Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30216.17ON67467436060.0
ACR009W6.17ON68067823090.0
SAKL0E01100g6.17ON71071818620.0
Kwal_56.224116.17ON68969716780.0
KLTH0C11308g6.17ON69069216580.0
KLLA0D01067g6.17ON66069616420.0
TDEL0G045206.17ON67969516180.0
ZYRO0C07876g6.17ON68169515520.0
Kpol_1045.726.17ON69571014660.0
TPHA0J003106.17ON67571213441e-177
CAGL0L13288g6.17ON64669312991e-171
Skud_5.276.17ON61549812951e-171
YEL062W (NPR2)6.17ON61550012891e-170
Smik_5.256.17ON61549912791e-168
KNAG0M011406.17ON59468112611e-166
NCAS0H008706.17ON61267712051e-157
TBLA0G010106.17ON71053011631e-149
KAFR0L003806.17ON54067511081e-144
Suva_5.56.17ON61935611021e-142
NDAI0D008606.17ON6665097382e-87
KAFR0B004307.527ON62894771.3
KAFR0I014104.28ON101687771.4
NCAS0H017305.365ON542102761.5
TBLA0B048808.84ON612105724.1
TPHA0O010201.424ON26575697.7
NCAS0A095001.268ON103132708.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3021
         (674 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...  1393   0.0  
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   894   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   721   0.0  
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   650   0.0  
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   643   0.0  
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   637   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   627   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   602   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   569   0.0  
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   522   e-177
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   504   e-171
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   503   e-171
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   501   e-170
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   497   e-168
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   490   e-166
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   468   e-157
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   452   e-149
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   431   e-144
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    429   e-142
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   288   2e-87
KAFR0B00430 Chr2 complement(91101..92987) [1887 bp, 628 aa] {ON}...    34   1.3  
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....    34   1.4  
NCAS0H01730 Chr8 (329637..331265) [1629 bp, 542 aa] {ON} Anc_5.3...    34   1.5  
TBLA0B04880 Chr2 complement(1148937..1150775) [1839 bp, 612 aa] ...    32   4.1  
TPHA0O01020 Chr15 (190997..191794) [798 bp, 265 aa] {ON} Anc_1.4...    31   7.7  
NCAS0A09500 Chr1 complement(1889764..1892859) [3096 bp, 1031 aa]...    32   8.1  

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score = 1393 bits (3606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/674 (100%), Positives = 674/674 (100%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180
           QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180

Query: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240
           MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV
Sbjct: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240

Query: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300
           PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV
Sbjct: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300

Query: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPT 360
           LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPT
Sbjct: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPT 360

Query: 361 ASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENNKG 420
           ASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENNKG
Sbjct: 361 ASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENNKG 420

Query: 421 ILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCY 480
           ILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCY
Sbjct: 421 ILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCY 480

Query: 481 SYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKKPLVP 540
           SYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKKPLVP
Sbjct: 481 SYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKKPLVP 540

Query: 541 NTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGTAKV 600
           NTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGTAKV
Sbjct: 541 NTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGTAKV 600

Query: 601 LFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEVE 660
           LFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEVE
Sbjct: 601 LFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEVE 660

Query: 661 ELLKATGEYNIINS 674
           ELLKATGEYNIINS
Sbjct: 661 ELLKATGEYNIINS 674

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/678 (65%), Positives = 531/678 (78%), Gaps = 9/678 (1%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M N FDGFVPIH IFY+LFHPTEGTKVRFQFP DSLE SGI FDTIKNYVIPK QLCNKL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           +TFK+GSYRLVCYPVNI A YYARNSFSF+ VFVFPYDSATSPYEPAI RL KM RVLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180
           QSQ+LSK+ERDP+YY LKT + KA +Q +EE +SK    N + K R  H+  A  KYHEI
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHN--ATTKYHEI 185

Query: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240
           MKHI  +EK L IEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLL PPNSC S EDV
Sbjct: 186 MKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDV 245

Query: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300
           PIAK+NL++ VDVNWDPTM+KIVP+INGINSIAKISK SDS V LVMEC+KHL+YYDCV 
Sbjct: 246 PIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVA 305

Query: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPT 360
           LVDMFQFSNIYAPT+ L +FL D  + RECQ+YV+SSED E+H+LPFE RPN  HSRN T
Sbjct: 306 LVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQT 365

Query: 361 ASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENN-K 419
           AST T  TL+RT  TN R +SFSSN EF+QK +  +SL    S T S+K+  +N   N +
Sbjct: 366 ASTNTVYTLRRTTSTN-RADSFSSNAEFSQKSSGISSLAQ--SFTQSNKDYYYNRSRNLE 422

Query: 420 GILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRC 479
               RTLPTR  LFDLYRSL+QGQT+K+WYK N+  IR+N+IDVRR I FGVF +LIYRC
Sbjct: 423 SNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRC 482

Query: 480 YSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRK-KPL 538
           YSYPVAKSIGTL++LKRFDY S  +NF+    +  NNVFST+DI VDF   S+ R   P 
Sbjct: 483 YSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPF 542

Query: 539 VPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGTA 598
           + ++D A+EVLR+ Y+KLS+ + L + +D I +  +   +N+A+    +RK S ST  T 
Sbjct: 543 LNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTT 602

Query: 599 KVLFDMKDRLSNKDFEYRDQNAASTE--LKRKRQQQFLLLKSIKNVDSFDKIAIKLEINK 656
           ++ FD+++R  +KD E+R+Q        LK+KR Q+FLLL+S+K+VDSFDKIA++LE+NK
Sbjct: 603 RITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNK 662

Query: 657 QEVEELLKATGEYNIINS 674
            EVE LLK TGEYNI+NS
Sbjct: 663 HEVERLLKGTGEYNIVNS 680

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/718 (55%), Positives = 504/718 (70%), Gaps = 52/718 (7%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           MS+HFDGFVPIH++FYS+FHPTEGTKVR+QFPP +LEN+ I+FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LTFKYG YRL CYPVN+NASYYARNSF+F+FVFVFPY+ ATSPYEPA+ RLGKMFRVLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKA------VDQ-------NSEEPESKNNPQNCNDKIRR 167
           QSQ+LSK E DP+Y+HLK+Q+         VDQ       ++E+    NN Q+  ++ + 
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 168 GHHEHAFEKYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPL 227
                A EKYHEIM  +   +K+LSIEDLITKLY+DLNNYSEC IP+DSGN++DIKLFPL
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 228 LAPPNSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVM 287
           LAPPNSC S EDVPI+ +NL   +DVNWDPTM+KIVP+ING+NSIAKI+K+S SD  LV+
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 288 ECVKHLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPF 347
           ECVKHLIYY+CVVL D+FQFSNIYA TS +SEFLTDP++A ECQ YV SS D EL++LPF
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSS-DLELYRLPF 359

