Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30206.16ON94494447120.0
ACR010C6.16ON94593933470.0
SAKL0E01078g6.16ON94895424390.0
KLLA0D01045g6.16ON96594623740.0
Kwal_56.224036.16ON94394423410.0
KLTH0C11330g6.16ON94192823200.0
TDEL0G045306.16ON95889120930.0
NDAI0D008706.16ON106995120290.0
ZYRO0C07898g6.16ON97488720010.0
NCAS0H008806.16ON100489719000.0
KAFR0L003706.16ON96394218370.0
CAGL0B03641g6.16ON98886118320.0
TPHA0M002406.16ON93985118090.0
KNAG0M011306.16ON95078315030.0
Kpol_1032.66.16ON100461712581e-157
YEL061C (CIN8)6.16ON100060212371e-154
Skud_5.286.16ON99860212341e-153
Smik_5.266.16ON100268212221e-151
Suva_5.66.16ON99960211581e-142
Kpol_1045.736.16ON96293411461e-141
TBLA0A072306.16ON109754411161e-135
TPHA0J003006.16ON9829559501e-112
ACR228C7.387ON11295159461e-110
TDEL0C016007.387ON11055529311e-108
ZYRO0B03234g7.387ON11385289321e-108
Ecym_46887.387ON11344839251e-107
SAKL0F12298g7.387ON11124489221e-107
NCAS0E026407.387ON11025298951e-103
KAFR0L017107.387ON11515448971e-103
Suva_2.547.387ON11106268901e-103
NDAI0E043007.387ON11865488881e-102
Skud_2.417.387ON11104558741e-100
YBL063W (KIP1)7.387ON11116538583e-98
Smik_2.537.387ON11136918512e-97
TPHA0E008907.387ON12326548221e-92
TBLA0D006407.387ON11424397415e-82
SAKL0G05016g5.531ON5044224955e-53
Ecym_34152.633ON6624064851e-50
ADR145C2.633ON6353704673e-48
Kwal_47.186085.531ON4794184565e-48
SAKL0G18920g2.633ON6493514551e-46
Ecym_40665.531ON4784094336e-45
KAFR0F042103.528ON6723504364e-44
KAFR0H024108.678ON6583694222e-42
ZYRO0D12650g5.531ON4783674105e-42
Suva_7.443.528ON8053484201e-41
YGL216W (KIP3)3.528ON8053484201e-41
Smik_7.483.528ON8053474173e-41
KLTH0G01606g3.528ON8193584164e-41
Skud_7.533.528ON8053484155e-41
TBLA0C049603.528ON8013844147e-41
NCAS0E005503.528ON7843514102e-40
TBLA0C039403.479ON7393594073e-40
AER441C3.528ON8183714066e-40
NDAI0I029603.528ON8683594076e-40
Kwal_47.190933.528ON8193484059e-40
Kpol_1013.78.678ON6203513981e-39
KLTH0G03850g5.531ON4734103912e-39
SAKL0F01760g3.528ON8093474032e-39
ZYRO0E08668g3.528ON7783484022e-39
Ecym_12003.528ON8333714032e-39
Kpol_1004.255.531ON5063703922e-39
CAGL0D04994g3.479ON6923593983e-39
KLLA0D05951g8.678ON6683453973e-39
CAGL0I07029g3.528ON7053493941e-38
KLLA0A01606g3.528ON7693563951e-38
AGR253W3.479ON7094113922e-38
TDEL0D059603.528ON7333493922e-38
TBLA0C053103.479ON6763423903e-38
TPHA0D032003.479ON7243473895e-38
ZYRO0F07414g8.678ON6543523876e-38
Kpol_423.83.528ON8063503897e-38
KNAG0B005203.528ON7233593842e-37
KNAG0A078803.479ON7643393781e-36
CAGL0M02189g8.678ON6723653752e-36
TPHA0D034803.528ON8473493782e-36
NCAS0F034703.479ON6984303718e-36
TPHA0D012708.678ON6963603701e-35
Ecym_23958.678ON6873563691e-35
TDEL0A062408.678ON6373793653e-35
NDAI0B057703.479ON7633483656e-35
KLTH0D11286g8.678ON6783593611e-34
SAKL0H06490g8.678ON6573473601e-34
Skud_16.4353.479ON7293403602e-34
Smik_16.3883.479ON7293383574e-34
NCAS0C013508.678ON6553543547e-34
YPL155C (KIP2)8.678ON7063723557e-34
Ecym_44073.479ON7113503558e-34
ACR145W8.678ON6853523549e-34
SAKL0F03168g3.479ON7063433541e-33
Skud_16.1278.678ON7063723503e-33
Suva_16.4693.479ON7313453486e-33
TDEL0F036403.479ON7043483476e-33
KLTH0F14498g3.479ON7024003469e-33
NDAI0E02090singletonON6853703441e-32
Kpol_505.393.479ON6923443441e-32
Kpol_1050.1033.479ON6973413441e-32
Kwal_26.88068.678ON7153473423e-32
Smik_6.3528.678ON7153783423e-32
KLLA0B10956g3.479ON6903953371e-31
KLLA0B00759g5.531ON4561703245e-31
Suva_16.1558.678ON7043773263e-30
KNAG0J017208.678ON6253503172e-29
TDEL0B072702.633ON6444452942e-26
TBLA0C018808.678ON4683272873e-26
TPHA0D041903.479ON6723402862e-25
KAFR0B065903.479ON7061482711e-23
Kpol_1019.112.633ON6475332665e-23
YPR141C (KAR3)3.479ON7291442593e-22
ZYRO0B04290g3.479ON7311492551e-21
Suva_11.1452.633ON6573682442e-20
TPHA0N016502.633ON6823672211e-17
Skud_11.1482.633ON6563532183e-17
Smik_11.1602.633ON6563742174e-17
Kwal_55.21164singletonOFF5882981994e-15
Kwal_YGOB_55.211643.479ON6572982004e-15
YKL079W (SMY1)2.633ON6561341729e-12
CAGL0L05104g2.633ON6753511602e-10
TBLA0A008202.633ON8031861594e-10
KNAG0M025402.633ON5221411495e-09
KAFR0C040202.633ON6673451371e-07
NDAI0C004802.633ON5983771343e-07
TBLA0C008002.633ON6931331343e-07
NCAS0H031802.633ON6601061343e-07
ZYRO0E01078g2.633ON6681081155e-05
KNAG0H003602.633ON6814181148e-05
NCAS0C052002.633ON5723191030.001
NCAS0C028308.401ON874127810.60
ZYRO0G12562g3.296ON68677781.3
KAFR0L018707.412ON71274762.2
NCAS0E01710singletonON746101735.8
KLLA0E00903g8.207ON2001105736.4
KAFR0G032504.250ON269130717.1
Kpol_1056.342.497ON146694728.2
KLLA0F15334g5.190ON194546728.2
NDAI0C013705.477ON97499719.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3020
         (944 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...  1819   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...  1293   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   944   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   919   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   906   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   898   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   810   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   786   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   775   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   736   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   712   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   710   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   701   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   583   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   489   e-157
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   481   e-154
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   479   e-153
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   475   e-151
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   450   e-142
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   446   e-141
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   434   e-135
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   370   e-112
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   369   e-110
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   363   e-108
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   363   e-108
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   360   e-107
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   359   e-107
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   349   e-103
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   350   e-103
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   347   e-103
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   346   e-102
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   341   e-100
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   335   3e-98
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   332   2e-97
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   321   1e-92
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   290   5e-82
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   195   5e-53
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   191   1e-50
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   184   3e-48
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   180   5e-48
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   179   1e-46
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   171   6e-45
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   172   4e-44
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   167   2e-42
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   162   5e-42
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   166   1e-41
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   166   1e-41
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   165   3e-41
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   164   4e-41
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   164   5e-41
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   164   7e-41
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   162   2e-40
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   161   3e-40
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   160   6e-40
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   161   6e-40
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   160   9e-40
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   157   1e-39
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   155   2e-39
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   159   2e-39
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   159   2e-39
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   159   2e-39
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   155   2e-39
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   157   3e-39
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   157   3e-39
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   156   1e-38
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   156   1e-38
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   155   2e-38
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   155   2e-38
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   154   3e-38
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   154   5e-38
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   153   6e-38
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   154   7e-38
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   152   2e-37
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   150   1e-36
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   149   2e-36
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   150   2e-36
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   147   8e-36
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   147   1e-35
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...   146   1e-35
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   145   3e-35
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   145   6e-35
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   143   1e-34
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   143   1e-34
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   143   2e-34
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   142   4e-34
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   140   7e-34
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...   141   7e-34
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   141   8e-34
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   140   9e-34
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   140   1e-33
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   139   3e-33
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   138   6e-33
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   138   6e-33
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   137   9e-33
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   137   1e-32
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   137   1e-32
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   137   1e-32
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   136   3e-32
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   136   3e-32
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   134   1e-31
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   129   5e-31
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...   130   3e-30
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....   126   2e-29
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...   117   2e-26
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...   115   3e-26
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...   114   2e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   108   1e-23
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...   107   5e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   104   3e-22
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   102   1e-21
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    99   2e-20
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    90   1e-17
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    89   3e-17
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    88   4e-17
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    81   4e-15
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    82   4e-15
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    71   9e-12
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    66   2e-10
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    66   4e-10
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    62   5e-09
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    57   1e-07
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    56   3e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    56   3e-07
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     56   3e-07
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    49   5e-05
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    49   8e-05
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    44   0.001
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     36   0.60 
ZYRO0G12562g Chr7 complement(992906..994966) [2061 bp, 686 aa] {...    35   1.3  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    34   2.2  
NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON}               33   5.8  
KLLA0E00903g Chr5 (92292..98297) [6006 bp, 2001 aa] {ON} similar...    33   6.4  
KAFR0G03250 Chr7 (674757..675566) [810 bp, 269 aa] {ON} Anc_4.25...    32   7.1  
Kpol_1056.34 s1056 complement(84006..88406) [4401 bp, 1466 aa] {...    32   8.2  
KLLA0F15334g Chr6 complement(1410456..1416293) [5838 bp, 1945 aa...    32   8.2  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...    32   9.4  

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score = 1819 bits (4712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 886/944 (93%), Positives = 886/944 (93%)

Query: 1   MVYNGLTTKKRTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINT 60
           MVYNGLTTKKRTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINT
Sbjct: 1   MVYNGLTTKKRTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINT 60

Query: 61  TGDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGK 120
           TGDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGK
Sbjct: 61  TGDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGK 120

Query: 121 TYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDD 180
           TYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDD
Sbjct: 121 TYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDD 180

Query: 181 TPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLL 240
           TPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLL
Sbjct: 181 TPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLL 240

Query: 241 YEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSY 300
           YEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSY
Sbjct: 241 YEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSY 300

