Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30236.19ON34934917910.0
ACR007W6.19ON31323710161e-138
Smik_15.1756.19ON31224110121e-137
SAKL0E01144g6.19ON43024010221e-137
YOR006C (TSR3)6.19ON31323810091e-137
KLLA0D01111g6.19ON31424310061e-136
Suva_15.1816.19ON33623910041e-136
KNAG0M011506.19ON3072389961e-135
Skud_15.1676.19ON3122389931e-134
TDEL0G045006.19ON3012389891e-134
CAGL0E02717g6.19ON3252409851e-133
Kpol_1037.246.19ON3662409671e-130
TPHA0J003206.19ON3422439621e-129
KLTH0C11264g6.19ON3462369431e-126
Kwal_56.224216.19ON3372299221e-123
ZYRO0C07832g6.19ON2812469141e-123
NCAS0H008106.19ON3232498641e-115
NDAI0D007906.19ON4012658651e-114
KAFR0L003906.19ON3292218161e-107
TBLA0A072506.19ON3042427594e-99
CAGL0E03454g4.46ON867104840.066
ACL172C3.245ON631117840.075
TBLA0D050301.377ON80078760.72
NDAI0C054008.520ON1838130741.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3023
         (349 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   694   0.0  
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   395   e-138
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   394   e-137
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   398   e-137
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   393   e-137
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   392   e-136
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   391   e-136
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   388   e-135
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   387   e-134
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   385   e-134
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   384   e-133
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   377   e-130
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   375   e-129
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   367   e-126
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   359   e-123
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   356   e-123
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   337   e-115
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   337   e-114
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   318   e-107
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   296   4e-99
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    37   0.066
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    37   0.075
TBLA0D05030 Chr4 complement(1239797..1242199) [2403 bp, 800 aa] ...    34   0.72 
NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_...    33   1.5  

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/349 (96%), Positives = 336/349 (96%)

Query: 1   MGKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRCS 60
           MGKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRCS
Sbjct: 1   MGKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRCS 60

Query: 61  GKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPF 120
           GKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPF
Sbjct: 61  GKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPF 120

Query: 121 EKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGF 180
           EKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGF
Sbjct: 121 EKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGF 180

Query: 181 LELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNASK 240
           LELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNASK
Sbjct: 181 LELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNASK 240

Query: 241 ELHPYXXXXXXXXXXXXXFKSDLSDSNNDLCVANISKEDNNKEYGLVYRSPSEISSDRDC 300
           ELHPY             FKSDLSDSNNDLCVANISKEDNNKEYGLVYRSPSEISSDRDC
Sbjct: 241 ELHPYSDIDDIDEDETSDFKSDLSDSNNDLCVANISKEDNNKEYGLVYRSPSEISSDRDC 300

Query: 301 IKDNTSFEVDFLGTKSQNSDKCKDKILLNSLNYVDNKIRNLSLDLEENI 349
           IKDNTSFEVDFLGTKSQNSDKCKDKILLNSLNYVDNKIRNLSLDLEENI
Sbjct: 301 IKDNTSFEVDFLGTKSQNSDKCKDKILLNSLNYVDNKIRNLSLDLEENI 349

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  395 bits (1016), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 182/237 (76%), Positives = 206/237 (86%), Gaps = 1/237 (0%)

Query: 1   MGKGRNKDYD-KNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRC 59
           M KG+NK  + +    KGS+ H+ ++N RR E K+   + ++FP  LAMWDFDHCDPKRC
Sbjct: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 60

Query: 60  SGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIP 119
           SGKKLERLGLIKSLR+ QKFQGIVVSPNGKTVVCPND+EI E++GVSVVECSWARL+EIP
Sbjct: 61  SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 120

Query: 120 FEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLG 179
           F KIGGRHERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLAE LLSHFSWG G
Sbjct: 121 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 180