Query: 348 EGRPN--ANHSRNPTASTITFGTLKRTIYTNP-RPESFSSNTEFAQKPN------ANTSL 398
           E RPN  + HS     S+ T  T+   +  +P R  S    +E + + N      A++ +
Sbjct: 360 ESRPNLLSMHSSRKQNSSSTIHTV--GVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLM 417

Query: 399 PSEPSITHSSKNSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRK 458
                   S+  S  + + ++ +    LPT+SCLFDLYRSL QG+T+K+WYK+NFE+IR 
Sbjct: 418 RVRDRSGQSTTGSAVDEQESRLL----LPTKSCLFDLYRSLHQGETVKEWYKINFEIIRD 473

Query: 459 NRIDVRRFITFGVFRKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNF-----MSPKNNN 513
           N IDVRRFITFG+ R LIYRCY+YPV K++G L+MLK    AS   +         K N 
Sbjct: 474 NHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNF 533

Query: 514 SNNVFSTADICVDF-----GEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQ 568
           +NNVFSTADI VD      G P++   +    N D A+EVL+DAYKKLS+ E + + L  
Sbjct: 534 TNNVFSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYH 593

Query: 569 ITRSKKLSLENDA------SANVDNRKLSSSTSGT---AKVLFDMKDR---LSNKDFEYR 616
           +         +D+       +   +RK SSST  +   +KV F+ K R      +D +  
Sbjct: 594 VHNPMSRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFE-KGRSPWQVEEDEKKE 652

Query: 617 DQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674
                S  LK KR ++FLLLKS+K+VD+FDKI ++LE +++EVE+LLK  G YNIINS
Sbjct: 653 RTEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/697 (50%), Positives = 478/697 (68%), Gaps = 33/697 (4%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           MS HFDGFVP+H I Y++FHPTEGTKVR QFPP  LE S I+FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LTFKYGS+RLVCYPVN+ A YYARNSFSFDFVFVFPYD ATSPYE AI RLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNC---NDKIRRGHHEHAFEKY 177
           QSQ+LSK E   +Y+ LKT+D  +    ++EP + N  Q     N+  +   H +AFEKY
Sbjct: 121 QSQILSKAENSHVYFQLKTRD--SHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKY 178

Query: 178 HEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSV 237
           HEI+K +    K++S+EDLITK+Y DLNNYSECLIP+DSGNA+DIKLFPLL+PP+SC S 
Sbjct: 179 HEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLSF 238

Query: 238 EDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYD 297
           EDVP+  +NL   +DVNWDPTM+KIVPYING NSIAK++K SDSD  LV+EC++HL+YY+
Sbjct: 239 EDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYN 298

Query: 298 CVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSR 357
           CV+L D+FQF NIYAPTS+LS FLT+P++A ECQ+YV   E + +  LPFE +P+     
Sbjct: 299 CVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYN 358

Query: 358 NPTA--STITFGTLKRTIYTNPRPESFSSNTEFAQK----PNANTSLPSEPSITHSSKNS 411
           N     S+ T    ++    + +  SF++  + + +    P ++TS     +++ +S  +
Sbjct: 359 NIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGN 418

Query: 412 EFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGV 471
                NNK        ++SCLFD+YRSLSQGQT+K+WYK +FE IR  RIDVRRFITFGV
Sbjct: 419 SEGGFNNKVFFT----SKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGV 474

Query: 472 FRKLIYRCYSYPVAKSIGTLDMLKRFDY----ASLPNNFMSPKNNNSNNVFSTADICVDF 527
              L+YRCYS+P+ K++G L+++K        +S    ++S  +  +NNV S A+I +  
Sbjct: 475 IHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGL 534

Query: 528 -GEPSQFRKKPL--VPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLE-----N 579
               S+ R++      N D A+++L D Y+KL+LNE   N ++Q ++S    +      +
Sbjct: 535 ESSSSKLRERRFNHFSNADTAEDILNDVYRKLALNE---NKVEQSSQSGNPMMRMFGNCS 591

Query: 580 DASANVDNRKLSSSTSGTA---KVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLL 636
           D S+   + K   ST+G+     V FD++  +++   E R +       + KR+ + LLL
Sbjct: 592 DDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLL 651

Query: 637 KSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIIN 673
           KS+++V++FDKI  +L  +++EVE++L+  G YN+++
Sbjct: 652 KSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/692 (50%), Positives = 474/692 (68%), Gaps = 20/692 (2%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           MS HFDGFVP+H IFYS+FHPTEGTKVR QFP   LE S I+FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LTFKYG +RLVCYPVN+ A YYARNSFSFDFVFVFPYD ATSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQ--NCNDKIRRGHHEHAFEKYH 178
           QSQ+LSK E   +Y+ LK ++ +    N+E  +    P   +  +  +  +  +A  KY+
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQK-HGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYY 179

Query: 179 EIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVE 238
           EI+K +    K+++I DLITK+Y DLN+YSECLIP+DSGNA+DIKLFPLL+PP+SCFS+E
Sbjct: 180 EILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFSIE 239

Query: 239 DVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDC 298
           DVPI+ +NL   +DVNWDPTM+KIVP+INGINSIAK++K+SDSDV LV+EC+KHLIYY+C
Sbjct: 240 DVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNC 299

Query: 299 VVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRN 358
           V+L D+FQFSNIYA T++LS FLT+P++A ECQ+YV  +E + L  LPFE  P+ +   N
Sbjct: 300 VILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGN 359

Query: 359 --PTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSIT-HSSKNSEFNH 415
               +S  T   L++   T  R  SF+S  +F    + +T      SI  H++ ++ F +
Sbjct: 360 IRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGN 419

Query: 416 ENNKGILNRTLP--TRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFR 473
            ++ G+  + +P  ++SCLFDLYRSL+QGQT+++WYK +FE IR  RIDVRRFITFGV  
Sbjct: 420 -SDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLH 478

Query: 474 KLIYRCYSYPVAKSIG---TLDMLKRFDYASLPN-NFMSPKNNNSNNVFSTADICVDF-- 527
            LIYR YSYPV ++IG   +++ L   +++       +   N   NNV S ADI +    
Sbjct: 479 GLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLEN 538

Query: 528 -GEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITR--SKKLSLENDASAN 584
            G  ++  K       DAA+EVL D Y+KL+L+++  + + Q     SK     ++ S +
Sbjct: 539 AGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTD 598

Query: 585 VDNRKLSSSTSGTA--KVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNV 642
           +  R+ ++S       KV FD++  L+    + R ++     ++ KR ++ +LLKS+++V
Sbjct: 599 ISTRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKSVRSV 658