Query: 301 EGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 360
           EGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF
Sbjct: 301 EGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 360

Query: 361 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMK 420
           RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMK
Sbjct: 361 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMK 420

Query: 421 DIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSS 480
           DI              DFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSS
Sbjct: 421 DILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSS 480

Query: 481 QNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHT 540
           QNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHT
Sbjct: 481 QNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHT 540

Query: 541 MKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIR 600
           MKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIR
Sbjct: 541 MKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIR 600

Query: 601 TIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXX 660
           TIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSV        
Sbjct: 601 TIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTE 660

Query: 661 XXXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRN 720
                     YLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALI              RN
Sbjct: 661 MTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRN 720

Query: 721 LMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELX 780
           LMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKEL 
Sbjct: 721 LMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELA 780

Query: 781 XXXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFK 840
                      KQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFK
Sbjct: 781 DNSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFK 840

Query: 841 ESSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSFGPIASTGKTPMRPELKNP 900
           ESSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSFGPIASTGKTPMRPELKNP
Sbjct: 841 ESSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSFGPIASTGKTPMRPELKNP 900

Query: 901 IPKTRSRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMKKIK 944
           IPKTRSRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMKKIK
Sbjct: 901 IPKTRSRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMKKIK 944

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score = 1293 bits (3347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/939 (67%), Positives = 744/939 (79%), Gaps = 3/939 (0%)

Query: 8   TKKRTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIA 67
           T+K  MLDD  EELNITVAVRCRGRNEREIKAKS+VVVTVPDVTGSNEVSINTT ++GIA
Sbjct: 8   TRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIA 67

Query: 68  GKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 127
            KMNSRTYTVD+VFGPSADQ LIFK IAEPLFDDF+KGYNCTVLVYGMTSTGKTYTMTGD
Sbjct: 68  AKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD 127

Query: 128 EKLYDGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKR 187
           EKLYDG+LSDSAGIIPR++F+LFD LEAT+SD LVKCSYIELYNEELKDLLD++ D SKR
Sbjct: 128 EKLYDGQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKR 187

Query: 188 LRIFDSNTITNSRAGSQNNS-PKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSA 246
           LRIFDS+++ +S   S  ++ P+E +   +  ++RR    P K  R S  KQ L E  S 
Sbjct: 188 LRIFDSSSMNHSSRASSQSNSPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247

Query: 247 IYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFR 306
           IY+QN+QEFHI NAREGI+VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK+ +GELFR
Sbjct: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFR 307

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 366
           +SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT
Sbjct: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 367

Query: 367 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXX 426
           RLLQDSLGGNTKTALIATISPAKINADETSSTLEYA KAKNIKNRPQLG+ MMKDI    
Sbjct: 368 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKN 427

Query: 427 XXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLL 486
                     DFLSTK+K+GIYMSHEHYQE+VNDLEN QTEIQESKRQ+ES +SQN+LLL
Sbjct: 428 ISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLL 487

Query: 487 KDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQ 546
           KDKKASQ++ ELQ+ KI +LQ+TIEYL DKIERQH NE +L +TIHKLKEALHTM+GSL+
Sbjct: 488 KDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLK 547

Query: 547 NYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHET 606
           +YETHELRLQNDIKEVLYQGITSYRESM+QHLE VK  MLDKNLSI  N++ I TIF +T
Sbjct: 548 SYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDT 607

Query: 607 LDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXXX 666
           L SV + GSDMC  +VK++K+ PS   ++F E +  L +++ +YS               
Sbjct: 608 LKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISEENN 667

Query: 667 XXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNLMLSSM 726
               YLD+H  KN+ QE+LDLRME  Y K K  SD L+              R LM++SM
Sbjct: 668 HLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSM 727

Query: 727 KDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXXXXXXX 786
           KD V+E+ID E  +FQP+++RW+ S +NIN+CDA+HQ FE KST  L  LKEL       
Sbjct: 728 KDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKS 787

Query: 787 XXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKGF 846
                 + +    +F   V++    +S+ KQM+DI+DKH+MLEDHF++N+KYFKESSKGF
Sbjct: 788 SEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGF 847

Query: 847 EEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSFGPIASTGKTPMRPELKNPI-PKTR 905
           E+MDCSIKKII EMSPEVGDIK +E L+ER+N+R+F P+  TGKTP R  LKN I  K  
Sbjct: 848 EDMDCSIKKIIHEMSPEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNAITSKAS 907

Query: 906 SRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMKKIK 944
           SRSMSPIK+LDTNV  + P +KRGT++   +GP  KK++
Sbjct: 908 SRSMSPIKTLDTNVRIISP-VKRGTIEFGAEGPPTKKVR 945

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/954 (51%), Positives = 661/954 (69%), Gaps = 32/954 (3%)

Query: 11  RTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKM 70
           R + ++  +ELNITV+VRCRGRNEREIKAKS+VVVTVPDVTGSNEVSINTT ++GI  +M
Sbjct: 7   RELSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQM 66

Query: 71  NSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
           NS+TYTVD+VFGPSADQ LIFK IAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE+L
Sbjct: 67  NSKTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERL 126

Query: 131 YDGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRL 188
           YDGELSD+AGIIPR+LF+LFDTLE  + D+LVKCS+IELYNEELKDLL++  +    K+L
Sbjct: 127 YDGELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKL 186

Query: 189 RIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTK----------------PKR 232
           RIFDSNT +++   +  N+     GTS +  +   T +P K                P+ 
Sbjct: 187 RIFDSNTTSSNSRNNSRNNSPNLVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQQQQPRL 246

Query: 233 PSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIF 292
            +  +Q L EQSSAIYIQNLQEFHITNA++GI++LQ+GLKHRQVASTKMNDFSSRSHTIF
Sbjct: 247 INNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIF 306

Query: 293 TIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 352
           TIMLYK++ GE+FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA
Sbjct: 307 TIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 366

Query: 353 DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRP 412
           DK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINA+ETSSTLEYATKAKNIKN+P
Sbjct: 367 DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKP 426

Query: 413 QLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESK 472
           QLG+ +MKDI              DFLSTK+K+GIYM+ +HY+E+ +DLENY+TE+QE K
Sbjct: 427 QLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECK 486

Query: 473 RQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIH 532
           R++E  +SQN LLLKDK+AS +++ELQ +KI  L + I +L DK+++QH+NE DLV TIH
Sbjct: 487 REIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIH 546

Query: 533 KLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSI 592
            LK+A++T++ SL+N E ++L+ ++++++VLY  +TS+++S+ + L  +K     ++L I
Sbjct: 547 TLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGI 606

Query: 593 NHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSV 652
           + N+D I+    + L+S+ S   D+C + V+ + +     ++  +  L D+ T V +YS 
Sbjct: 607 DGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSN 666

Query: 653 XXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXX 712
                             YL+EH  KNN++E L + ++K YH  K ++  L         
Sbjct: 667 ELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMD 726

Query: 713 XXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKL 772
                 ++LM+ S+K A  E++ KE+++F PVK++W  S ENIN+CD+ +  F++     
Sbjct: 727 SHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDA 786

Query: 773 LTNLKELXXXXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHF 832
           L  L+                V++++  F+GI         +V  +N++ +KH  L D  
Sbjct: 787 LRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQV 846

Query: 833 ENNIKYFKESSKGFEEMDCSIKKIIREMSPE--VGDIKQIEALLERVNSRSFGPIASTGK 890
           E    Y + +++ FE +D  I++II +  P   VG+ + +  +LE++      PI S  +
Sbjct: 847 ERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPIGSASR 906

Query: 891 TPMRPELKNPIPKTRSRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMKKIK 944
           TP             SRS+SP+K+LD N+ + +   KR   + E D    ++IK
Sbjct: 907 TP------------SSRSVSPMKTLDNNIFNGISPSKRKVDETENDRSKSQRIK 948

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/946 (51%), Positives = 658/946 (69%), Gaps = 35/946 (3%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78
           +ELNITVAVRCRGRNE+EIKAKS+VVV  PDV G+NEVSINT+GDIGI  +MNS+TYTVD
Sbjct: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138
           +VFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELS++
Sbjct: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130

Query: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDY----SKRLRIFDSN 194
           AGIIPRVLF+LFDTLE  ESD++VKCS+IELYNEELKDLLDD  D     S++LRI+DS 
Sbjct: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190

Query: 195 TITNSRAGSQNNSPKEQDGTSSSM-AKRRY---THIPTKPKRPSLNKQL----------- 239
             +N+     + S    +  + ++ AKRR         KPK P+ ++             
Sbjct: 191 NSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQQQQQQ 250

Query: 240 -----------LYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRS 288
                      + EQSSAIYIQ+LQEFHIT+A+EG+ +LQKGL HRQVASTKMND SSRS
Sbjct: 251 QQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRS 310

Query: 289 HTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 348
           HTIFT+ LYK++ GE FR+SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI
Sbjct: 311 HTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370

Query: 349 NSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
           NSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ETSSTLEYATKAKNI
Sbjct: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430

Query: 409 KNRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEI 468
           KN+PQLGSFMMKDI              DFLSTK+KEGIYMSH HY E++ND+ENY+TEI
Sbjct: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEI 490

Query: 469 QESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLV 528
           QES+R++E  SSQN LL KDKK+SQ   E Q ++I  LQ++++YL +KI+ +H+NEI+L 
Sbjct: 491 QESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELT 550

Query: 529 STIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDK 588
           + I KLK+A+  M+G+L+ +E HE RLQ+DI+++LY  I  YR  ++  L+ +K + L++
Sbjct: 551 NMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQ 610

Query: 589 NLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALGDLDTKV 647
           + +I+ +++ ++      L++V+     MC N+  K+V DQP        E L D+ +KV
Sbjct: 611 SFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSE-LNDMFSKV 669

Query: 648 QTYSVXXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXX 707
             ++                   YLD HF +NN+QE+L++  +K YH+   +S  L+   
Sbjct: 670 DEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKI 729

Query: 708 XXXXXXXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFEN 767
                      R L++ ++K A +E+I +E+  F+PV++ W  SF +IN CD+   +F++
Sbjct: 730 TNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKD 789

Query: 768 KSTKLLTNLKELXXXXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKM 827
            +T+ L +LK               ++++N+ +F+     A+   +I   ++DI +KH +
Sbjct: 790 DTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSV 849

Query: 828 LEDHFENNIKYFKESSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSFGPIAS 887
           L D  E N+ +   SS+GF+ +D S+K+I+    PE       + L++ ++S S  P+AS
Sbjct: 850 LRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVAS 909

Query: 888 TGKTPMRPELKNPIP-KTRSRSMSPIKSLDTNVVHVVPLIKRGTMD 932
           +GKTP+RP LK+    ++ S+S+SP KS    +++  PL KR + D
Sbjct: 910 SGKTPLRPLLKSETKQRSLSKSVSPAKSSHATIIN-SPL-KRKSSD 953

