 800  SEFPTSHPSICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTS 859

Query: 782  -----PGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRTNN----- 831
                 P  L +  LE    L L++  L+ +    ++   L ++E  L  +L+ NN     
Sbjct: 860  NRHFLPLSLLIDKLEIQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKE 919

Query: 832  ------FKPRANKDERIE------PEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQS 879
                  F  + N D+  E      PE++++IQ+F+KFNL E    K   T ++ + +   
Sbjct: 920  SNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIK 979

Query: 880  LKAQDIECAQRIIYQQ--MEIVSNSVGP-----SVEKTFI----GSNENYSLDSFQQAIE 928
             K  D+  +Q   +Q+  ++I  N++       S +K  I     S + Y  +S+   +E
Sbjct: 980  YKIMDLNSSQ-FFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVE 1038

Query: 929  FIAMCLET------LSSKIQY----VLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSD 978
            F+   LE       L  K+ Y    + +  +  WW  YG L     +Y +++P+     +
Sbjct: 1039 FLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDIN 1098

Query: 979  VSGEESKGFFESYIEGKR-QKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVT 1037
             + E     F+  +        E  +   ++   T L+  + ++K  HENLA E++ F+ 
Sbjct: 1099 NNFESFNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMN 1158

Query: 1038 FKNFAYESFVMK 1049
            FKN     +++K
Sbjct: 1159 FKNKFIREYIIK 1170

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  219 bits (558), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 243/840 (28%), Positives = 389/840 (46%), Gaps = 105/840 (12%)

Query: 253  ELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNV-ATILYPEGTNSFDLXXXXXXX 311
            E  +Y  IW KLV    + EP  +  +    YIS + +     Y    N F L       
Sbjct: 179  EARLYSSIWNKLVH--QTSEPQNIDKFYGC-YISFHELNINDYYSLPFNKFSLRDVVFIE 235

Query: 312  XXXXXXXDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDADTLIGLMLVVLC 371
                     F KL  + S +EK  I++STF ILT+K+    ID    AD L+  ML+++ 
Sbjct: 236  NVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLEID----ADNLLNFMLIIIN 291

Query: 372  RSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSE 431
            R ++ NL  H  YL+ F  + +   FG+  Y++ST+ AVL Y +  +  +K K+     +
Sbjct: 292  RVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYID--NNLDKFKRYTDAIQ 348

Query: 432  ANRVFWDLIRSGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLN--YQEQI 489
             +++                +  L  R+ N ES L  CI     D ++E+L +  Y +  
Sbjct: 349  DSKI---------------SEEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNF 393

Query: 490  KLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVA 549
             +ED+L D     STLL+ A++  +   A +LI+++I+N T +E   YVN  +   R V 
Sbjct: 394  PMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDENNRNVG 453

Query: 550  HYLPQAFSIIEKIGLYLDWRKKDVNM-HTPLFIICRAYDQ--LHYSEMLSRSFEYVFEYC 606
            H++   + ++ KIG YL+W  KD     TPLF I R+YDQ    Y +M  RSF +  +  
Sbjct: 454  HFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRFAMD-- 511

Query: 607  RRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYAKYNRIE 666
                 DF    H D   N+LLHI+K  IQ IL   ++ +N  N  GMTPLM++ KY R+ 
Sbjct: 512  ---SGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRRLY 568

Query: 667  NIRDILEDK-RLIVSKIQNPQTLKA----IDYVKNPMILNLIGTHIAKN-SLYGLLSADG 720
            NI+ +L  K +  VS  +  Q   A         +  ILNL+G    KN S++G      
Sbjct: 569  NIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFTHS 628

Query: 721  IK--------FEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFY--NKKHPMNFLPID 770
            +K           N + + IT+KF +  Y T+R ++K I+ L+     +  H  +FLP+ 
Sbjct: 629  LKQFLHKSKHGNKNQYSVKITLKF-EKKYKTIRFNIKTIKALINMVLTSNSHVSSFLPLY 687

Query: 771  HILSILKNIG-----KPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLST 825
             + + L  I      K  IL + NL     + L T L   +  R  ++      E+ L  
Sbjct: 688  KVFNELNGIASMISTKSKILFINNLN----VILDTILFLELVPREGFIL-----EARLKD 738