Query: 643 DSFDKIAIKLEINKQEVEELLKATGEYNIINS 674
            +FDKI   L  +++ VE +L   G YN+++S
Sbjct: 659 HNFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/696 (51%), Positives = 472/696 (67%), Gaps = 58/696 (8%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M++ FDGFVPIH++FY+LFHPTEG+KVRFQFPP+SLEN  I FDTIKNY+IPKPQLCNKL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LTFKYG YR+VCYPVN+NA YYARNSF+F+FVFVFPYD ATSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEE-----PESKNNPQNCNDKIRRGHHEHAFE 175
           QSQ+LSK E++P+Y+ LK+ D  A DQ++E       E  +     +D           E
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDG----------E 170

Query: 176 KYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCF 235
           KY EI+K +A N+K L IEDL+ KL+ DLNNYSECLIP+D GN+IDIKLFP+  PP+S  
Sbjct: 171 KYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNI 230

Query: 236 SVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIY 295
           SVEDVPIA +NL D +DVNWDPTMVKIVPYINGINS+A+I+  + SDV LV EC+KHL+Y
Sbjct: 231 SVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMY 290

Query: 296 YDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQ--LPFEGRPNA 353
           Y+CV+L D+FQFSNIYAPTS++  FLT+P++A+ CQL+V   +   L Q  LPFEGRPN 
Sbjct: 291 YNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV---QGDSLKQSLLPFEGRPNN 347

Query: 354 NH-SRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSI---THSSK 409
            + +    AST T  + +R    +    + + +T   +  + N    S  S     H+S+
Sbjct: 348 IYPTGRKQASTSTVHSRRR----DSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASE 403

Query: 410 NSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITF 469
           N+      N+  + R LPTRSCLFDLY+SLSQG+T+KDWYK NFE+IR NRIDVR+ I F
Sbjct: 404 NTSLATGENQ--MKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMF 461

Query: 470 GVFRKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADI-CVDFG 528
           G+ R+LIYR  SYP+ K++GT D+LK         ++ S    +S N+FS ADI  VD  
Sbjct: 462 GITRRLIYRVNSYPIVKNVGTWDILKSLVSKEPKTHYGS---GSSKNIFSAADIKVVDTK 518

Query: 529 EPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDA------- 581
           E      K      DAADE+L+  Y+KLSL + +PN + +  R    S  N+A       
Sbjct: 519 EEGNQSDK-----LDAADELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSR 573

Query: 582 -SANVDNRKLS--SSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKS 638
            S++  ++K+S    T+G  K + ++ D                   K+K++++ +LL+S
Sbjct: 574 KSSSGSHQKVSFDFGTAGQQKTVTEVPD---------LGDGEKVEVWKKKKEEELILLES 624

Query: 639 IKNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674
           + N ++FDK+  KL+ ++ EVE LLK  G YNI+NS
Sbjct: 625 LSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/695 (48%), Positives = 469/695 (67%), Gaps = 37/695 (5%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M + F+GF+PIH+IFY++FHPTEGTKVR++FPP +LE+  I+FD IKNY+IPKPQLC+KL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LT KY +YR+  YPV +N+  YARN FSF+FVFVFPYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180
           Q+ +LSK E+DPI+YH K  ++K      ++ ++K+ P+  +  + +    +A EKYH+I
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIK------DDQDAKSKPEKGSHNLSKSQ-AYASEKYHKI 173

Query: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240
           M  I   +   S++DL+ ++Y+DLNNYSECLIP+D GNA+DIK+FP++ PPNS  S+EDV
Sbjct: 174 MTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDV 233

Query: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300
           P++ +NL   +DVNWDPTM+KIVPYING+NSI+KI+K S SD GLV+EC+KHLIYY+CV+
Sbjct: 234 PVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVL 293

Query: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPT 360
           L D+FQFSNIYAPTS L  FLTD  ++ ECQ YV+  EDS L +LPF+     NHS   +
Sbjct: 294 LADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFK---RVNHSATES 350

Query: 361 ASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLP---SEPSITHSSKNSE----F 413
                  + +    +  R  S SSN +F   P++N  +P   SE S+  + K+S+     
Sbjct: 351 VDHELADSHRSQRTSGSRTTSMSSNGKFF--PSSNNEMPALISEESLYRTGKHSQSSFSS 408

Query: 414 NHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFR 473
           N+ N   +L R LPT+SCLFDLYRSLSQG ++++WY +++  IR NRIDVRRFITFGV  
Sbjct: 409 NNTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVIN 468

Query: 474 KLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFM--SPKNNNSNNVFSTADICVDFGEPS 531
            LIYRCYSYP+ K++   D+ KR     + N+ +  +   N S N+FST+DI        
Sbjct: 469 GLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYER 528

Query: 532 QFRKKPLVPNTDAADEVLRDAYKKLSL---NERLPNPLDQITR-SKKLSLENDASANVDN 587
           Q  K     N D ADEVLR+ YKKLS+    +  PN  D I R  ++ SL + A  + +N
Sbjct: 529 QRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNN 588

Query: 588 RKLSSSTSGTAKVLFDMKDRL--------SNKDFEYRDQNAASTELKRKRQQQFLLLKSI 639
                ++   +KV FD +  +        S+ D    D+ A   +L+R R++  +LL+S+
Sbjct: 589 IYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEA---KLER-RERDLILLESV 644

Query: 640 KNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674
           +  DS D I +KLE+++ +VE L++  GEY IINS
Sbjct: 645 EAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/695 (48%), Positives = 454/695 (65%), Gaps = 49/695 (7%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M++ F+GFVPIH++FY++FHPT+GT+VR+++PP +LE + I+FD IKNY+IPKPQLC+KL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LT KY  YR+VCYPV +N+ YYARN FSF+FVFVFPYD  TS YEPAI RLGKMFRVLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180
           Q+Q+LSK E DPIY+  K  D      N+ E + K N +     + +     A  KY+EI
Sbjct: 135 QNQILSKAENDPIYFDFKLAD------NTTEQDGKLNAEKSFKGLTKSQG-MALAKYNEI 187

Query: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240
           MK +   +   S++DL+ ++++DLNNYSECLIP+D GNA+DIK+FPL  PPNSC S+EDV
Sbjct: 188 MKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDV 247

Query: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300
           PI+ +NL   +DVNWDPTM+KIVPYI+G+NSI+KI+K SDSDV LV+ECVKHL+YY+CV+
Sbjct: 248 PISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVI 307

Query: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFE-----GRPNANH 355
           L D+FQFSNIYAPTS + +FLTDP++A ECQ +V  +  S L ++PFE        + + 
Sbjct: 308 LADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQ 367

Query: 356 SRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNH 415
           S+N  + + T     ++   + RP  +S+       P            + SS N+   H
Sbjct: 368 SKNQESGSRTTSMSSKSDSKSKRPFFYSA-------PRNPYRFNQRSQSSFSSTNTNVTH 420