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/944 (50%), Positives = 639/944 (67%), Gaps = 21/944 (2%)

Query: 13  MLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNS 72
           M DD  EELNITVAVRCRGRNE+E+KA+S+VVV VPDVTG+NEVSINTTGD GI  ++NS
Sbjct: 1   MSDD--EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINS 58

Query: 73  RTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 132
           +TYTVD+VFGPSADQ LIFK IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LYD
Sbjct: 59  KTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118

Query: 133 GELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRLRI 190
           GELS+ AGIIPRVLF+LFD L A   D+++KCS+IELYNEELKDLLD+TPD S  K+LRI
Sbjct: 119 GELSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178

Query: 191 FDSNTITNSRAGSQNNS--PKEQDGTSSSMAKRRYTHIPT--KPKRPSLNKQL-LYEQSS 245
           FDS +  +S + + + +  PK  +G  SS   RR T  P+  +P +  ++K +   E SS
Sbjct: 179 FDSVSNVSSNSRASSRNNSPKPNEG--SSFGTRRKTRAPSIHRPTKSPVSKPVSPCEPSS 236

Query: 246 AIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELF 305
           AI+IQNLQEFHI +A+EGI +LQ+GL+HRQVASTKMND SSRSHTIFTIMLYK   GE F
Sbjct: 237 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESF 296

Query: 306 RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKL 365
           R+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS+HIPFRESKL
Sbjct: 297 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKL 356

Query: 366 TRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXX 425
           TRLLQDSLGGNTKTALIATISPAKIN++ETSSTLEYATKAKNIKN+PQ+GSF+MKD+   
Sbjct: 357 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLK 416

Query: 426 XXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLL 485
                      D LSTK+K+GIYMS E+Y+E+ N+LENY+TE++E KR +E  S+QNSLL
Sbjct: 417 SVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLL 476

Query: 486 LKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSL 545
           +K+K+ S ++NE Q +K+ +L N IE+L DKI+RQH+NE +L + + +L  ALHTM+ SL
Sbjct: 477 IKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSL 536

Query: 546 QNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHE 605
           + YE    R   +++ VLY  I S+++S+   +E +K  + +    +  N+D + T    
Sbjct: 537 RIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTTELTR 596

Query: 606 TLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXX 665
             D + S+  ++  N +K V DQ    ++     +  + + V +YS              
Sbjct: 597 IFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSISEEY 656

Query: 666 XXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNLMLSS 725
                YL+EHF KNN QE LD+ +++ YH+ K +++++               +  M+ S
Sbjct: 657 NNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQS 716

Query: 726 MKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXXXXXX 785
           ++ A SE++ KE+ +  PVK+ W  S ENINECD  +  FENK    +  + +       
Sbjct: 717 LRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQK 776

Query: 786 XXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKG 845
                 +  +  +T              I++ ++ I  KH +L+   +++  Y + +++ 
Sbjct: 777 TSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQK 836

Query: 846 FEEMDCSIKKIIREMS-PEVGDIKQIEALLERVNSRSFGPIASTGKTPMRPELKNPI--- 901
           F E+D SI+ ++   + P+      I+ LLE++N +S  P+  +GKTPMR   ++     
Sbjct: 837 FGEIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTD 896

Query: 902 ----PKTRSRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMK 941
               P+  S ++SPIK +D N     P  KRG +  + + PA K
Sbjct: 897 QLLPPQKSSYTISPIKEIDGNRRLTSPH-KRGVVS-DHERPAFK 938

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/928 (50%), Positives = 630/928 (67%), Gaps = 13/928 (1%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78
           EELNITVAVRCRGRNE+E+KAKS+VVV VPDVTG+NEVSINTTGD GI  ++NS+TYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138
           +VFGPSADQ LIFK IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LYDGELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRLRIFDSNTI 196
           AGIIPRVLF+LFD L+A   D+++KCS+IELYNEELKDLLD+TPD S  ++LRIFDS T 
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTN 184

Query: 197 TNSRAGSQNNSP-KEQDGTSSSMAKRRYTHIPTKPKR-PSLNKQLLYEQSSAIYIQNLQE 254
            NS   S  NS  K  +G++S   +R   +   KP R P++   L  E +SAI+IQNLQE
Sbjct: 185 PNSSRSSSRNSSPKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNLQE 244

Query: 255 FHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVD 314
           FHI +A+EGI +LQ+GL+HRQVASTKMND SSRSHTIFTIMLY+   GE FR+SKMNLVD
Sbjct: 245 FHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVD 304

Query: 315 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLG 374
           LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLTRLLQDSLG
Sbjct: 305 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLG 364

Query: 375 GNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXXXXXXX 434
           GNTKTALIATISPAKIN++ETSSTLEYATKAKNIKN+PQ+GSF+MKD+            
Sbjct: 365 GNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKI 424

Query: 435 XXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQ 494
             D L+TK+K+GIYMS E+Y+E+ N+LENY+TE+QE KR +E  S+QN LL K+K+ + +
Sbjct: 425 RSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNE 484

Query: 495 LNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELR 554
           +NE Q +KI +L N I++L DKI+RQH+NE +L + + +L  AL TM+ SL+ YE    R
Sbjct: 485 VNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHR 544

Query: 555 LQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAG 614
            Q +++ VLY+ I S++ S+   +E +K    D    ++ N+D +    +   D + ++ 
Sbjct: 545 FQTEMERVLYENIGSFKHSLLNEIEKLKGTEED-GFDVDANIDTLTKELNRIYDFINTST 603

Query: 615 SDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXXXXXXXYLDE 674
            ++C   +  + +Q  T  Q  +  +  +   V +YS                   YL+E
Sbjct: 604 IEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNE 663

Query: 675 HFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNLMLSSMKDAVSEMI 734
           HF KNN Q+ LD+ +++ YH+ K +++++               + +M+ S+K+A SE++
Sbjct: 664 HFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVV 723

Query: 735 DKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXXXXXXXXXXXXKQV 794
            KE+ +  PVK+ W  S ENINECD  +  FE     ++ ++ E                
Sbjct: 724 AKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDA 783

Query: 795 QENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKGFEEMDCSIK 854
             +++ F+   R     + I   + +I  KH ML+   +++  Y + +++ F E+D SI+
Sbjct: 784 NLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQ 843

Query: 855 KIIREMS-PEVGDIKQIEALLERVNSRSFGPIASTGKTPMR-------PELKNPIPKTRS 906
            ++   +  +     +IE LLE++N +   P+  +GKTPMR          +  +P+ RS
Sbjct: 844 GLLNSQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPRKRS 903

Query: 907 RSMSPIKSLDTNVVHVVPLIKRGTMDIE 934
            S+SPI+ +D N     P  ++ T+D E
Sbjct: 904 YSISPIREIDGNRKASSPFKRKITIDHE 931

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/891 (47%), Positives = 605/891 (67%), Gaps = 21/891 (2%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78
           EELNITVAVRCRGRNEREIKAKS+VVV+VPDVTGSNEVSINTTGD+GI  ++NS+TYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138
           +VFGPSA+Q L+F+ IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELS+S
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDY--SKRLRIFDSNTI 196
           AGIIPR+LF+LF+TLE  + D++VKCS++ELYNEELKDLL D+ +   S++LRIFDSNT+
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTM 192

Query: 197 TNS-RAGSQNNSPKEQDGT---------SSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSA 246
           + +  + S  NS K              +++  ++R+   P+  +    + Q   +Q++ 
Sbjct: 193 SAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAPSVTQ----SHQNSQDQNAG 248

Query: 247 IYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFR 306
           IYIQNLQ+FHITNA+EGI +LQKGLKHRQVA+TKMNDFSSRSHTIFTI LYK Y GE+FR
Sbjct: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFR 308

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 366
           +SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DKS+H+PFRESKLT
Sbjct: 309 VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLT 368

Query: 367 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXX 426
           RLLQDSLGGNTKTALIATISPAKIN++ET STL+YA KAKNIKN+PQLGS +MKDI    
Sbjct: 369 RLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKN 428

Query: 427 XXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLL 486
                     D LSTK+KEGIYMS ++Y+E+ NDLE+Y+TE++E KR +E+ +SQN+LLL
Sbjct: 429 ITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLL 488

Query: 487 KDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQ 546
           KDKKAS ++N+LQ +K+  +++ +  L  K E+Q++ E +LV+T   LK  + TM+  ++
Sbjct: 489 KDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIK 548

Query: 547 NYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHET 606
            +E  E  +++ + ++        ++++  ++  ++ ++  +N+ +  N+D IR    + 
Sbjct: 549 EHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKL 608

Query: 607 LDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXXX 666
           L+  +    DM  + V+ + D+    +Q   E + +++  + T                 
Sbjct: 609 LERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFN 668

Query: 667 XXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNLMLSSM 726
               YL++HF KNN++E+L   +++ YH  +T++D L               ++LML S+
Sbjct: 669 NLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESL 728

Query: 727 KDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXXXXXXX 786
           K A  ++I KE+++F+P K++W  SF+ IN+CD+ +  F+N     L  +K         
Sbjct: 729 KTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEA 788

Query: 787 XXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKGF 846
                 +V+E +   E      S      +Q + I +K  +L +  + ++    + +   
Sbjct: 789 INKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAV 848

Query: 847 EEMDCSIKKIIREM--SPEVGDIKQIEALLERVNSRSFGPIASTGKTPMRP 895
           +++  +I  ++ E   S E   ++ ++ +L R++ ++   +    ++P+RP
Sbjct: 849 DKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQN---LLYLDRSPLRP 896

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/951 (45%), Positives = 596/951 (62%), Gaps = 78/951 (8%)

Query: 21   LNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQV 80
            LNITVAVRCRGRNEREIK KS+V+VTVPD+ GSNEVSINTT D+GI  +MNS+TYTVD+V
Sbjct: 52   LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 81   FGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDSAG 140
            FGPSA+Q+LIF  +AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS+SAG
Sbjct: 112  FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 141  IIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKR-------LRIFDS 193
            IIPR+LF+LFDTLE  + D++VKCS+IELYNE+LKDLL+D  +           LRIFDS
Sbjct: 172  IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFDS 231

Query: 194  NTITN---------SRAGSQNNSPKEQDGTSS---------------------------- 216
            +T +N         SRA S+NNSP+    TS+                            
Sbjct: 232  STASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPENSNIFT 291

Query: 217  ----------------SMAKRRYTHIPTK-------PKRP--SLNKQLLYEQSSAIYIQN 251
                            S +K + +++ T        PK P  SL      + ++ IYIQN
Sbjct: 292  SNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNGIYIQN 351