Query: 826  WLRTN-NFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKF-TILRKLVVFQSLKAQ 883
            +LR     K  A K ++++ E+++ I +FLKFNL+E +  K     ILR++    +LK  
Sbjct: 739  YLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQMNSI-NLKLF 797

Query: 884  DIECAQRIIYQQMEIVSNSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQY 943
            D    QRI Y  + +    V   +       N N  + +FQ     I   L  L    + 
Sbjct: 798  D----QRISYMDL-LHCPDVVVHLNNPLWNLNYNILISNFQILENSIDNTLHFL----KV 848

Query: 944  VLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKL 1003
              + K+  WW+L  EL +L +           +S+   +  + FF      +++K   ++
Sbjct: 849  FQNEKIRKWWKLNNELINLTK----------LASNSDDDLLRSFF-----NRKEKLSIEI 893

Query: 1004 QARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNIL 1063
              ++R     +  L+ ++   HE LA EI+ F+ FK      F+ +T   + +  HRN L
Sbjct: 894  DDKIR----SINELNCDIFVSHELLAVEINNFMKFKPL----FITRT---LVVWAHRNCL 942

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  161 bits (407), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/274 (33%), Positives = 145/274 (52%), Gaps = 15/274 (5%)

Query: 3   YHXXXXXXXXXXAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62
           YH          A+FNCP P  SPLKKLF N+K +RFILL P ++ LL Y D+ S LPL 
Sbjct: 4   YHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLH 63

Query: 63  ELCYNYDFVASHILIQLQESKVT----EQEYRTLNGNSVIIRSQAGIVMSKPEL---RKC 115
           +LCYN +F+ S+IL+  + S +     +  Y TL+G +V+I+ +  ++ +       R+ 
Sbjct: 64  DLCYNAEFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFHIRRRL 123

Query: 116 RVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEM----HNPSKSKT 171
           ++   ++L NFNDY      F +L ID+PL    V ND LQ F +YE      +   + +
Sbjct: 124 KILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKNAHAMPNLS 183

Query: 172 INTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGV 231
           I++  +    FE  + ++P    QL   F   R     +    D    IF+ +V   +  
Sbjct: 184 IDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGD----DPSRSIFESIVQQAFDG 239

Query: 232 IKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLV 265
           +K D  F+N+  L ++  +Y ELN+Y+DIW +L 
Sbjct: 240 MKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLT 273

>TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {ON}
           Anc_6.265 YPL239W
          Length = 200

 Score = 40.0 bits (92), Expect = 0.014,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 2/89 (2%)

Query: 463 ESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLI 522
           + S+ +   AG L+ +KEI         L  +    ++  ST L  A   GH ++ + L+
Sbjct: 13  QDSIILDARAGDLESLKEIFTTLIHPKLL--ITCSESETKSTALHMACANGHTDVVKYLL 70

Query: 523 DVMISNCTNNEFYEYVNRSNSAGRTVAHY 551
            ++  N T+ E  +YVN+ N  G T  H+
Sbjct: 71  TLVKENATSEELKDYVNKQNETGNTALHW 99

>Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W
           (REAL)
          Length = 1077

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 12/83 (14%)

Query: 444 VAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQ--- 500
           +AVS    +   I R S   + L I    G+ D++K++L         E+  +D+N    
Sbjct: 301 IAVSKRPKQKKGIYRDSGGRTRLQIACDKGKFDVVKKML---------EEGGYDINDQDN 351

Query: 501 ANSTLLIQALETGHDEIAELLID 523
           A +T L +A   GH EI ELLI+
Sbjct: 352 AGNTALHEAALQGHIEIVELLIE 374

>Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W
           (REAL)
          Length = 1141

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 12/83 (14%)

Query: 444 VAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQ--- 500
           +AVS    +   I R S   + L I    G+ D++++++         ED  +D+N    
Sbjct: 369 IAVSKRPKQKKGIYRDSGGRTRLQIACDKGKFDVVQKMI---------EDGGYDINDQDN 419