Query: 416 ENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKL 475
           +     L R LPT++CLFDLYR+LSQG T+++WY +N++ I+KN IDVRRFITFGV + L
Sbjct: 421 D-----LARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGL 475

Query: 476 IYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSN-----NVFSTADICVDFGEP 530
           IYRC+S+PV K +   D+  +   A   N          N      VFST+D+    GE 
Sbjct: 476 IYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDM--KLGEG 533

Query: 531 SQFRKKPLVPNTDAADEVLRDAYKKLS-LNE---RLPNPLDQITRSKK-LSLENDASANV 585
           S+  +   V   D ADEVLR+ YKKLS  NE   R   PL +I R +  +SL   +  NV
Sbjct: 534 SKMHQNFSV---DIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNV 590

Query: 586 DNRKLSSSTSGTAKVLFDM-KD-----RLSNKDFEYRDQNAASTELKRKRQQQFLLLKSI 639
            + K     S   KV FDM KD      LS +  + +++ AA  + + K  Q+ +LL+SI
Sbjct: 591 SHPKKPERVS---KVAFDMNKDDPVPYSLSQQKGKNKEREAAKLD-RAKNNQKIILLESI 646

Query: 640 KNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674
              D  DKI +KLE  + EVEELL   G+Y IINS
Sbjct: 647 AAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/710 (45%), Positives = 445/710 (62%), Gaps = 58/710 (8%)

Query: 5   FDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKLLTFK 64
           FDGF PIH+IFYS+FHPTEG KV +QFPP++L+N  I+FD+I++YVIPKPQLCNKLLT K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEEQSQV 124
           YG+YR++ YP+ IN S YARN+FSF+ VFVFPY+  TSPYE  I +LGKMFRVLEEQSQ 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIR------------------ 166
           LSK E+D  Y+     D KA+  +S + +SK  P+  +                      
Sbjct: 124 LSKAEKDLAYF-----DFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANAT 178

Query: 167 --RGHHEHAFEKYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKL 224
             + +  + FEKY EI + ++ +E   SI+D I +LY+DLNNYSECLIP+D+GNA+DIKL
Sbjct: 179 DSKKNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKL 238

Query: 225 FPLLAPPNSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVG 284
           FPLL PP +  S+EDVPI+++NL + +DVNWDPTM+KIVP+I+G+NSIAKI+K SDSD  
Sbjct: 239 FPLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTV 298

Query: 285 LVMECVKHLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQ 344
           LV+EC+KH IYY CVV+ D+FQFSNIYAPTS L  FLTDP +A ECQ YV   E S LHQ
Sbjct: 299 LVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQ 358

Query: 345 LPFEGRPNANHSRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSI 404
           LP E         + + S       K     + R  SF S +  A   N N+SL S   +
Sbjct: 359 LPLESLSKLKLDSDGSDSQ---NLRKSKNGIDSRAASFVS-SRGASSHNENSSLYSRSDL 414

Query: 405 ------THSSKNSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRK 458
                 + SS +S+  ++ N  +  + LPTRS LFDLYRSLSQG T+K+WYK NF  IR 
Sbjct: 415 YLNRHRSESSISSQNTNDLNGNV--KQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRN 472

Query: 459 NRIDVRRFITFGVFRKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKN----NNS 514
           N ID+R+FI FG+   L+YRC S+PV  +   ++ +K+F    + N   + K+      S
Sbjct: 473 NGIDIRKFIIFGIINGLLYRCQSFPVTANFEEINKVKKF--KDIQNRKETRKDKLQKQLS 530

Query: 515 NNVFSTADICVDFGEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKK 574
            ++FST+DI V     S   ++    + D AD VL++ YKKL+L     N  ++   S++
Sbjct: 531 QDIFSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQE 590

Query: 575 L---SLENDASANVDNRKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTE------- 624
           L   S+++   ++    K+       +KV F       N + +Y   +   TE       
Sbjct: 591 LEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQ-----NSNMQYSASSGDVTENEDINNL 645

Query: 625 LKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674
            K ++Q + +LL+++++ ++ DKI + LE  + EVEE+LK   ++ +INS
Sbjct: 646 EKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  522 bits (1344), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 314/712 (44%), Positives = 432/712 (60%), Gaps = 77/712 (10%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M+N FDGFVPIH IFYS+FHPTEGTKV ++FPP +L  SGI+FD IKNYVIPKPQLC+KL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LT KY +YR+V YP+ IN+S YARN+FSF+ VFVFPY+  TSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNN---------------------PQ 159
           Q Q LSK E+D  Y+  K      +DQ+    E  NN                       
Sbjct: 121 QCQFLSKCEKDMAYFDFKLIS-NLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGST 179

Query: 160 NCNDKIRRGHHEHAFEKYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNA 219
           N  DK      E+ F KY+ I  +I  ++ QLS+ D++ ++++DLN+YSEC IP+D GNA
Sbjct: 180 NTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNA 239

Query: 220 IDIKLFPLLAPPNSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYS 279
           IDIKLFP L PP    SVEDVPI  +NL   +DVNWDPTM+KIVPYI+G+NSI KI+  S
Sbjct: 240 IDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLS 299

Query: 280 DSDVGLVMECVKHLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSED 339
           +SD  LV+EC++H +YY CV+L D+FQFSNIYAPTS +++FLTDP++A ECQ+YV S ED
Sbjct: 300 NSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPED 359

Query: 340 SELHQLPF-EGRPNANHSRNPTAST--ITFGTLKRTIYTNPRPESFSSNTEFAQKPNANT 396
           S L  LPF +GR    + R+ + ++   +  +L++ +  N +  SF S+       N +T
Sbjct: 360 SLLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNL--NSKASSFISD---EGHHNDDT 414

Query: 397 SLPSEPSITHS---------SKNSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKD 447
           + P+  SI  +         S N++  H+N        LPT+S LFDLYRSLSQG  +++
Sbjct: 415 AYPNHDSIYENRRRSESSFSSGNNDEMHQN-----RNYLPTKSTLFDLYRSLSQGVKLEE 469

Query: 448 WYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFM 507
           WY++NF  IR N ID+RRFI FG+ +++IYRC+SYP+ K+      L   D  +L N   
Sbjct: 470 WYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLN--DLKNLQNGPK 527

Query: 508 SPKNNNSN---NVFSTADICVDFGEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPN 564
             KN + +   N+FST+DI       +  +KK    + D AD VL + YKKLS N R   
Sbjct: 528 IVKNKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTT 587

Query: 565 PLD-QITRSKKLSLENDASANVDNRKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAAST 623
            ++ Q     K++ +N +  N                  D+   ++N   E       +T
Sbjct: 588 SINGQGQHPSKVAFKNQSYDN------------------DLPGLMNNLGIE-------AT 622