Query: 252  LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMN 311
            LQEFHI+NA+EG+++LQKGLK+RQVASTKMNDFSSRSHTIFTI LYK ++G LFR+SKMN
Sbjct: 352  LQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMN 411

Query: 312  LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQD 371
            LVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD++ HIPFRESKLTRLLQD
Sbjct: 412  LVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQD 471

Query: 372  SLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXXXX 431
            SLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGS + KDI         
Sbjct: 472  SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNITTEL 531

Query: 432  XXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKA 491
                 D LSTK+KEGIYMS EHYQ+++N+L+N++TE  ESKR +E  SSQN+LLLKDK+ 
Sbjct: 532  SQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKDKRT 591

Query: 492  SQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETH 551
            S ++NELQ +K+++ Q++I  L +KIE Q+  E  LVS++ KL+ +  T K  ++NYE  
Sbjct: 592  SNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQ 651

Query: 552  ELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVR 611
            ++ +++ I+++L   + S R  +  H   +KT     +  I  N+D I+    + L + +
Sbjct: 652  QIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEVIKMLGTTQ 711

Query: 612  SAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXXXXXXXY 671
                      ++    Q   ++++  E + D++ K+Q +                    Y
Sbjct: 712  EKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNLKQY 771

Query: 672  LDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNLMLSSMKDAVS 731
            L+E+  +NN++++++  +         ++D L               RNLML+S K A  
Sbjct: 772  LNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKAATD 831

Query: 732  EMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXXXXXXXXXXXX 791
            E+I+KE+E+F P K++W  S + IN+CD+ +  F+ + T  L+  +              
Sbjct: 832  EVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASINQMYDNS 891

Query: 792  KQVQENVTNFEGIVRQASAK------ESIVKQMNDINDKHKMLEDHFENNIKYFKESSKG 845
             +++  ++   G     + K      + I  Q N++  K+ + +D+ EN++K    S   
Sbjct: 892  TRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKCAVASVNN 951

Query: 846  FEEMDCSIKKIIREMSPEVGDIK-QIEALLERVNSRSFGPIASTGKTPMRP 895
               ++ SIK  +R+   + G  + ++    ++ N +  GP    G  P++P
Sbjct: 952  LNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKENGKE-GP-TKPGLQPLQP 1000

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/887 (47%), Positives = 574/887 (64%), Gaps = 53/887 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78
           EELNITVAVR RGRNEREI+AKS+VVV+VPDV GS+EV+INTT D+GI  +MNS+TY VD
Sbjct: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138
           +VFGPSA+Q+LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRLRIFDSNTI 196
           AGIIPR+LF+LF+TL+  + D++VKCS++ELYNEELKDLLDD+ + S  ++LRI+DS + 
Sbjct: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSGSG 192

Query: 197 TNS----RAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQS-------- 244
           +NS    R  S+NNSPK     +  M  RR   + T P   SL KQ    Q         
Sbjct: 193 SNSNSGSRKNSRNNSPKL---VTDPMINRR--RMRTVPLSSSLAKQQHQWQQRREQQHQL 247

Query: 245 ---------------------------SAIYIQNLQEFHITNAREGISVLQKGLKHRQVA 277
                                      S +YIQNLQ+FHIT+AR+G+ +LQKGL++RQVA
Sbjct: 248 REQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVA 307

Query: 278 STKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSI 337
           +TKMNDFSSRSHTIFTI LY+ ++GE+F++SKMNLVDLAGSENISRSGAQ+QRAKEAGSI
Sbjct: 308 TTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSI 367

Query: 338 NQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSS 397
           NQSLLTLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ET S
Sbjct: 368 NQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCS 427

Query: 398 TLEYATKAKNIKNRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEM 457
           TL+YA+KAKNIKNRPQL SF+MKDI              D LSTK +EG+YMS ++Y+E+
Sbjct: 428 TLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEI 487

Query: 458 VNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKI 517
            NDLE+Y+TEIQESKR +E  SSQNSLLLKDKKAS ++NELQ +K+  +++ +  L +K+
Sbjct: 488 TNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKL 547

Query: 518 ERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQH 577
           E QH+ E +LV     LK  L   +  ++ Y   E ++   ++ +L Q    +R+ +  +
Sbjct: 548 ESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNN 607

Query: 578 LETVKTRMLDKNL-------SINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPS 630
           +E ++T     ++        I  N++ +R    E L   +     M  + ++ + ++  
Sbjct: 608 IEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAP 667

Query: 631 TSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLRME 690
           T +Q     +  ++  V TY                    Y ++HF KNN++E+L+  ++
Sbjct: 668 TVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHID 727

Query: 691 KAYHKSKTASDALIXXXXXXXXXXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKERWVL 750
           K Y + + ++D L+              + LM+ S++ A +E IDKE+++F+P +++W  
Sbjct: 728 KTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEE 787

Query: 751 SFENINECDAAHQQFENKSTKLLTNLKELXXXXXXXXXXXXKQVQENVTNFEGIVRQASA 810
           SF+ IN CD+    F       L+++K               +V++ V  +E        
Sbjct: 788 SFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDG 847

Query: 811 KESIVKQMNDINDKHKMLEDHFENNIKYFKESSKGFEEMDCSIKKII 857
            E + +Q+ DI +K   L +    +IK  +     F+E+   I+  I
Sbjct: 848 NEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTI 894

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/897 (45%), Positives = 569/897 (63%), Gaps = 53/897 (5%)

Query: 20  ELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQ 79
           ELNITVAVRCRGRNEREI +KS VVVTVPD+TG+ E+SINTTG+ GI  +MNS+TYTVD+
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 80  VFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE--LSD 137
           VFGP+ADQ LIF+ +AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY     LSD
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 138 SAGIIPRVLFRLFDTLE--------ATESDHLVKCSYIELYNEELKDLLD-DTPDY---- 184
           +AGIIPR+LF+LFDTL+         + +D +VKCS++ELYNE+LKDLL+ D+ D     
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 185 ----SKRLRIFDSNTITNSRAGSQNNSPKEQDG----TSSSMAKRRYTHIPTKPK----- 231
               S++LRIFDS    N+ + S  +S          TSS +     T++  + K     
Sbjct: 208 QQLGSRKLRIFDSTNNNNNNSNSNASSRASSRNNSPRTSSILPNANATNLAMRKKSIRYN 267

Query: 232 -------------RPSLNKQLLY-----EQSSAIYIQNLQEFHITNAREGISVLQKGLKH 273
                        RP+ N +        E ++ IYIQNLQEFHITNA+EG+S+LQKGLKH
Sbjct: 268 YNSNNKAKSSNNTRPNTNDEPSSIAGPDENTNGIYIQNLQEFHITNAKEGLSLLQKGLKH 327

Query: 274 RQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKE 333
           RQVASTKMNDFSSRSHTIFTI LYK ++  LFR+SKMNLVDLAGSENI+RSGA NQRAKE
Sbjct: 328 RQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLVDLAGSENINRSGAMNQRAKE 387

Query: 334 AGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAD 393
            GSINQSLLTLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+ ++
Sbjct: 388 TGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSE 447

Query: 394 ETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEH 453
           ET STLEYA+KAKNIKN+PQLGS ++KDI              D +STK+K+GIYMSHEH
Sbjct: 448 ETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKVKSDLMSTKSKDGIYMSHEH 507

Query: 454 YQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYL 513
           YQE++ +LE+ +TE+QESKR +E  SSQNS+LLKDK+++ ++NELQ +K+  L++++  L
Sbjct: 508 YQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANEVNELQRIKLNNLKDSMSNL 567

Query: 514 CDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRES 573
            +K+E Q+  E  L+  I +L+++   +   ++NY+T + +L+  I  +L + +   ++ 
Sbjct: 568 NEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQSQLKTQISNILNENLFELKKI 627

Query: 574 MDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSY 633
           ++ H + +  R  + N  +  N+  I+      L+  +     M    ++   +Q   + 
Sbjct: 628 LNSHKDAI--RQSEGNFDVEMNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINL 685

Query: 634 QQFKEALGDLDTKVQTYSVXXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAY 693
           Q+  E +  ++  V  Y                    YLD  F +NN++++L++ +    
Sbjct: 686 QKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIHINATS 745

Query: 694 HKSKTASDALIXXXXXXXXXXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFE 753
                +S  L               + LM+ + + A +++I KE+E+F+P + +W  S E
Sbjct: 746 DILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDVITKEMELFKPKRNKWEESIE 805

Query: 754 NINECDAAHQQFENKST----KLLTNLKELXXXXXXXXXXXXKQVQENVTNFEGIVRQAS 809
            IN CD+ +  F +  T    K+ TNL                QV E ++N +  V+ A 
Sbjct: 806 LINRCDSINNGFHHNMTGQVSKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDSDVKTAL 865

Query: 810 AKESIV-KQMNDINDKHKMLEDHFENNIKYFKESSKGFEEMDCSIKKIIREMSPEVG 865
             + +  K  N+I +K+ +L+ + +N I Y  +S    +E+  ++K  +  +  +V 
Sbjct: 866 ENDPMFNKHFNEIIEKNMILQKNRKNAINYTDKSLLNIDELSETVKIALNNIVDDVA 922

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/942 (44%), Positives = 567/942 (60%), Gaps = 118/942 (12%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78
           EELNITVAVRCRGRN+REI AKS+VVVTVPD+ GS EV+INT+ DIG   +MNS+TYTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138
           +VFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLL-----DDTPDYSKRLRIFDS 193
           AGIIPR+LF+LF+TLE    DH+VKCS++ELYNEELKDLL     +D  ++ K+LRIFDS
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNF-KKLRIFDS 193

Query: 194 NTITNSRAGSQNNSPKEQDGTSSSMAKR-------RYTHIPTKPKRPSL----------- 235
               +SR+ S+NNSPK  +  ++ + K+       R  +I +  KR S+           
Sbjct: 194 -LGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIAS-SKRSSMQTIRNTTTTKA 251

Query: 236 ------------------NK---------QLLYEQSSAIYIQNLQEFHITNAREGISVLQ 268
                             NK          +  +Q++ IYIQNLQEFHIT A+EGI +LQ
Sbjct: 252 SATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQ 311

Query: 269 KGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQN 328
           KGLK+RQVASTKMNDFSSRSHTIFTI L+K  +GE+FR+SKMNLVDLAGSENI+RSGA N
Sbjct: 312 KGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALN 371

Query: 329 QRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPA 388
           QRAKEAGSINQSLLTLGRVINSLADK++H+PFRESKLTRLLQDSLGGNTKTALIATISPA
Sbjct: 372 QRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPA 431

Query: 389 KINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIY 448
           K+  +ET STLEYA+KAKNIKN+PQLGSF+MKDI              D LSTK+K+GIY
Sbjct: 432 KVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIY 491