Query: 180 FLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236
           FLELN+E+LE YQ+CTDH SIKAAEEAWL+++E EA +RRKQT E DIWMMGNVNRK
Sbjct: 181 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRK 237

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  394 bits (1012), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 182/241 (75%), Positives = 205/241 (85%), Gaps = 2/241 (0%)

Query: 1   MGKGRNKDYDKNHS--QKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKR 58
           MGKG+NK ++  +   Q+G+NGHSSR NHRR+E KY      KFPV LAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118
           CSGKKLERLGLIKSLRV QKFQGIVVSPNGK VVCP+D E+ E++G SVVECSWARLEE+
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178
           PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A  LLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNA 238
           GFLELNKE+LEIYQ+CTD DS+K AEE WL+++E E  ER+ Q KE DIWMMGN+NR+  
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

Query: 239 S 239
            
Sbjct: 241 G 241

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  398 bits (1022), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 185/240 (77%), Positives = 215/240 (89%), Gaps = 4/240 (1%)

Query: 1   MGKGRNKDYDKNHSQ--KGSNGHSSRTNHRRIETKY--NAIQGSKFPVTLAMWDFDHCDP 56
           MGKG+NK++++  S+  +G+NGHSSR NH+R+E K   ++  G+KFPV LAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 57  KRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLE 116
           KRCSGKKLERLGLIKSLRV QKFQGIVVSPNG+ VVCPNDR I E++G SVVECSWARL+
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 117 EIPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSW 176
           E+PF +IGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA  LLS+FSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 177 GLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236
           GLGFLELNKE+LEIYQ+CTD DS+KAAEEAWLK+IE EA +R++Q+KE DIWMMGNVNR+
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  393 bits (1009), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 207/238 (86%), Gaps = 2/238 (0%)

Query: 1   MGKGRNKDYDKNHS--QKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKR 58
           MGKG+NK ++  +   Q+G+NGHSSR NHRR+E KY+  +  KFPV LAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118
           CSGKKLERLGLIKSLRV QKFQGIVVSPNGK VVCP+D EI E++G SVVECSWARLEE+
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178
           PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A  LLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236
           GFLELNKE+LEIYQ+CTD DS+K AEE WL+++E E  ER+ + KE DIWMMGN+NR+
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR 238

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  392 bits (1006), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 184/243 (75%), Positives = 212/243 (87%), Gaps = 3/243 (1%)

Query: 1   MGKGRNKDYD-KNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRC 59
           MGKG+NK+   +  SQKGSNGHSSR NH+R+E K+     SKFPV LAMWDFDHCDPKRC
Sbjct: 1   MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRC 60

Query: 60  SGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIP 119
           SGKKLERLGLIKSLRV QKFQG+VVSPNGKTVVCP+D+ + E+ G SVVECSWARL+E+P
Sbjct: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120

Query: 120 FEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLG 179
           F KIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA  LLS+FSWG  
Sbjct: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180

Query: 180 FLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNAS 239
           FLELNKE+L+IYQ+CTDHDS+KAAEE WL++IE EA+ER++Q K  DIWM+GNVNR  AS
Sbjct: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR--AS 238

Query: 240 KEL 242
           ++L
Sbjct: 239 RDL 241

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  391 bits (1004), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/239 (74%), Positives = 208/239 (87%), Gaps = 2/239 (0%)

Query: 1   MGKGRNKDYDKNHS--QKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKR 58
           MGKG+NK ++  +   Q+G+NGHSSR NH+R+E KY+  + + FPV LAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118
           CSGKKLERLGLIKSLRV QKFQGIVVSPNG  VVCP+D E+ E++G SVVECSWARLEE+
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178
           PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A  LLSHFSWGL
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKN 237
           GFL+LN+E+LEIYQKCTD +S+K AEE WL+++E E  ER+ Q+K+ DIWMMGNVNRK+
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKD 263

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 207/238 (86%), Gaps = 4/238 (1%)