Query: 624 ELKRK--RQQQFLLLKSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIIN 673
           +  R+     +  LL ++++ ++ D I   LE++++EVE LL    EY IIN
Sbjct: 623 KFSREININDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIIN 674

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  504 bits (1299), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 314/693 (45%), Positives = 427/693 (61%), Gaps = 68/693 (9%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M++ F+GFV IHSIFYS FHPTEG+KV+F FPP SLENSGI+FD+IKNYVIPK  LC++L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           +TFKYG+YR+ CYPV +N+S YARN FSF+FVFVFP++  TSPYEPAI RLGKMFRVLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVK-AVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHE 179
           Q+Q+LSK E D I ++LK+ D    +D +S      ++  +    I     +  +E+ + 
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISS----IMTTQQKDKYERLNN 176

Query: 180 IMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVED 239
           I+ +I       +I DL+ +LY+DLN YSECLIP+D GNA+DIKLFPLL PP    S+E 
Sbjct: 177 IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEH 236

Query: 240 VPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCV 299
           VPI+ +NL   VDVNWDP M+ I+PYINGIN+I +IS+ S ++  LV+EC++HL+YY C+
Sbjct: 237 VPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCI 296

Query: 300 VLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYV---ISSEDSELHQLPFEGRPNANH- 355
           VL D+F+FSN+YAPTS L  FL DP++A ECQ YV   I+S+ ++L   P  G+ +A + 
Sbjct: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNG 356

Query: 356 ---SRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSE 412
              SRN + ST    +L      + RP+S SS+ + +Q         SE SI  S+ NS 
Sbjct: 357 DIGSRNNSVST----SLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSI--STGNS- 409

Query: 413 FNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVF 472
               NN   +++ LPTRS LFDLYRSLSQG T+K+WY  N ++IR NRIDVRRFITFGV 
Sbjct: 410 ----NNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVL 465

Query: 473 RKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQ 532
           R++IYRC +Y V  S   L  L + +    P +  +     SN++ S             
Sbjct: 466 RRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSL------------ 513

Query: 533 FRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPL-DQITRSKKLSL-----ENDASANVD 586
                      AADE L +AYKKLSL       L    T     SL     E + S    
Sbjct: 514 -----------AADEALMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKR 562

Query: 587 NRKLSSSTSGTAKVLFDM--KDRLSNKDFEY----RDQNAASTELKRKRQQQFLLLKSIK 640
           N++LS       KV F+   +DR     F +    +     +T  K  + Q+ ++LK++ 
Sbjct: 563 NKRLS-------KVSFEALPEDR---NGFRWGSNIKTPIQETTWKKLSKMQRRIMLKALA 612

Query: 641 NVDSFDKIAIKLEINKQEVEELLKATGEYNIIN 673
           + ++ DKI + LE+ +Q V  +L   GE  +IN
Sbjct: 613 DAETLDKICVLLEMPRQNVVNILHELGELKLIN 645

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  503 bits (1295), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 259/498 (52%), Positives = 359/498 (72%), Gaps = 22/498 (4%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L+N GI+F+TIKNY+IPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           +TFKYG+YR+VCYPV IN+  YARN FSF+FVFVFPYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFE----K 176
           Q+Q+LSK E+D +++ LK  +   +  ++    + +NP +          + A +    +
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 177 YHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFS 236
           Y+++ K + + E   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C S
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 237 VEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYY 296
           +EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK S SD  LV+EC++HLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 297 DCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHS 356
            CV L D+FQFSNIYAP+S +  FLTD  +A +CQ YV   E S++  LP     ++   
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360

Query: 357 RNPTASTITFGTLKRTIYTNP--RPESFSSNTEFAQKPNANTSL--------PSEPSITH 406
            +P+   +   +   +I +NP  R  SFSSN++ +Q  + N+S          S+ S++ 
Sbjct: 361 DSPSL-FVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSS 419

Query: 407 SSKNSEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRF 466
           S+  +  N        NR LPTRSCLFDLYRSLSQG+T+K WY+    ++++N IDVRRF
Sbjct: 420 SNLRANDNR-------NRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRF 472

Query: 467 ITFGVFRKLIYRCYSYPV 484
           ITFG+ R++IYRCYS+PV
Sbjct: 473 ITFGLERRIIYRCYSFPV 490

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 630 QQQFLLLKSIKNVDSFDKIAIKLEINKQEVEELLKATGEYNIINS 674
           +++ +L  SI++ +SFD I + L  +K EVE  L   GE+ +INS
Sbjct: 571 EEERILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVINS 615

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 256/500 (51%), Positives = 356/500 (71%), Gaps = 14/500 (2%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L+N GI+F+T KNY+IPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           +TFKYG+YR+VCYPV IN+  YARN FSF+FVFVFPYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQN----CNDKIRRGHHEHAFEK 176
           Q+Q+LSK ERDP+++ LK  +      ++  P S  NP +     +    +   +    +
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 177 YHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFS 236
           Y +++K + + +   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C S
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 237 VEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYY 296
           +EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK S+SD GLV+EC++HLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 297 DCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHS 356
            CV L D+FQFSNIYAP+S +  FLTDP +A +CQ YV   E S++  LP      +   
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360

Query: 357 RNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEP------SITHSSKN 410
            +P+ S     +   +I +NP   + S ++      N++ +               S  +
Sbjct: 361 DSPSFSVRR-KSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSS 419

Query: 411 SEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFG 470
           S  +  NN+   NR LPTRSCLFDLYRSLSQGQT+K WY+  + ++++N ID+RRFITFG
Sbjct: 420 SNIHVINNR---NRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFG 476

Query: 471 VFRKLIYRCYSYPVAKSIGT 490
           + +++IYRCYS+PV  + G+
Sbjct: 477 LEKRIIYRCYSFPVMINAGS 496

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 7/77 (9%)

Query: 598 AKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQ 657
           +KV F+M+ R+S+           ST  K   +++ +L +SI+N ++FDKI + L   K 
Sbjct: 546 SKVSFEMQ-RVSSL------ATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKL 598

Query: 658 EVEELLKATGEYNIINS 674
           EVE  L   GE+ +INS
Sbjct: 599 EVESYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  497 bits (1279), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 257/499 (51%), Positives = 356/499 (71%), Gaps = 14/499 (2%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L+N GI+F+TIKNY+IPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           +TFKYG+YR+VCYPV IN+  YARN FSF+FVFVFPYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFE----K 176
           Q+Q+LSK E+DP+++ LK  +   +  ++  P + +N  +          + A +    +
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 177 YHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFS 236
           Y++++K   + E   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C S
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 237 VEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYY 296
           +EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK S+SD  LV+EC++HLIYY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 297 DCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHS 356
            CV L D+FQFSNIYAP+S +  FLTDP +A +CQ YV   E S++  LP      +   
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 357 RNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSI------THSSKN 410
            +P+ S     +   +I +NP   + S ++      N++ +     +         S  +
Sbjct: 361 DSPSFSVRR-KSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSS 419