Query: 449 MSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQN 508
           M  +HY+E+  DL+NY+TEIQE KR +ES +SQN+LLLKDK+   + NELQ +KI  +  
Sbjct: 492 MDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNE 551

Query: 509 TIEYLCDKIERQH--RNEID-----LVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKE 561
           +++ L  KIERQ    NE+D        T  KL + +  MK         E  + +  K 
Sbjct: 552 SMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKN-------REALVNSKFKT 604

Query: 562 VLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDM---C 618
           +L   ++   + ++  +E  K + +++N +++ N+  I++     L + R         C
Sbjct: 605 LLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQEC 664

Query: 619 TNIVKIVKDQP-----------------STSYQQFKEALGDLDTKVQTYSVXXXXXXXXX 661
             I K + D P                 S  Y Q  E L DL  +   +           
Sbjct: 665 --ITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNF----------- 711

Query: 662 XXXXXXXXXYLDEHFL---KNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXX 718
                    ++ + F    K +  E+L+  +       +++S+ ++              
Sbjct: 712 -------KQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN 764

Query: 719 RNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKE 778
           + L+++S+ +  +E++  EL+  +P   +W  S E IN  DA + +F +     +T + +
Sbjct: 765 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD 824

Query: 779 LXXXXXXXXXXXXKQVQENV-TNFEGIVRQASA---KESIVK-QMNDINDKHKMLEDHFE 833
                        K++ E+  TN   I    +      +I+K     I +K+  L +  +
Sbjct: 825 KIKQTNDSINNNIKKINEHFKTN--DIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVK 882

Query: 834 NNIKYFKESSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLE 875
                  ES K   E+D SI+ +++++  E  DIK+  + L+
Sbjct: 883 EGYLVTNESMKKLNELDTSIRTVLKDIDYE-KDIKETNSPLK 923

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/861 (46%), Positives = 526/861 (61%), Gaps = 51/861 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78
           EELNI VAVRCRGRNEREIKAKS+VVV VPD   +NEVSINTT D+GIA KMNS+TYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138
           +VFGPSA QKL+++ IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL++GEL D+
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS----KRLRIFDSN 194
           AGIIPRVLF LFDTLEA + D+LVKCS++ELYNEELKDLLD T   +    K+LRIFDSN
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDSN 209

Query: 195 ----------------------TITNSRAG-----------------SQNNSPK----EQ 211
                                    NSRA                  S NN  K    +Q
Sbjct: 210 VNGTSASGSSSRSSSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISNNNHNKFSRFKQ 269

Query: 212 DGTSSSMA----KRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVL 267
               S+ A      +  HIP      +  +Q   +QS++IYIQNL+EFHIT+A EG+ +L
Sbjct: 270 TSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHITSAMEGLQLL 329

Query: 268 QKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQ 327
           QKGLK RQVASTKMNDFSSRSH+IFTI LYK   GELFR+SKMNLVDLAGSENISRSGA 
Sbjct: 330 QKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISRSGAM 389

Query: 328 NQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISP 387
           NQRAKEAGSINQSLLTLGRVINSLADKS HIPFRESKLTRLLQDSLGGNTKTALIATISP
Sbjct: 390 NQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISP 449

Query: 388 AKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGI 447
           AK+ ++ET STLEYA+KAKNIKN+PQLG+F+MKDI              D LSTK+KEG+
Sbjct: 450 AKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLSTKSKEGV 509

Query: 448 YMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQ 507
           YMSHEHY+++  D+E Y+TE++ESKR +ES ++QN++L +++ + +  N      I  L+
Sbjct: 510 YMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKANIASLK 569

Query: 508 NTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGI 567
           + +  L   ++ Q   E ++ S +  ++ A   MK ++  +E  +  LQ  I   +   I
Sbjct: 570 DNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFISDEI 629

Query: 568 TSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKD 627
           ++ R+++ +H+E ++     K+  I+ N+  +     + + +     S      VK++  
Sbjct: 630 SNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEASKSYGECVKMMLK 689

Query: 628 QPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDL 687
           +    ++     L ++    +                      YL  +F KNN++E+L  
Sbjct: 690 ETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEELLSH 749

Query: 688 RMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKER 747
            ++  Y + +  S  L+              +  ML ++     E+I+ EL+MF   + +
Sbjct: 750 HVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQRAK 809

Query: 748 WVLSFENINECDAAHQQFENKSTKLLTNLKELXXXXXXXXXXXXKQVQENVTNFEGIVRQ 807
           W  S   IN+CD+ +  F       L  ++++              +Q    N + I   
Sbjct: 810 WEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQSRTRNRQSIEEM 869

Query: 808 ASAKESIVKQMNDINDKHKML 828
               + I +Q+  I  K+K L
Sbjct: 870 IQGNDVIRQQITRIKQKNKSL 890

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/851 (46%), Positives = 544/851 (63%), Gaps = 23/851 (2%)

Query: 14  LDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDI--GIAGKMN 71
           ++D  +E+NI VAVRCRGRN+REIK+KS+V+V+VPDV GSNE+SINT+ DI  G+  ++N
Sbjct: 8   IEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLN 67

Query: 72  SRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
           S+TYTVD+VFGPSA+Q+LIF+ IAEPLF+DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY
Sbjct: 68  SKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLY 127

Query: 132 DGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS-KRLRI 190
            G+LSDSAGIIPRVLF+LF+T+E    ++++KCS+IELYNEELKDLL D+ +   K+LRI
Sbjct: 128 KGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQ 250
           FDSN   +S   + +          S M  R+    P      +   Q     +++IYIQ
Sbjct: 188 FDSNLSKSSNNNNISRQNSH---FISGMDLRKNPINPINNSNDNTAIQ---NGNASIYIQ 241

Query: 251 NLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKM 310
           NL+EFHI NAREGI +LQKGLK+RQVASTKMND SSRSHTIFTI LYK ++GE+F+ISKM
Sbjct: 242 NLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKM 301

Query: 311 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQ 370
           NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADK+IHIPFRESKLTRLLQ
Sbjct: 302 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQ 361

Query: 371 DSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXXX 430
           DSLGGNTKTALIATISPAK+NA+ET STLEYATKAK+IKN+PQLGS +MKD+        
Sbjct: 362 DSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNE 421

Query: 431 XXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKK 490
                 D  STK K+G+YM+  HY+++ NDLE+Y+TEIQE  R V+S   QN+LLLKDKK
Sbjct: 422 LAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDKK 481

Query: 491 ASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYET 550
           AS ++N+LQ++ +  + NT+  +   +E QH+ E  LV  +   +E    MK  ++ Y  
Sbjct: 482 ASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYSE 541

Query: 551 HELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSV 610
            E R+Q+++K +    +   +E + ++L  +      +NL +  N+ +   +  + + S+
Sbjct: 542 KEERIQSNMKSIFNDELIKLKELLIENLNGIAK----ENLIVQTNVKDNIKLIKDDVISI 597

Query: 611 RSAGSDMCTNIV-----KIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXX 665
            +   ++   +      +I+K+ P    + F   +       +TY               
Sbjct: 598 VTESQELSKKLFLEFSQQIIKETPLI-LEMFSSDVKKNQELNETYFANLFENLESIKQQY 656

Query: 666 XXXXXYLDEHFLKNNNQEMLD--LRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNLML 723
                Y    F K+N+  +++  +   KA  + K+ SD +                 L+L
Sbjct: 657 SKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIE-KSVSD-IFKQFQQNMEAFAEQNEKLIL 714

Query: 724 SSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXXXX 783
            ++K   S++I  E+  F+  K  W +SF+ IN CD  +  + ++    L N+K      
Sbjct: 715 ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSS 774

Query: 784 XXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESS 843
                    Q++ NV +     +  +   +I    N I  K   L DH + ++   + S 
Sbjct: 775 DEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSL 834

Query: 844 KGFEEMDCSIK 854
             F+E+  SI+
Sbjct: 835 LVFDEICKSIQ 845

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/783 (43%), Positives = 487/783 (62%), Gaps = 42/783 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78
           +++NITVAVRCRGRN+REI+AKS +VVTVPDVT + EVSINT+G  GI  ++ ++TYTVD
Sbjct: 23  DDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTVD 82

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGELSD 137
           +V+GP + QKL+F++ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G+++ 
Sbjct: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142

Query: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPD-------------- 183
            AGI PR+L +LF+ L+    D++VKCS++ELYNE+L+DLL +  D              
Sbjct: 143 QAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199

Query: 184 ---YSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRP------S 234
               SK+LRIFDSN   NSR+    NSP       +  A+  Y     K  R       S
Sbjct: 200 SLNASKKLRIFDSN---NSRS----NSPVTNTNNPTHKARSDYLKKKLKSNRKKSLDDMS 252

Query: 235 LN-----KQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSH 289
           LN     K  +    + IYIQNL++FHI+ A+EG+ +LQ+GL+ RQVA+TK+ND SSRSH
Sbjct: 253 LNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSH 312

Query: 290 TIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN 349
           TIFTI LYK ++ +L+R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVIN
Sbjct: 313 TIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVIN 372

Query: 350 SLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
           SLADKS HIPFRESKLTRLLQDSLGGNTKT LIATISPAKI A+ET STLEYA+KAKNIK
Sbjct: 373 SLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIK 432

Query: 410 NRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQ 469
           N+PQLGSF++KDI              D   TK+KEGIY+S ++Y+EMV+DL+N++TE+ 
Sbjct: 433 NKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELT 492

Query: 470 ESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVS 529
           E KR  +S   +N LL K+KK+  +  +    ++  L++ ++ + +K+ + +     L  
Sbjct: 493 ELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSE 552

Query: 530 TIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKN 589
            +  +      +K  ++ Y+      ++  + +L   + +    +    +T+K  +   N
Sbjct: 553 QVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKN-VNSGN 611

Query: 590 LSINHNMDEIRTIFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALGDLDTKVQ 648
             I+ ++D IR      L++ +     +  + +  ++K+ P   +Q   + +GD+    +
Sbjct: 612 YQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKI-FQLISDNVGDIRGMTE 670

Query: 649 TYSVXXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXX 708
            +                    YLD  F +NN+ EM+    +      +  SD L+    
Sbjct: 671 EHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQ 730

Query: 709 XXXXXXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENK 768
                       ++ +S+ D   ++I+KE+++F P K +W  S + IN+ D+   +F N 
Sbjct: 731 NSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNN 790

Query: 769 STK 771
            TK
Sbjct: 791 MTK 793

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  489 bits (1258), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 266/617 (43%), Positives = 395/617 (64%), Gaps = 10/617 (1%)