Query: 2   GKGRNK---DYDKNHSQKGSNGHSSRTNHRRIETK-YNAIQGSKFPVTLAMWDFDHCDPK 57
           GKG+NK   D     S KGSNGHSSR NH+R+E + ++ ++G+KFPV +AMWDFDHCDPK
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63

Query: 58  RCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEE 117
           RCSGKKLERLGLI SL+V QKFQGIVVSPNG+ VVCP+DR I E++G SVVECSWARL+E
Sbjct: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123

Query: 118 IPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWG 177
           +PF +IGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA  LLS+FSWG
Sbjct: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183

Query: 178 LGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNR 235
           LGFLELNKE+LE+YQKCTDH+S+K AEE WL +IE EA +R+ + ++ DIWMMGNVNR
Sbjct: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  387 bits (993), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 206/238 (86%), Gaps = 2/238 (0%)

Query: 1   MGKGRNKDYDKNH--SQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKR 58
           MGKG+NK ++  +   Q+G+NGHS+R NH+ +E KY+  +  KFPV LAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118
           CSGKKLERLGLI+SLRV QKFQG+VVSPNG+ VVCPND EI E++G SVVECSWARLEE+
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178
           PF KIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MD A  LLSHFSWGL
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236
           GFL+LNKE+LEIYQ+CTD DS+K AE+ WL+++E E  ER+  TK+ DIWMMGN+NR+
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRR 238

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  385 bits (989), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 178/238 (74%), Positives = 202/238 (84%), Gaps = 1/238 (0%)

Query: 2   GKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRCSG 61
           GK +N++    HS KGSNGHSSR NH+R+E K    + +KFPV LAMWDFDHCDPKRCSG
Sbjct: 4   GKNKNREAKNGHSGKGSNGHSSRQNHKRMEMK-RGTEDTKFPVKLAMWDFDHCDPKRCSG 62

Query: 62  KKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPFE 121
           KKLERLGLIKSLRV QKFQGIVVSPNG  VVCP+D+ I E++G SVVECSWARL+E+PF 
Sbjct: 63  KKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVPFN 122

Query: 122 KIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGFL 181
           KIGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD A  LLSHFSWGLGFL
Sbjct: 123 KIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLGFL 182

Query: 182 ELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNAS 239
           ELN+E+LEIYQ+CTD DS+KAAE AWL +I+ E  ER+ Q K+ DIWM GNVNRK  +
Sbjct: 183 ELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGTT 240

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  384 bits (985), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 179/240 (74%), Positives = 201/240 (83%), Gaps = 3/240 (1%)

Query: 2   GKGRNKDYDKNHSQK--GSNGHSSRTNHRRIETKY-NAIQGSKFPVTLAMWDFDHCDPKR 58
           GKG+NK +D+  S K  GSNGH +R NHR +E KY    + S FPV LAMWDFDHCDPKR
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63

Query: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118
           CSGKKLERLGLIKSLRV QKFQGIVVSPNGK+VVCP+DREI E +G SVVECSWARLEE+
Sbjct: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123

Query: 119 PFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGL 178
           PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA  LLSHFSWGL
Sbjct: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183

Query: 179 GFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNA 238
           GFLELNK++LE YQ+CTD +SIK  EE WL+QI+ E  ER+ + +  D+WMMGN NR N+
Sbjct: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  377 bits (967), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 174/240 (72%), Positives = 202/240 (84%), Gaps = 5/240 (2%)

Query: 1   MGKGRNKDYDKNHSQ--KGSNGHSSRTNHRRIETKY---NAIQGSKFPVTLAMWDFDHCD 55
           M KG+NK ++    +  +GSNGHSS+ NH+ +E K    N  Q  KFPV LAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 56  PKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARL 115
           PKRCSGK+LERLGLIKSLRV QKFQG+VVSPNGK V+CPNDREI E++G SVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 116 EEIPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFS 175
           +E+PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A  LLS+FS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 176 WGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNR 235
           WGLGFLE+N+E+L+IYQ+CTD +S+K AEE WL +IE E  ER+ Q +E+DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  375 bits (962), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 174/243 (71%), Positives = 202/243 (83%), Gaps = 8/243 (3%)