Query: 411 SEFNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFG 470
           S  +  NN+   NR LPTRSCLFDLYRSLSQGQT+K WY+  + +I+ N ID+RRFITFG
Sbjct: 420 SNIHISNNR---NRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFG 476

Query: 471 VFRKLIYRCYSYPVAKSIG 489
           + +++IYR YSYPV  S+G
Sbjct: 477 LEKRIIYRSYSYPVMLSVG 495

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  490 bits (1261), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 290/681 (42%), Positives = 397/681 (58%), Gaps = 96/681 (14%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M + F+GFVPIH++FY++FHPTEG+KV +QFPP +L++  I+FD IKNY+IPKPQLC++L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LT KYG+YR+V YPV + +S YARN F F+FVFVFPY+ ATSPYEPAI RLGKMFRVLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180
           QSQVLS+ ERD     L   D    D NS    +KN     +  I +     + +K  E 
Sbjct: 121 QSQVLSRAERDD---SLFKGDKLPFDNNS----AKNQAPLTHALISKT-KSFSPDKKTEG 172

Query: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSC-FSVED 239
             H+      +S++DLI ++Y+DLNNYSECLIP+D GNAIDIK+FPL+ PP S   S+ED
Sbjct: 173 DIHL------ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIED 226

Query: 240 VPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCV 299
           VP+  + L   +D+NWDPTMV I+P+ING+NSI  I++ SDSD  LV+EC+KHLIYY CV
Sbjct: 227 VPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCV 286

Query: 300 VLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFE----GRPNANH 355
           ++ D+FQFSNIYAP+S ++EFLTDP++A +CQ YV   + S L  +P +    G  N  H
Sbjct: 287 IITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRNNKH 346

Query: 356 SRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSE--PSITHSSKNSEF 413
            ++ + S+    + +     +     F S    + K  + +SL SE  P    S  ++ +
Sbjct: 347 KKSNSLSSTGVLSWQSNSQYSNNSSEFYS---MSNKKRSESSLSSEGTPGAGRSDDHTIY 403

Query: 414 NHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFR 473
                        PTR  LFDLYRSLSQG T++ WY  NF  IR N IDVR+FI FG  +
Sbjct: 404 ------------YPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIK 451

Query: 474 KLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQF 533
           K+IYR  SYPV +      + K+   + +     +P + N+   FST+DI  D G     
Sbjct: 452 KIIYRVLSYPVLEKRRNSIIAKQMGKSKMAEK--APHSKNA--FFSTSDIKFDDG----- 502

Query: 534 RKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSS 593
                                     +RL N L    R  K+S E     N   RK   +
Sbjct: 503 --------------------------DRLFNSL--YARFSKVSFEK-RRENARERKSFDA 533

Query: 594 TSGTAKVLFDMKDRLSNKDFEYRDQNAASTE-LKRKRQQQFLLLKSIKNVDSFDKIAIKL 652
             GT                     N A  E +   ++++  LL ++ N++SFDKI ++L
Sbjct: 534 VGGT---------------------NGADKETMILTKEEKLQLLGALDNLESFDKICVQL 572

Query: 653 EINKQEVEELLKATGEYNIIN 673
             ++ E+  L+   GEY +IN
Sbjct: 573 GRSRVEIANLIADIGEYRVIN 593

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  468 bits (1205), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 288/677 (42%), Positives = 400/677 (59%), Gaps = 83/677 (12%)

Query: 3   NHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKLLT 62
           NHF+GF+PIH+IFYS+FHPTEGTKV ++FPP +L N  I+FDTIKNY+IPK QLCN+LLT
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  FKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEEQS 122
           FKY +YR+V YP+ INA YYARN FSF+FVFVFPY+  TSPYEP+I RLGKMF++LEEQS
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 QVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYH-EIM 181
           Q+LSK E DPIY+  K+  V      +  P+   +P + N +    +  +   ++  +  
Sbjct: 130 QILSKAENDPIYF--KSDYVPTEPTTTIIPQI--SPSHRNKRNNDHNDNNDGSRFETDFF 185

Query: 182 KHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLA-PPNSCFSVEDV 240
                   + S++DLI ++Y+DLNNYSECLIP+D GN I+IK+FPLL  PPN   S+EDV
Sbjct: 186 GEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDV 245

Query: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300
           P++ +NL + +DVNWDPTM+ IVPYING+N I+KI+K + +D  LV+EC+KHL+YY+CV+
Sbjct: 246 PMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVI 305

Query: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPT 360
           + D+FQFSN+YAPTS +  FLTD  +A +CQ YV+    S+L  LPFE   N   S  P 
Sbjct: 306 ITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPS-TPK 364

Query: 361 ASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENNKG 420
            S  T  +   +   N    S+    +  +   + +   ++P+  H     E  H     
Sbjct: 365 HSRTTSLSSSMSGSVNSHEHSYMDTIQ--KSETSLSLSSTDPNNPH----FELAH----- 413

Query: 421 ILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCY 480
                LPT++CLFDLYRSLS G T++ WY+ N  +I +N +DVR+FI FG+ R LIYRC+
Sbjct: 414 -----LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCH 468

Query: 481 SYPVAK-----SIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRK 535
           SYP+ +      I  ++ L   D   L             +  S A      G  S    
Sbjct: 469 SYPIPQRPSNEGIQRIERLNDIDAHRL----------QIRSSGSAARSNSGSGSGSSASP 518

Query: 536 KPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTS 595
             +  N D ADE+L++ YKKL              R  K+S                   
Sbjct: 519 SSI--NVDGADELLKNVYKKLE-------------RHSKVSF------------------ 545

Query: 596 GTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEIN 655
                     D+  N+  +  ++   ST  K +R    +LLKSI+++++ DKI +KL  +
Sbjct: 546 ---------MDKEKNESMKTDEKGRPSTMTKEERS---VLLKSIESLENLDKICVKLGKS 593

Query: 656 KQEVEELLKATGEYNII 672
           +Q+VE  L   G Y II
Sbjct: 594 RQQVERWLDELGNYKII 610

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  452 bits (1163), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 248/530 (46%), Positives = 347/530 (65%), Gaps = 35/530 (6%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M +HF+GFVPIH++FYS+FHPTEGTKVR++FPP +L+   I+FDTIKNY+IPKPQLC+KL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LT KYG YRLV YPV IN+S YARN FSF+FVFVFP +  TSPYEP I RLGKMFRVLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180
           Q+Q+LS+ E D +Y+   +  + + +Q+S   + KN           G     F  + + 
Sbjct: 121 QNQLLSRAENDSVYFD-NSHSLLSSEQDSIMHQDKNTSI-------LGFSRKRFS-FSKR 171