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301
           ++ + IYIQNL+EFHIT+A+EGI +LQ+GL++RQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361
           G++FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+IHIPFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421
           ESKLTRLLQDSLGGNTKTALIATISPAK+N++ET STLEYA KAK+IKN+PQLGS + KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 422 IXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481
           I              D LSTK+++G+YMS  HY+E+ NDLE+Y+TE+QE KR ++  ++Q
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541
           N LLLKDKKAS +++ LQ +K+  ++++I +L D IE+QHR E  LV  I KLK     M
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601
           + +++ +   E   Q  +K++  + +   +  + ++LE +  +++  N  +  N+++I+ 
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 602 IFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALGDLDTKVQT----YSVXXXX 656
                +D+ ++  + +  + + +++K+ P         +L D   K+Q     Y+     
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPI-----LLGSLNDDIIKMQKISDLYNEQLSI 712

Query: 657 XXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXX 716
                         YL+  F K++++E+L+  +EK Y   + AS  ++            
Sbjct: 713 SISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLE 772

Query: 717 XXRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNL 776
             RN+++ S+K+  S+++  E+E+F P K++W  SFE IN+CD+ + ++    + LL+N+
Sbjct: 773 ESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNM 832

Query: 777 KELXXXXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNI 836
           K               Q+++   N     +     + I +Q  ++ +K+  LE H   +I
Sbjct: 833 KTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESI 892

Query: 837 KYFKESSKGFEEMDCSI 853
              + S   F+++  SI
Sbjct: 893 TMNESSINAFDKLSESI 909

 Score =  295 bits (754), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 166/185 (89%), Gaps = 4/185 (2%)

Query: 15  DDGN-EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSR 73
           D GN +ELNI VAVRCRGRNEREIKAKS+VVV+VPDV GS+E++INTT D+GIAG+MNS+
Sbjct: 6   DKGNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSK 65

Query: 74  TYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           TYTVD+VFGPSA+Q+LIF+ +AEPLF+DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LY+G
Sbjct: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125

Query: 134 ELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTP---DYSKRLRI 190
           ELSDSAGIIPRVLF+LFD +E    D+++KCS+IELYNEELKDLLD+       +K+LRI
Sbjct: 126 ELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRI 185

Query: 191 FDSNT 195
           FDSN 
Sbjct: 186 FDSNA 190

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  481 bits (1237), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/602 (43%), Positives = 381/602 (63%), Gaps = 14/602 (2%)

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301
           +Q++ IYIQNLQEFHITNA EG+++LQKGLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370

Query: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361
            ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFR
Sbjct: 371 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 430

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGSF+MKD
Sbjct: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD 490

Query: 422 IXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481
           I              D LSTK+KEGIYMS +HY+ + +DLE+Y+ E+QE KR++ES +S+
Sbjct: 491 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSK 550

Query: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541
           N+LL+KDK  S++  + Q+ +I  L+ TI++L  ++++QH+ EI++    +KL++    M
Sbjct: 551 NALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVM 610

Query: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601
           + +L +Y+  EL L    +  + + I   + ++   L T++   + +  +I  N+D I+ 
Sbjct: 611 QMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKN 670

Query: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXX 661
                + +++     M  + VK + ++    +    E +  +    Q +           
Sbjct: 671 EVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDI 730

Query: 662 XXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNL 721
                    YL  HF KNN+QE+L+  ++  Y   +  ++  +              + L
Sbjct: 731 SEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKL 790

Query: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXX 781
           ++ ++  A S +ID+E+++F+P + +W  SF+ IN+CD+ + +F N     L+ +K    
Sbjct: 791 IMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIK---- 846

Query: 782 XXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDIND-------KHKMLEDHFEN 834
                       + E+++  +G V ++    S++K     ND       KH ML+D+ +N
Sbjct: 847 ---STVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKN 903

Query: 835 NI 836
           +I
Sbjct: 904 SI 905

 Score =  292 bits (747), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 153/185 (82%), Gaps = 10/185 (5%)

Query: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS E+SINTTGD GI  +MN++ YTV
Sbjct: 32  NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91

Query: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137
           D+VFGP A Q LIF  +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELSD
Sbjct: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151

Query: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPD----------YSKR 187
           +AGIIPRVL +LFDTLE  ++D++VKCS+IELYNEELKDLLD   +          + K+
Sbjct: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKK 211

Query: 188 LRIFD 192
           LRIFD
Sbjct: 212 LRIFD 216

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  479 bits (1234), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 259/602 (43%), Positives = 386/602 (64%), Gaps = 14/602 (2%)

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301
           +QS+ IYIQNLQEFHITNA EG+++LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368

Query: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361
            ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+FMMKD
Sbjct: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488

Query: 422 IXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481
           I              D LSTK+KEGIYMS +HY+ + +DLE+++ E+QE KR++ES +S+
Sbjct: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548

Query: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541
           NSLL+KDK  S++  + Q+ ++  L+ TI +L  ++++QH+ E+++    +KL++    M
Sbjct: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608

Query: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601
           + +LQ+Y+  EL L    +  + + I S + ++   L+ ++ + + +   I  N+D ++ 
Sbjct: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 668

Query: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXX 661
                +++++     M  + VK + ++    +    E +  +  + Q +           
Sbjct: 669 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDI 728

Query: 662 XXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNL 721
                    YL  HF KNN+QE+L+  ++  Y   +  ++  +              + L
Sbjct: 729 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKL 788

Query: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXX 781
           ++ +M +A S +ID+E+++F+P + +W  SF+ IN+CD+ + +F N     L+ +K+   
Sbjct: 789 IMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKK--- 845

Query: 782 XXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDIND-------KHKMLEDHFEN 834
                       + E+++  +G V ++    S++K     ND       KH +L+D+ E+
Sbjct: 846 ----TVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIES 901

Query: 835 NI 836
           +I
Sbjct: 902 SI 903

 Score =  291 bits (745), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 135/185 (72%), Positives = 154/185 (83%), Gaps = 10/185 (5%)

Query: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS EVSINTTGD GI  +MN++ YTV
Sbjct: 34  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTV 93

Query: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137
           D+VFGP A Q LIF+ +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GEL+D
Sbjct: 94  DKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELND 153

Query: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTP----------DYSKR 187
           +AGIIPRVL +LFDTLE  +SD++VKCS+IELYNEELKDLLD+             + K+
Sbjct: 154 AAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKK 213

Query: 188 LRIFD 192
           LRIFD
Sbjct: 214 LRIFD 218

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  475 bits (1222), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 276/682 (40%), Positives = 407/682 (59%), Gaps = 29/682 (4%)

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301
           +QS+ IYIQNLQEFHITNA EG+ +LQKGLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372

Query: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361
            ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFR
Sbjct: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+F+MKD
Sbjct: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492

Query: 422 IXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481
           I              D LSTK+KEGIYM+ +HY+ + +DLE+Y+ E+QE KR++ES +S+
Sbjct: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSK 552

Query: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541
           NSLL+K+K  S++  + Q+ +I  L+ TI++L  ++++QH+ E+++     KL++    M
Sbjct: 553 NSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612

Query: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601
           + +LQ+Y+  EL L    +  +   I + + ++   L T++ R + +   I  N+D I+ 
Sbjct: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKN 672

Query: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXX 661
                +++++     M  + VK + ++    +    E +  +    + +           
Sbjct: 673 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDI 732

Query: 662 XXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNL 721
                    Y   HF +NN+QE+L   ++  Y K +  ++  +              + L
Sbjct: 733 SEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKL 792

Query: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXX 781
           ++ ++    S +ID+E+ +F+P + +W  SF+ INECD+ + +F N     L+ +K    
Sbjct: 793 IMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIK---- 848

Query: 782 XXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDIND-------KHKMLEDHFEN 834
                       + ++++  +G V ++    S++K     ND       KH +L+D+ E+
Sbjct: 849 ---STVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIES 905

Query: 835 NIKYFKESSKGFEEMDCSIKKIIREMSPEVGDIK--QIEALLERVNSRSFGPIASTGKTP 892
           +I          +++  +I+KI+     +    K   IE LL  + + S        + P
Sbjct: 906 SITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLS-------KRMP 958

Query: 893 MRPELKNPIPKTRSRSMSPIKS 914
           +R      I  T S SM  I S
Sbjct: 959 LR------ISNTNSNSMQNIIS 974

 Score =  293 bits (749), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 135/185 (72%), Positives = 153/185 (82%), Gaps = 10/185 (5%)

Query: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS E+SINTTGD GI  +MN++ YTV
Sbjct: 32  NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91

Query: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137
           D+VFGP A Q LIF  +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELSD
Sbjct: 92  DKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151

Query: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTP----------DYSKR 187
           SAGIIPRVL +LFDTLE  ++D++VKCS+IELYNEELKDLLD+             + K+
Sbjct: 152 SAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKK 211

Query: 188 LRIFD 192
           LRIFD
Sbjct: 212 LRIFD 216

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  450 bits (1158), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 262/602 (43%), Positives = 380/602 (63%), Gaps = 14/602 (2%)

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301
           +QS+ IYIQNLQEFHITNA EG+++LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369

Query: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361
            ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFR
Sbjct: 370 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+F+MKD
Sbjct: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489

Query: 422 IXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481
           I              D LSTK+KEGIYMS +HY+ + +DLE+Y+ E+QE KR +ES SS+
Sbjct: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSK 549

Query: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541
           NSLLLKDK  S+   + Q+ ++  L+ TI  L  ++++QH+ E+++    +KL++    M
Sbjct: 550 NSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 609

Query: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601
           + +LQ+Y+  EL L    +  + + I S + ++   L  ++   + +  +I  N+D I+ 
Sbjct: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 669

Query: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXX 661
                +++++     M  + VK + ++    +    E +  +    Q +           
Sbjct: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 729

Query: 662 XXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALIXXXXXXXXXXXXXXRNL 721
                    YL  HF KNN+QE+L+  ++  Y   +  +   +              + L
Sbjct: 730 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 789

Query: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELXX 781
           ++ ++ +A S +I++E+++F+P + +W  SF+ IN+CD+ + +F N     L+ +K    
Sbjct: 790 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKN--- 846

Query: 782 XXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDIND-------KHKMLEDHFEN 834
                       + ++++  +G V ++    S++K     ND       KH +L+D+ EN
Sbjct: 847 ----TVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIEN 902

Query: 835 NI 836
           +I
Sbjct: 903 SI 904

 Score =  290 bits (743), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 154/186 (82%), Gaps = 12/186 (6%)

Query: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS EVSINTTGD GI  +MN++ YTV
Sbjct: 32  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91

Query: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137
           D+VFGP A Q LIF  +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELSD
Sbjct: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151

Query: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLD-----------DTPDYSK 186
           +AGIIPRVL +LFDTLE  ++D++VKCS+IELYNEELKDLLD           + P + K
Sbjct: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGP-FMK 210