Query: 501 ANSTLLIQALETGHDEIAELLID 523
           A +T L +A   GH EI ELLI+
Sbjct: 420 AGNTALHEAALQGHIEIVELLIE 442

>YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subunit
           of the Set3 complex, which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity; potential Cdc28p substrate
          Length = 1083

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 442 SGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQ- 500
           S +AVS    +   I R S   + L I    G+ D++K+++         E+  +D+N  
Sbjct: 310 SHIAVSKRPKQKKGIYRDSGGRTRLQIACDKGKYDVVKKMI---------EEGGYDINDQ 360

Query: 501 --ANSTLLIQALETGHDEIAELLID 523
             A +T L +A   GH EI ELLI+
Sbjct: 361 DNAGNTALHEAALQGHIEIVELLIE 385

>TDEL0G02830 Chr7 complement(546686..548995) [2310 bp, 769 aa] {ON}
           Anc_2.353 YMR160W
          Length = 769

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 65/135 (48%), Gaps = 13/135 (9%)

Query: 784 ILPVINLENSIFLGLLTQLLSVIGQR--NEYMA---VLRYNESDLSTWLRTNNFKPR--- 835
           IL  +NL ++ F+ +L  L      R  NEY     + +  +S+L +WL+  + K R   
Sbjct: 522 ILLALNLGHTKFVPILKLLSPYFISRSFNEYTVSPNLRKQTQSELKSWLQDMDVKWRTTN 581

Query: 836 -ANKDERIEPEEVSSIQSFLKFNLSEFSEIKE--KF--TILRKLVVFQSLKAQDIECAQR 890
            +N+     PE VSS+  FL+F L   +   E  KF   I    +V+++     ++    
Sbjct: 582 SSNQPHDELPETVSSVHKFLEFALYHDTRNPELVKFHSDIYDDDMVYKNFIENTLKTRSP 641

Query: 891 IIYQQMEIVSNSVGP 905
           +I + + ++S+  GP
Sbjct: 642 LIEKHLALLSDHSGP 656

>Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W
           (REAL)
          Length = 1085

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 12/84 (14%)

Query: 442 SGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQ- 500
           S +A+     +   I R S   + L I    G+ D++K ++         E+  +D+N  
Sbjct: 306 SHIAIPKRPKQKKGIYRDSGGRTRLQIACDKGKFDVVKNMI---------EEGSYDINDQ 356

Query: 501 --ANSTLLIQALETGHDEIAELLI 522
             A +T L +A   GH EI ELLI
Sbjct: 357 DNAGNTALHEAALQGHIEIVELLI 380

>TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa]
           {ON} Anc_8.876 YML097C
          Length = 503

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 359 ADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAY 413
           ADT I L++  L +S ++NL S++ Y+  F  R ++   G   Y LS+++A + +
Sbjct: 258 ADTFIPLLIYTLLKSDIENLVSNVRYIERF--RFENFIRGEESYYLSSLQAAINF 310

>NCAS0C01900 Chr3 complement(351773..353125) [1353 bp, 450 aa] {ON}
           Anc_8.582 YPL103C
          Length = 450

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 142 DRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQ 201
           DR   G L++   LQV G YE  NP     I TI E    F + + +           F+
Sbjct: 85  DRSFKGTLIKYSPLQVLGRYE--NPFTEYRIQTIYEFF--FNRIVEV-----------FE 129

Query: 202 RDRQRIRNEVDQLDKLIKIFK 222
           R+R  I  +  Q+D+L+ + K
Sbjct: 130 RNRGGIPPDKHQMDQLMPVHK 150

>KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 171

 Score = 32.7 bits (73), Expect = 2.5,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 18/111 (16%)

Query: 617 DHEDPMGNSLLHIM-KGG----IQSILSQPNINVNKSN-IKGMTPLMLYAKYNR------ 664
           D +DP+GN+ +H+  K G    +  +L Q  ++VN+ N I G T L L   Y+       
Sbjct: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102

Query: 665 ---IENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLI-GTHIAKNS 711
               EN+ ++  D R+   + Q P  L   D +++  ++NL+ G  IA ++
Sbjct: 103 TFIAENLIEVGADPRIRNKRGQTPLQLVHSDELES--LVNLLQGAEIAADN 151