Query: 181 MKHIAMNE-------KQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNS 233
              ++++E          S++DLI ++++DLNNYSECLIP+D GN++DIK+FP + PP+ 
Sbjct: 172 PTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSI 231

Query: 234 CFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHL 293
             S EDVP+A ++L   +DVNWDPTM+KIVP+I+ INSI++I+  S+SDV  V+EC++HL
Sbjct: 232 SISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHL 291

Query: 294 IYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNA 353
           +YY  V+L D+FQF+NIYAPTS+L +FLTD ++A +CQ YV   ++S   +LP E   N 
Sbjct: 292 VYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINT 351

Query: 354 NHSRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEF 413
           +                   Y+N     + +N            +  +P  + SS +S  
Sbjct: 352 DLDE----------------YSNSGSAIYPNNEILENDDRLRWPMYYKPRNSQSSLSSGI 395

Query: 414 NHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFR 473
           +  N +   +  LPT+SCLFDLYRSLSQG  + DWY  ++ +I  N+ID+RRFITFG+ R
Sbjct: 396 SSGNERT--SNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVR 453

Query: 474 KLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADI 523
            L+YRCY+ P+ K+ G  D+L     +   N + S   ++ N   STA+I
Sbjct: 454 GLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHS-NGDDKNGTASTANI 502

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 71/146 (48%), Gaps = 19/146 (13%)

Query: 539 VPNTDAADEVLRDAYKKLSLNERLP-NPLDQITRSKKLSLEND------ASANVDNR--- 588
           + N+  AD+VL D ++KL+  +  P +P+ +          N        S+N  N+   
Sbjct: 572 ILNSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNGSNIVGYGSSNTGNKVSF 631

Query: 589 KLSSSTSGTAKVLFDMKDRL-SNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDK 647
            LS  +  T   L  M   L S+KD   + Q         K   + LLL+S++  D+ DK
Sbjct: 632 NLSRDSDTTQNNLDHMNPILDSSKDIIAQQQ--------EKNHIRRLLLESLREADNMDK 683

Query: 648 IAIKLEINKQEVEELLKATGEYNIIN 673
           I IKL+  ++EVEELL   G+Y IIN
Sbjct: 684 ICIKLQKPRKEVEELLSEIGDYVIIN 709

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  431 bits (1108), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 263/675 (38%), Positives = 372/675 (55%), Gaps = 136/675 (20%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M+  F+GF PIH+IF+S+FHPTEG+KV +QFPP++L+   I+FD+IKN+VIPKPQLC++L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           LT +Y +YRLV YPVN+++S YARN FSF+FVF+F YD  T PYEPAI RLGKMF+ LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180
           QSQ+LSK +R   ++    +DV  VD                                  
Sbjct: 121 QSQILSKSQRTSAFFK-DGEDVDFVD---------------------------------- 145

Query: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSC-FSVED 239
                    + SI+DL+ +LY+DLNNYSECLIP+D GN I+IK+FP+L PP S   S+ED
Sbjct: 146 --------TKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIED 197

Query: 240 VPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCV 299
           VP++ +NL   VD+NWDPTM+ I+P+I+G+NSI  IS  SDSD  LV+EC+KHLIYY+CV
Sbjct: 198 VPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCV 257

Query: 300 VLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNP 359
           ++ D+FQFSNIYAP+S ++ FL DP IA  CQ YV+    S+++ LP     +   + + 
Sbjct: 258 IITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSD 317

Query: 360 TASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENNK 419
                   +            +++  +E A    + ++L S          SE   +N +
Sbjct: 318 MTQKALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSS----------SEGQQDNPR 367

Query: 420 GILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRC 479
               + LP++  LFDLYRSL+ G T++ WYK NF  I++N IDVR+FI FGV  K+IYR 
Sbjct: 368 Q--GQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRV 425

Query: 480 YSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKKPLV 539
           + YP+             ++ +  +  +S + N+   V ST+DI  D G           
Sbjct: 426 HQYPI------------MEHKTFKSPLLSDRQNDK-IVLSTSDIKFDVG----------- 461

Query: 540 PNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGTAK 599
                 D +L   Y KLS                                         K
Sbjct: 462 ------DRILNSIYNKLS-----------------------------------------K 474

Query: 600 VLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEV 659
           V FD   +L +K    R+   +         ++ +L  +++  +SFD+I  KL  +K EV
Sbjct: 475 VTFDRDKKLESKIGNSRNLGES---------EKNILFNALERHESFDRICSKLGKSKNEV 525

Query: 660 EELLKATGEYNIINS 674
           E ++   GEY  INS
Sbjct: 526 ESIISEIGEYMTINS 540

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  429 bits (1102), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 208/356 (58%), Positives = 279/356 (78%), Gaps = 9/356 (2%)

Query: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60
           M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L++ GI+F+TIKNY+IPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120
           +TFKYG+YR+VCYPV IN+  YARN FSF+FVFVFPYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQN-------CNDKIRRGHHEHA 173
           Q+Q+LSK ERDP+++ LK  +   +  ++  P + +NP +        +DK  +    + 
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 174 F--EKYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPP 231
           F  EKY++I+K + + E   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 232 NSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVK 291
            +C S+EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK+S SD  LV+EC++
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 292 HLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPF 347
           HLIYY CV L D+FQFSNIYAP+S +  FLTDP +A +CQ YV   E S+L  LP 
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPL 356

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

Query: 587 NRKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTEL----KRKRQQQFLLLKSIKNV 642
           N  LS + S +        +R S   FE +  N+ +T      K   +++ +L KSI++ 
Sbjct: 528 NHSLSVTGSKSTTQTNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSA 587

Query: 643 DSFDKIAIKLEINKQEVEELLKATGEYNIINS 674
           ++FDKI + L  +KQEVE  L   GE+ +INS
Sbjct: 588 ENFDKICVLLGKSKQEVENYLSELGEFKVINS 619

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  288 bits (738), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 185/509 (36%), Positives = 284/509 (55%), Gaps = 88/509 (17%)

Query: 187 NEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNS-CFSVEDVPIAKL 245
           N  ++S++DLI ++Y+DLNNYSECLIP+D GN +DIK+FPLL PP +   S+EDVP++ +
Sbjct: 223 NNSRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLV 282

Query: 246 NLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVVLVDMF 305
           +L    DVNWDPTM+K++P+INGIN I+KISK S+S   LV+EC+KHLIYY+CV++ D+F
Sbjct: 283 DLTKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIF 342

Query: 306 QFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPF--------EGRPNANHSR 357
           QFSN Y+ TS +S FLTDP++A  CQ YV+    S+L +LPF        +      H  
Sbjct: 343 QFSNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHH 402