Query: 1   MGKGRNKDYDKNHSQ--KGSNGHSSRTNHRRIETKY-NAIQGSK-----FPVTLAMWDFD 52
           M KG+NK  +    +  +GSNGH +RTNH+R+E K+ NA  G+      FPV LAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 53  HCDPKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSW 112
           HCDPKRCSGKKLERLGLIKSLRV QKFQGIVVSPNGK VVCP+D+E  E++G SVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 113 ARLEEIPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLS 172
           ARL+E+PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA  LL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 173 HFSWGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGN 232
           HFSWGLGFLELNKE+LE+YQKCTD +S+K  EE WL++I+ E  ER+ Q++E DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 233 VNR 235
            NR
Sbjct: 241 TNR 243

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  367 bits (943), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/236 (73%), Positives = 198/236 (83%), Gaps = 4/236 (1%)

Query: 2   GKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYNAIQ-GSKFPVTLAMWDFDHCDPKRCS 60
           GKG NK     HS K S+GH+S   HR +E+K+ A + G  FPV LAMWDFD CDPKRCS
Sbjct: 7   GKGSNKQRGA-HSSKPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKRCS 63

Query: 61  GKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPF 120
           GKKLERLG+IKSLRV QKFQGIVVSPNGK+VVCPNDR I E+ G +VVECSWARL+E+PF
Sbjct: 64  GKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVPF 123

Query: 121 EKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGF 180
            KIGGR+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA  LLSHFSWGL F
Sbjct: 124 NKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQF 183

Query: 181 LELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236
           LELNKE+LE+YQ+CTD DSIK AE+AWL+QIE EA ER+ +   +D+W+ GNVN K
Sbjct: 184 LELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHK 239

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  359 bits (922), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 169/229 (73%), Positives = 194/229 (84%), Gaps = 5/229 (2%)

Query: 14  SQKGSN----GHSSRTNHRRIETKYNAIQ-GSKFPVTLAMWDFDHCDPKRCSGKKLERLG 68
           S KGSN    GHS+R++   +ETK+ A   G  FPV LAMWDFD CDPKRCSGKKLERLG
Sbjct: 7   SNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERLG 66

Query: 69  LIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPFEKIGGRHE 128
           +IKSLRV QKFQGIVVSPNGK VVCPND++I E+ G +VVECSWARL EIPF KIGGR+E
Sbjct: 67  IIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGRNE 126

Query: 129 RLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGFLELNKEIL 188
           RLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA  LL+HFSWGLGFLELNKE++
Sbjct: 127 RLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKELI 186

Query: 189 EIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKN 237
           E+YQKCTD +S+K AE +WL++IE EA ERR  +  +D+WM GNVNR++
Sbjct: 187 EVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRS 235

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  356 bits (914), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/246 (66%), Positives = 200/246 (81%), Gaps = 5/246 (2%)

Query: 1   MGKGRNKDYDKNHSQ--KGSNGHSSRTNHRRIETKYNAIQGSK---FPVTLAMWDFDHCD 55
           MGKG+NK+++   ++  +G+NGH+S+ NH+ +E K+     S    FPV L MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 56  PKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARL 115
           PKRCSGKKLERLGLI+SLRV QKFQG+VV+PNG  VVCPND+ I E++G SVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 116 EEIPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFS 175
           +E+PF +IGGRHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD A  LLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 176 WGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNR 235
           +G  FLE+N E+LEIYQ+CTD +S+K AE AWL++IE E  +R+ Q K  DIWM GNVNR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

Query: 236 KNASKE 241
             A+ +
Sbjct: 241 MPAASQ 246

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  337 bits (864), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 156/249 (62%), Positives = 196/249 (78%), Gaps = 12/249 (4%)