Query: 187 RLRIFD 192
           +LRIFD
Sbjct: 211 KLRIFD 216

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  446 bits (1146), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 293/934 (31%), Positives = 497/934 (53%), Gaps = 62/934 (6%)

Query: 20  ELNITVAVRCRGR--NEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNS--RTY 75
           E NI V  R +G+  NE+    +  +++  P             G I   GK ++  R +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEP-------------GLIKFKGKDDAVKREF 58

Query: 76  TVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYDGE 134
            +D +F     Q+ ++ +  +P+F DFI GYNC+ LVYG T +GKTYT++G+E  L   E
Sbjct: 59  GMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSE 118

Query: 135 LSD-SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDY-----SKRL 188
            S  S G+IPRVL  LFD L     DH+VKCSY+E+YNEELKDLL D  +       K+L
Sbjct: 119 ASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKL 178

Query: 189 RIFDSNTI-----TNSRAGSQNNSP------------KEQDGTSSSMAKRRYTHIPTKPK 231
           RI DS +       NS   +++NSP            +++ G  S  A ++   +    +
Sbjct: 179 RIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSI-SR 237

Query: 232 RPSLN----KQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSR 287
             S N    ++ + E++ A YIQNL+EFHITNA+EGI +L +GLK+RQ+AS+K   +SSR
Sbjct: 238 SNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSR 297

Query: 288 SHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV 347
           + TIFTI+LYK  EGE+FR+SK N VDLAG+E+  +    NQR K+   INQ +  L ++
Sbjct: 298 ASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKI 357

Query: 348 INSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKN 407
           +NSL +K   IPF++SKLT L++D+L GN+K+  I T+   K + DE   TLE+  K ++
Sbjct: 358 VNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRS 417

Query: 408 IKNRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTE 467
           +K  P LG  + K+               D LSTK+KEG+YMSHEHY  +  DL+ ++ E
Sbjct: 418 LKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVE 477

Query: 468 IQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDL 527
           I + K+ ++  + Q++ L KDK+A +++NE+Q +K+  +++++  +   IE+Q R E DL
Sbjct: 478 IMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDL 537

Query: 528 VSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLD 587
           +++  KLKE ++ M  ++  Y   E  +Q  +K +  + ++  +  + ++L   +   L 
Sbjct: 538 INSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELI 597

Query: 588 KNLSINHNM----DEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDL 643
            NL I +N+    +EI+ I   + + + S   D C  I K+ ++ P   +  F + +  L
Sbjct: 598 DNLEIENNLNKAHEEIKQILQISENEIDSLFLD-C--IKKMSEESPKL-FSSFIQDVSRL 653

Query: 644 DTKVQTYSVXXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDAL 703
           +                          Y++E F KNN++E+L   + K YH+ + +SD  
Sbjct: 654 ENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDF 713

Query: 704 IXXXXXXXXXXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQ 763
           +              ++++L ++K A SE+I+ E+  F P KE+W  S E I +   +  
Sbjct: 714 LLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSN 773

Query: 764 QFENKSTKLLTNLKELXXXXXXXXXXXXKQVQENVTNFEGIVRQASAKESIVKQMNDIND 823
           +F+ K+  ++  L++              +++  +   +         E + ++   I  
Sbjct: 774 EFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMK 833

Query: 824 KHKMLEDHFENNIKYFKESSKGFEEMDCSIKKIIR-EMSPEVGDIKQI-EALLERVNSRS 881
           K+ +L+D    N+   +ES   F+++D SI+ + + E+   +   + I + + ++++ + 
Sbjct: 834 KNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQR 893

Query: 882 FGPIASTGKTPMRPELKNPIPKTRSRSMSPIKSL 915
             P     K+P+R  +      + SR+   I+SL
Sbjct: 894 LTPNMRNRKSPVRQSV------SPSRTSPQIQSL 921

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  434 bits (1116), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 246/544 (45%), Positives = 335/544 (61%), Gaps = 20/544 (3%)

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301
           + ++ IYIQNLQEF+I NA +GI +LQKGL+HR+VASTKMND SSRSHTIFTI LYK + 
Sbjct: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361
           G L+R+SKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADKSIHIPFR
Sbjct: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421
           ESKLTRLLQDSLGGNTKT LI+TISPAKIN DETSSTLEYA+KAKNIKN+P LGSF+MKD
Sbjct: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 422 IXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481
           +              D +ST+ K+G+YMS +HY+E+ NDLE+Y+TE+QESKR  E   SQ
Sbjct: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541
           N  LLKDKKAS +LNELQ ++I +    I+ L + ++  ++ E  LV  I +LK    +M
Sbjct: 569 NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNL----------- 590
           + +++NY   +L ++   K++L       +  + Q L  +   ++D NL           
Sbjct: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIID-NLKSSIISNNSSI 687

Query: 591 ------SINHNMDEIRTIFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALGDL 643
                 +   N+D I     + L  V+     + ++ + +I+ D P+    +FK  +  +
Sbjct: 688 EAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNI-LNKFKIEINSI 746

Query: 644 DTKVQTYSVXXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDAL 703
           D +                        YL+  FL+NN + +L   +E    + ++ S+ L
Sbjct: 747 DFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNL 806

Query: 704 IXXXXXXXXXXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQ 763
           +                L    + +  ++++ KE E  +P KE+WV S E IN  D  + 
Sbjct: 807 LLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINN 866

Query: 764 QFEN 767
            F N
Sbjct: 867 TFHN 870

 Score =  304 bits (779), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 161/176 (91%), Gaps = 1/176 (0%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78
           EELNITVAVRCRGRNERE++AKS+VVV+VPD+ GSNEVSINT+ ++GIA  MNS+TYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138
           +VFGPSA Q L+FK IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELSDS
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS-KRLRIFDS 193
           AGIIPRVLF+LF++ E    D+++KCS++ELYNE+LKDLLDD+ D + K+LRIFDS
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFDS 184

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  370 bits (950), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 280/955 (29%), Positives = 478/955 (50%), Gaps = 82/955 (8%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTG--SNEVSI--NTTGDIGIAGKMNSRTYTV 77
           NITVAVRCR   + E  + S  ++++ D     SNEV +   +TG          + YT+
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG--------RKKIYTL 60

Query: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYDG 133
           D V+G   DQK +F     P +  F  GYN +++ YG   +GK YT+ G+    +   + 
Sbjct: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120

Query: 134 ELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTP----------- 182
           E S++ G++PRVL RLF  LE+  +DH++KCS++E+YN+EL+DLL DT            
Sbjct: 121 E-SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGA 179

Query: 183 --DYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSS------MAKRRYTHIPTKPK--- 231
                K+LRI DS +     AGS N+S ++    ++S      M ++R       P    
Sbjct: 180 TGSTGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPNNSI 239

Query: 232 --------RPSLNK---------QLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHR 274
                   R SL++         Q  +E+ ++IYIQNLQE  IT   EG+++++KGLK+R
Sbjct: 240 SNNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIKKGLKNR 299

Query: 275 QVAST----KMNDFSSRSHTIFTIMLYKSYE-GELFRISKMNLVDLAGSENISRSGAQNQ 329
           ++AST      N+FS RSH+IF I LYK  E  E+FR+SK++ V+ AGSE    + ++N 
Sbjct: 300 RIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN- 358

Query: 330 RAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 389
                G+ N +L +  ++IN + + S +  F +SKLT+LLQ++  G T+T  IA I+P K
Sbjct: 359 -----GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLK 413

Query: 390 INADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKE-GIY 448
              D T S L  ATK K IKN P+ GS + K+               D LS K+ + GIY
Sbjct: 414 KQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIY 473

Query: 449 MSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQN 508
           M  +HY E+   LE+Y+ +IQ SK  +   + + + +  +K+  +++NE Q +K+  L+ 
Sbjct: 474 MDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRE 533

Query: 509 TIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGIT 568
           TI  L   +E+Q + E +L +   KL   L  M+ S++ Y   E+ LQN +K +  + + 
Sbjct: 534 TISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELV 593

Query: 569 SYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQ 628
             + S++ +   +K RM D N ++N N+D I+    +  +  +S   ++ TN    V D 
Sbjct: 594 KLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNSANQVLDT 653

Query: 629 PSTSYQQFKEALGDLDTKVQTYSVXXXXXXXXXXXXXXXXXXYLDEHFLKNNNQEMLDLR 688
               ++Q    L +L+  V+                      Y++++FLK++++E++D  
Sbjct: 654 SPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSHEELIDTY 713

Query: 689 MEKAYHKSKTASDALIXXXXXXXXXXXXXXRNLMLSSMKDAVSEMIDKELEMFQPVKERW 748
           + + YH+ +  S                     +  S+    SE+++ EL  F P K++W
Sbjct: 714 INRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNPEKKKW 773

Query: 749 VLS----FENINECDAAHQQFENKSTKLLTNLKELXXXXXXXXXXXXKQVQENVTNFEGI 804
            L+     EN NE    ++   NK++++L  L                 +++NV   E  
Sbjct: 774 ELASNEIIENFNESITKNK---NKNSEILAKLLSESTSTSELFINNMSSIKKNVEIVEEF 830

Query: 805 VRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKGFEEMDCSIKKIIREMSPE- 863
               ++ + I  +  +I +K+K L+D   +N    + S   F+ +  +++ + +    E 
Sbjct: 831 SEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFKNEMKES 890

Query: 864 -VGDIKQIEALLERVNSRSFGPIASTGKTP----MRPELKNPIPKTRSRSMSPIK 913
              D   ++ + E++  +  G  +S+ K      + P   +PI K+ ++  SP+K
Sbjct: 891 YSNDTLNLKEIFEQMEQQKLGVNSSSKKKAYKQNLSPSKISPI-KSSTKLNSPLK 944

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  369 bits (946), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 224/515 (43%), Positives = 305/515 (59%), Gaps = 62/515 (12%)

Query: 7   TTKKR---TMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGD 63
           TT+KR   +   +G  E NI V VRCR RNEREI+ KS+VV++     G   +  N    
Sbjct: 36  TTQKRVRSSQQSEGEPEYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTN---- 91

Query: 64  IGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYT 123
               G  +++TYT D+VFG  +DQ+ +F  +A    ++ I+GYNCTV  YG T TGKTYT
Sbjct: 92  ---PGTGSNKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYT 148

Query: 124 MTGDEKLYDGE--------LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELK 175
           M+GD  +            LS+ AGIIPRVL  LF  L     D+ VK S++ELYNE+L+
Sbjct: 149 MSGDITMMGSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLR 208

Query: 176 DLLDDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSL 235
           DLL D  D S    + D N                 +G +   + R Y  + T    P+ 
Sbjct: 209 DLLVDDKDVS----LEDHNF----------------NGMAPPESIRIYDSLKTDRTSPN- 247