Query: 358 NPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHEN 417
           N    T +FG+   +I +N    SFS++               +   + +S NS  +  N
Sbjct: 403 NRHEKTPSFGS---SITSNNGRSSFSAD---------------DRKQSETSLNSSNDPSN 444

Query: 418 NKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIY 477
           +  I    LPT+  LF+LYRSL+Q   +K+WYK+N+  I +N ID+R+FI FG+ + LIY
Sbjct: 445 SNLISTAHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIY 504

Query: 478 RCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQF-RKK 536
           RC+SYP+                 +     +P++  S + F ++       +  Q  +K 
Sbjct: 505 RCHSYPIV----------------ITPVVSAPESAKSTSPFVSSSGISSSVDSKQHTQKG 548

Query: 537 PL---------VPNT---DAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASAN 584
           P+         VP++   D  D++++  Y+KL   E+  N   +++ S K++ +ND +  
Sbjct: 549 PISRFPGLGSHVPSSGVRDTRDKLMKSFYEKL---EKGKNH-SKVSFSDKIAFQNDEN-- 602

Query: 585 VDNRKLSSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDS 644
            D+   SS     +K    +K                         Q+ +LL SI N+D+
Sbjct: 603 -DHSATSSDNDDKSKSQLTLK-------------------------QRNILLDSISNMDN 636

Query: 645 FDKIAIKLEINKQEVEELLKATGEYNIIN 673
            DKI +KL   + ++EE L   G+Y +IN
Sbjct: 637 MDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

 Score =  201 bits (510), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 98/133 (73%), Positives = 116/133 (87%)

Query: 3   NHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKLLT 62
           NHF+GF+PIH+IFYS+FHPTEGTKVR++FPP +L  S I FD IKNY+IPK QLCNKLLT
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 63  FKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEEQS 122
           FKY +YR+V YP+ IN+ +YARN FSF+FVFVFPYD  TSPYEPAI RLGKMF+VLEEQ+
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 123 QVLSKIERDPIYY 135
           Q+LSK E DPIY+
Sbjct: 131 QILSKAENDPIYF 143

>KAFR0B00430 Chr2 complement(91101..92987) [1887 bp, 628 aa] {ON}
           Anc_7.527 YPR171W
          Length = 628

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 17/94 (18%)

Query: 276 SKYSDSDVGLVMECVKHLIYYDCVVLVDMFQFSNIYAPTS---QLSEFLTDPSIARECQL 332
           SKYS+SD    ++    L+  D +     + +   ++P      +S+F  + +++ + + 
Sbjct: 38  SKYSESD----LQKASELLDDDSLAYRSAYNYERTFSPKKPSYSISDFALENNVSSDSEA 93

Query: 333 YVISSED----------SELHQLPFEGRPNANHS 356
           Y++S ED          +++  LP  G+P   HS
Sbjct: 94  YIVSKEDYMLLNKLKTQNQVAALPSRGQPRERHS 127

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 5/87 (5%)

Query: 134 YYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHH---EHAFEKYHEIMKHIAMNEKQ 190
           Y  L   D+  VD    +   +N  +N +  +  GH    +H   KY     H  M EKQ
Sbjct: 208 YESLNVWDLDTVDNGVIDFFDENLKKNDDWDVLIGHMLGVDHVGHKYGP--NHFTMREKQ 265

Query: 191 LSIEDLITKLYEDLNNYSECLIPMDSG 217
           L +   I K+ + ++N +  ++  D G
Sbjct: 266 LQVNTFIKKIIDSIDNNTLLVVMGDHG 292

>NCAS0H01730 Chr8 (329637..331265) [1629 bp, 542 aa] {ON} Anc_5.365
           YHR078W
          Length = 542

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 110 RLGKMFRVLEEQSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGH 169
           R+ + F V    +++  K+E    Y +   QD+ A+++   EP  KNN +      R G+
Sbjct: 239 RINQRFVVWASHTEIKEKLES---YLYNINQDLNALEKVKSEPHMKNNMEMERLMERIGY 295

Query: 170 HEHAFEKYHEIMK---HIAMNEKQLSIEDLITKLYEDLNNYS 208
           H+    K   ++K   ++    K   +  LI  +Y+ +N ++
Sbjct: 296 HQLEVGKLETLLKKPSNLRTLRKVFDVGFLIYCVYKIVNTFT 337

>TBLA0B04880 Chr2 complement(1148937..1150775) [1839 bp, 612 aa]
           {ON} Anc_8.84 YPL005W
          Length = 612

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 5/105 (4%)

Query: 379 PESFSSNTEFAQKPN-ANTSLPSEPSITHSSKNSEFNHENNKGILNRTLPTRSCLFDLYR 437
           P++F  N     K N   T LP  PS+  S KN +  H + KG L ++L     L +L R
Sbjct: 33  PKNFPINKTHEDKRNPKQTHLPKRPSVAISFKNEDKKHIHRKGTLGKSLIPMKELKELNR 92

Query: 438 SLSQG---QTMKDWYKMNFEVIRKN-RIDVRRFITFGVFRKLIYR 478
             ++    + +    K NF+ +  N + D ++   F  + K + R
Sbjct: 93  GFNKKIVHEYLSPLSKTNFKRLDPNLKYDFKKAEAFTTYSKTVQR 137

>TPHA0O01020 Chr15 (190997..191794) [798 bp, 265 aa] {ON} Anc_1.424
           YCR009C
          Length = 265

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 15/75 (20%)

Query: 136 HLKTQDVKAVDQNSEEPESK-NNPQNCNDKI---RRGHHEHAFEKYHEIMKHIAMNEKQL 191
           H+K  D K VD+N +  E +  + + C + I    RG        YH+ +K +A +  QL
Sbjct: 18  HVKNID-KTVDKNYDIEERRYRSLEKCGEAICLEARG--------YHDSLKQVAQS--QL 66

Query: 192 SIEDLITKLYEDLNN 206
            I ++I+ LY+D NN
Sbjct: 67  KIAEVISSLYDDTNN 81

>NCAS0A09500 Chr1 complement(1889764..1892859) [3096 bp, 1031 aa]
           {ON} Anc_1.268
          Length = 1031

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 3   NHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPD 34
           NHF GF  +    Y  +   +GTK R  F PD
Sbjct: 821 NHFSGFTEVQDPRYYEYIDPDGTKTRLNFSPD 852

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,221,326
Number of extensions: 3830187
Number of successful extensions: 17351
Number of sequences better than 10.0: 118
Number of HSP's gapped: 18126
Number of HSP's successfully gapped: 130
Length of query: 674
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 558
Effective length of database: 40,180,143
Effective search space: 22420519794
Effective search space used: 22420519794
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)