>Kpol_1002.18 s1002 (48873..49493) [621 bp, 206 aa] {ON}
           (48873..49493) [621 nt, 207 aa]
          Length = 206

 Score = 32.3 bits (72), Expect = 4.0,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 501 ANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHY 551
           +NST L  A   GH  + + L+++  +N    +  E+VN +N  G T  H+
Sbjct: 49  SNSTALHMAAANGHLGMIQYLLEMAKNNGDEEKLKEFVNATNETGNTALHW 99

>Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AFR268C
          Length = 170

 Score = 31.6 bits (70), Expect = 6.0,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 10/97 (10%)

Query: 617 DHEDPMGNSLLHIM-KGGIQSILS-----QPNINVNKSNIKGMTPLMLYAKYNRIENIRD 670
           D +DP GN+ LH+  K G   +L         I ++  N++G TPL    KY+  E    
Sbjct: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHG 101

Query: 671 ILEDKRLIV----SKIQNPQTLKAIDYVKNPMILNLI 703
                 LI      +I+N    K I+ + N    +LI
Sbjct: 102 TFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLI 138

>Smik_13.38 Chr13 complement(75428..76786) [1359 bp, 452 aa] {ON}
           YML097C (REAL)
          Length = 452

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 50/93 (53%), Gaps = 3/93 (3%)

Query: 321 FAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKS 380
            +K++   S  +K   V++  +++   +++T ++    ADT I +++  + + QV+ L S
Sbjct: 214 LSKINRFKSPRDKMVCVLNASKVIFGLLKHTKLEQN-GADTFIPILIYCILKGQVRYLVS 272

Query: 381 HLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAY 413
           ++ Y+  F  R  D   G   Y LS+++A + +
Sbjct: 273 NVNYIERF--RSSDFIRGEEEYYLSSLQAAINF 303

>Smik_6.443 Chr6 complement(724235..724834) [600 bp, 199 aa] {ON}
           YPL239W (REAL)
          Length = 199

 Score = 31.6 bits (70), Expect = 8.4,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 26/53 (49%)

Query: 499 NQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHY 551
           +++NST L  A   GH E    +++ +    +  E   ++N +N  G T  H+
Sbjct: 47  SESNSTALHMAAANGHIETVRYILETVALENSAKELKAFINEANETGNTALHW 99

>YML097C Chr13 complement(78335..79690) [1356 bp, 451 aa] {ON}
           VPS9A guanine nucleotide exchange factor involved in
           vesicle-mediated vacuolar protein transport;
           specifically stimulates the intrinsic guanine nucleotide
           exchange activity of Vps21p/Rab5: similar to mammalian
           ras inhibitors; binds ubiquitin
          Length = 451

 Score = 32.0 bits (71), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 49/93 (52%), Gaps = 3/93 (3%)

Query: 321 FAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKS 380
             K++   S  +K   V++  +++   +++T ++    AD+ I +++  + + QV+ L S
Sbjct: 213 LGKINRFKSPRDKMVCVLNASKVIFGLLKHTKLEQN-GADSFIPVLIYCILKGQVRYLVS 271

Query: 381 HLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAY 413
           ++ Y+  F  R  D   G   Y LS+++A L +
Sbjct: 272 NVNYIERF--RSPDFIRGEEEYYLSSLQAALNF 302

>AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR175W
           (SWD3)
          Length = 320

 Score = 31.6 bits (70), Expect = 9.7,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 40  ILLVPSTDVLLQYQDLDSGLPLSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVII 99
           IL   S D L++  D +SG  L  L Y+ D+     ++ + + K +       NG  +++
Sbjct: 153 ILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPISQVKFSR------NGKFLLV 206

Query: 100 RSQAGIVMSKPELRKCRVKSYE 121
           RS  G+V     +R C V++++
Sbjct: 207 RSLDGVVKLWDFIRGCVVRTFK 228

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 113,437,815
Number of extensions: 5174107
Number of successful extensions: 17433
Number of sequences better than 10.0: 79
Number of HSP's gapped: 17794
Number of HSP's successfully gapped: 80
Length of query: 1079
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 959
Effective length of database: 39,721,479
Effective search space: 38092898361
Effective search space used: 38092898361
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)