Query: 1   MGKGRNKDYD----KNHSQKGSNGHSSRTNHRRIETKYNAIQGS----KFPVTLAMWDFD 52
           MGKG+NK  D    K    +G+NGHSSR NH+ +E + +  + +    K PV L MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 53  HCDPKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSW 112
           HCDPKRCSGKKLERLGLIKSL++ Q+FQG+++SPNGK VV P D +I +++G +VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 113 ARLEEIPFEKI----GGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAE 168
           ARL+EIPF K+    GG++ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR D A 
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 169 TLLSHFSWGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIW 228
            LLS+FSWG+ FL LN+E+ E+Y +CTD DSI+ A+EAWL +I+ EA ER+ Q ++NDIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 229 MMGNVNRKN 237
           +MGN NR N
Sbjct: 241 LMGNTNRVN 249

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  337 bits (865), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 161/265 (60%), Positives = 199/265 (75%), Gaps = 26/265 (9%)

Query: 1   MGKGRNKDYDKN----HSQKGSNGHSSRTNHRRIETK----YNAIQG------------- 39
           MGKG+NK  D       + +G+NGHSSR NH+ +E K    + + Q              
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 40  -SKFPVTLAMWDFDHCDPKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDRE 98
             K PV L MWDFDHCDPKRCSGKKLERLGLIKSL++ Q+FQG+++SPNGK VV P+D +
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 99  IAEKYGVSVVECSWARLEEIPFEKI----GGRHERLLPYLVAANQVNYGRPWRLNCVEAL 154
           I +++G +VVECSWARL+EIPF K+    GG++ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 155 AACFAIVGRMDLAETLLSHFSWGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETE 214
           AACFAI+GR D A  LLS+FSWGL FL+LN+E+ E+Y KCTD DS+KAA+E WL +IE E
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 215 AMERRKQTKENDIWMMGNVNRKNAS 239
           A ER+ Q +E DIWMMGN NR +A+
Sbjct: 285 ATERKLQAQETDIWMMGNTNRLDAN 309

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  318 bits (816), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 147/221 (66%), Positives = 178/221 (80%), Gaps = 3/221 (1%)

Query: 18  SNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRCSGKKLERLGLIKSLRVKQ 77
           SNGH SR N++++E K +  + + FPV LAMWDFDHCDPKRCSGKKLERL LI+SL++ Q
Sbjct: 23  SNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKINQ 82

Query: 78  KFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPFEKIGG-RHERLLPYLVA 136
           KFQGI VSPNGK  V P DRE+  ++G +VVECSWAR++EIPF K    + +RLLPYLVA
Sbjct: 83  KFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLVA 142

Query: 137 ANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGFLELNKEILEIYQKCTD 196
           ANQVNYGRPW+LNCVEA+AAC AIVG MDLAE LLSHFSWG+ FL+LN+E+LEIYQ+CTD
Sbjct: 143 ANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCTD 202

Query: 197 HDSIKAAEEAWLKQIETEAMERRKQ--TKENDIWMMGNVNR 235
            D I+AA++AW+ QIE E  ER+     +  DIWM GNVNR
Sbjct: 203 SDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR 243

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  296 bits (759), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 182/242 (75%), Gaps = 12/242 (4%)

Query: 1   MGKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYN-AIQGSK--FPVTLAMWDFDHCDPK 57
           M KG+NK +++  ++K +N        RR E+K++ +I+ +K  FPV LAMWDFDHCDPK
Sbjct: 1   MAKGKNKGHEERSNRKSNNS-------RRNESKHSLSIKSTKTNFPVKLAMWDFDHCDPK 53

Query: 58  RCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEE 117
           RCSGKKLER GL +SLRV Q+F G+VVSPNGK VV P DRE  E+YG++VVECSWARL+E
Sbjct: 54  RCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDE 113

Query: 118 IPFEKIGGR--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFS 175
           +PF K+GG+  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A  +L  FS
Sbjct: 114 VPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFS 173

Query: 176 WGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNR 235
           WG  FLELN E+L+IY  CTD  S++ A++ WL++IE E  ER+++    D W++GN NR
Sbjct: 174 WGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNR 233

Query: 236 KN 237
           KN
Sbjct: 234 KN 235

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309c IMH1
          Length = 867

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 4/104 (3%)

Query: 126 RHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGFLE--L 183
           ++E+  P L+ A +    +  ++  +E + A    VG +D A   L  F   L      L
Sbjct: 55  KYEQKYPLLLQAYKTEKSKSEKIEALEKILAENTPVGNLDDAVESLPTFFKNLNDKNSML 114

Query: 184 NKEI--LEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKEN 225
           N+EI  L + QK TD+D    A EA ++++E +   + + +KEN
Sbjct: 115 NEEIKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNRNSKEN 158

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 47/117 (40%), Gaps = 16/117 (13%)

Query: 6   NKDYDKNHSQKG-SNGHSSRTNHRRIETKYNAIQGS--KFPVTLAMWDFDHCDPKRCSGK 62
           + D ++  SQ   SN H+    + +++  Y A  GS    P    ++D  H  P      
Sbjct: 13  SMDIEQRSSQPSRSNSHAGSPGYEKVQPLYAAENGSTETAPTATGLFDSSHVVPVSQRRG 72

Query: 63  KLERLGLIKSL--------RVKQKFQGIV-----VSPNGKTVVCPNDREIAEKYGVS 106
            L RL L+           RVK+    IV     + P G +++ P    I + +G S
Sbjct: 73  LLSRLALVPEFRDARLYPPRVKKLILVIVAFACILGPMGTSIIYPAIGTIMQDFGTS 129

>TBLA0D05030 Chr4 complement(1239797..1242199) [2403 bp, 800 aa]
           {ON} Anc_1.377 YFR016C
          Length = 800

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 11/78 (14%)

Query: 260 KSDLSDSNNDLCVANISKEDNNKEY-GLVYRSPSEISSDRDCIKDNTSFEVDFLGTKSQN 318
           +S ++D+  D  VA      N+KE    V  +PS I+SD D +K           T   N
Sbjct: 255 ESSITDTKTDPLVAIAESSSNDKETPSSVVETPSTITSDADVVK----------STTISN 304

Query: 319 SDKCKDKILLNSLNYVDN 336
           +D  +D +++ S     N
Sbjct: 305 TDTMEDPVMMESTTNTSN 322

>NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_8.520
          Length = 1838

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 25/130 (19%)

Query: 110  CSWARLEEIPFEKIGGRHERLLP----YLVAANQVNYGRPWRLNCVEAL----------- 154
            C +A      ++ +G    R +P     +++ +  N G+PW LN  + +           
Sbjct: 1631 CIYAAASPGGYQLVG----RTIPIWDKLMLSTSSANTGQPWLLNPFDQIEFYPVSEEELD 1686

Query: 155  ---AACFAIVGRMDLAETLLSHFSWGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQI 211
               AAC      +D+  ++ SH  + L ++E NKE +E + K    +  KA E A L + 
Sbjct: 1687 NFTAACDQATFTVDIEPSIFSHKDY-LRWVEDNKESIEDFTKAQSGE--KANEFARLMEA 1743

Query: 212  ETEAMERRKQ 221
                +E+ KQ
Sbjct: 1744 SNVELEKTKQ 1753

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,594,716
Number of extensions: 1667409
Number of successful extensions: 5500
Number of sequences better than 10.0: 39
Number of HSP's gapped: 5649
Number of HSP's successfully gapped: 39
Length of query: 349
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 239
Effective length of database: 40,868,139
Effective search space: 9767485221
Effective search space used: 9767485221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)