Query: 236 NKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIM 295
                     +I+++ ++E +I +A+EG+ +L  G   R+VA+TK ND SSRSHTIFTI 
Sbjct: 248 --------GYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTIT 299

Query: 296 L----YKSYEGELF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS 350
                     GE + ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+
Sbjct: 300 TNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINA 359

Query: 351 LADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKN 410
           L D S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN
Sbjct: 360 LVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKN 419

Query: 411 RPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVND---LENYQTE 467
            PQ+   M K+               +  ++ +KEGIY++ E ++   ++   +E  Q +
Sbjct: 420 TPQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYESNSILVEEQQAK 479

Query: 468 I---QESKRQV-ESFSSQNSLLLKDKKASQQLNEL 498
           I   QE  R++ E F  Q  L+   K+   Q+ EL
Sbjct: 480 IDNLQEQLRRLKEKFLEQTKLI---KEKDGQIKEL 511

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  363 bits (931), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 227/552 (41%), Positives = 324/552 (58%), Gaps = 68/552 (12%)

Query: 16  DGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTY 75
           +G    N+ V VRCR RNE+EI+ KS+VV++     G   +  N  G +      + RTY
Sbjct: 35  EGRVSSNMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLS----HSKRTY 90

Query: 76  TVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD-------- 127
           T DQVFG  +DQ+ +F  +A+    + ++GYNCTV  YG T TGKTYTM+GD        
Sbjct: 91  TFDQVFGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLD 150

Query: 128 --EKLYDGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS 185
             +K+  GE S   GIIPRVL  LF  L    +++ VK S++ELYNE+LKDLL ++    
Sbjct: 151 SQDKILLGEHS---GIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEE 207

Query: 186 KRLRIFDSNTITNSRAGSQNNSPKEQ---DGTSSSMAKRRYTHIPTKPKRPSLNKQLLYE 242
           + +RIFD+N+  N      N + K+    DG+S   +    +                  
Sbjct: 208 ENIRIFDNNSGFNC-----NKNVKQLVKLDGSSHRTSSASSS------------------ 244

Query: 243 QSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEG 302
            SS+I ++ ++EF+I +A EG+ +L  G   R+VA+TK ND SSRSHT+FTI    +   
Sbjct: 245 -SSSIMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTD 303

Query: 303 -----ELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH 357
                +  +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S H
Sbjct: 304 PVSNEQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQH 363

Query: 358 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSF 417
           IP+RESKLTRLLQDSLGG TKT +IATISPAKI+ DET STLEYAT+AK+IKN PQ+   
Sbjct: 364 IPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQS 423

Query: 418 MMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVND---LENYQTEIQESKRQ 474
           M K+               +  +++ KEG+Y++ + +Q   ++   +E  +  IQ  + Q
Sbjct: 424 MSKNSCLGEYIHEIERLRQELKASRQKEGMYITEDQFQLYESNSILVEEQKVRIQNMEDQ 483

Query: 475 VESFSS---QNSLLLKD------------KKASQQLNELQDMKITRLQNTIEYLCDKIER 519
           +  F +   + + L KD            KK S +  E+ +   +  Q   EY+ D +E 
Sbjct: 484 ILKFKAKYVEQTNLSKDAEKRLKQSQLLCKKLSIEKAEMSENFQSFRQTCTEYV-DSVED 542

Query: 520 QHRNEIDLVSTI 531
            HR+ ++L+ ++
Sbjct: 543 IHRSNLELIRSL 554

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  363 bits (932), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 225/528 (42%), Positives = 315/528 (59%), Gaps = 49/528 (9%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V VRCR RN+REI  KS+VVV+     G + +  N +  +    K    TY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPKK----TYMFDEVF 99

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY---DGE---- 134
           G  +DQ+ IF  +A+    + ++GYNCTV  YG T TGKTYTM+GD  ++   D +    
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFDSN 194
           L + AGIIPRVL  LF  L    ++H VK S++ELYNE LKDLL D       +RIFD+N
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADNDSDEDNIRIFDNN 219

Query: 195 TITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSA-------- 246
              NS A           G S+ M++ +     +K + P+L+   +   +S         
Sbjct: 220 ---NSNA----------HGASNGMSQVKMNK--SKVRAPTLSGATVSSSASNSSTSSSSS 264

Query: 247 ---IYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS---- 299
              I ++ ++E +I +A EG+ +L KG   R+VA+TK ND SSRSHTIFTI+ + +    
Sbjct: 265 SSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDP 324

Query: 300 YEGELF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHI 358
             GE + +I K+NLVDLAGSENI+RSGA+N RA+EAG IN+SLLTLGRVIN+L + S HI
Sbjct: 325 VSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHI 384

Query: 359 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFM 418
           P+R SKLTRLLQDSLGG TKT +IATISPA+I+ DET STLEYAT+AK+IKN PQ+   +
Sbjct: 385 PYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSL 444

Query: 419 MKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVND---LENYQTEIQESKRQV 475
            KD               +  +++ +EG+Y++ E Y    ++   +E  +  IQ    Q+
Sbjct: 445 SKDSCIMEYIYEIERLRQELKASRQREGMYITQEQYDLYESNSLLVEEQKVVIQNMGEQI 504

Query: 476 ESFSSQNSLLLK-DKKASQQLNELQDMKIT-RLQNTIEYLCDKIERQH 521
           + F  +     K  K+A +Q  E Q +  T R+Q   +++ +  E+ H
Sbjct: 505 KRFKEKYVEQTKLSKEAHRQFQESQKVCDTLRIQK--KFMLETFEKYH 550

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  360 bits (925), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 216/483 (44%), Positives = 287/483 (59%), Gaps = 58/483 (12%)

Query: 17  GNEE--LNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSIN-TTGDIGIAGKMNSR 73
           G+EE   NI V VRCR RN REIK KS+VVV+     G   +  N +TG        N++
Sbjct: 49  GSEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG--------NNK 100

Query: 74  TYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           TYT DQVFG  +DQ+ +F  +A     + ++GYNCTV  YG T TGKTYTM+GD  +   
Sbjct: 101 TYTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGA 160

Query: 134 ELSDS--------AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLL--DDTPD 183
            L D         AGIIPRVL  LF  L+    D+ VK S++ELYNE+L+DLL  D  P 
Sbjct: 161 SLEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEP- 219

Query: 184 YSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQ 243
                 + D   I     G   NSP+           R Y ++       S         
Sbjct: 220 ------LIDEGGI----GGGVANSPE---------TIRIYDNLKLDRSNSS--------- 251

Query: 244 SSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----YKS 299
             +I ++ ++E +I +A+EG+ +L +G   R+VA+T+ ND SSRSHTIFTI         
Sbjct: 252 GHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTKIHP 311

Query: 300 YEGELF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHI 358
             GE + +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HI
Sbjct: 312 ISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 371

Query: 359 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFM 418
           P+RESKLTRLLQDSLGG TKT +IAT+SPAK + +ET+STLEYAT+AK+IKN PQ+   M
Sbjct: 372 PYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQINQLM 431

Query: 419 MKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVND---LENYQTEIQESKRQV 475
            K+               +  +  AKEGIY++ E Y+   ++   +E  Q +I   + Q+
Sbjct: 432 AKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESNCILVEEQQAKIDNLQEQI 491

Query: 476 ESF 478
           + F
Sbjct: 492 KRF 494

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  359 bits (922), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/448 (45%), Positives = 274/448 (61%), Gaps = 52/448 (11%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V VRCR RN+REI  KS+VV++     G + +  N +     +     +TYT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE------- 134
           G  +DQ+++F ++A+    + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 135 ---LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
              LS+ AGIIPRVL  LF  L+   +D+ VK S++ELYNE LKDLL D           
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLAD----------- 222

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                          S KE D  + S+  R + +I     +P  N Q     S +I ++ 
Sbjct: 223 ---------------SNKEDDNNAESI--RIFDNI-----KPEKNTQ----GSHSIMVKG 256

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----YKSYEGELF-R 306
           ++E +I +A+EG+ +L +G   RQVASTK ND SSRSHT+FTI           GE + +
Sbjct: 257 MEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDPLSGEEYVK 316

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 366
             K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HIP+RESKLT
Sbjct: 317 NGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLT 376

Query: 367 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXX 426
           RLLQDSLGG TKT +IAT+SPAKI+ +ET STLEYAT+AK+IKN PQ+   M KD     
Sbjct: 377 RLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSMTKDSCITE 436

Query: 427 XXXXXXXXXXDFLSTKAKEGIYMSHEHY 454
                     +  +T+ K+GIY++ E Y
Sbjct: 437 YIHEIDRLRKELRATRTKDGIYITQEKY 464

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  349 bits (895), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 211/529 (39%), Positives = 302/529 (57%), Gaps = 70/529 (13%)

Query: 23  ITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVFG 82
           I V VRCR RNEREI+ KS+VV++      S ++ ++         K   RTYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 83  PSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGEL------- 135
             +DQ+ +F + A+    + ++GYNCTV  YG T TGKTYTM+GD  +  G+L       
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 136 -SDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFDSN 194
             + AGIIPRVL  LF  L+  E  + VK S++ELYNE LKDLL       + +RIFD+ 
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNERLKDLLASEQSEEENIRIFDN- 235

Query: 195 TITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQE 254
                                                            SS+I ++ ++E
Sbjct: 236 ----------------------------------------------VSASSSIMVKGMEE 249

Query: 255 FHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----YKSYEGELF-RISK 309
            +I +A +G+ +L  G   R+VA+TK ND SSRSHT+FTI           GE + +  K
Sbjct: 250 IYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPVSGEQYVKTGK 309

Query: 310 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLL 369
           +NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+RESKLTRLL
Sbjct: 310 LNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIPYRESKLTRLL 369

Query: 370 QDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXX 429
           QDSLGG TKT +IATISPAKI+ DET STLEYAT+AK+IKN PQ+   M KD        
Sbjct: 370 QDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMSKDSCINEYVH 429

Query: 430 XXXXXXXDFLSTKAKEGIYMSHEHYQEMVND---LENYQTEIQESKRQVESFSS---QNS 483
                  +  +++ K+GI ++ + +    ++   ++  +T+IQ  + Q++ F     + +
Sbjct: 430 EIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQIQRFKDKYVKQT 489

Query: 484 LLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIH 532
            L K+ ++  + NELQ +++   +  +  L +  +    + I+ V+ IH
Sbjct: 490 ELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNHYIERVTKIH 538

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  350 bits (897), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 228/544 (41%), Positives = 315/544 (57%), Gaps = 75/544 (13%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V VRCR RN+REI+ KS+VV++     G  EV ++    +    K   +TY  DQVF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLSDPSSVLSHTK---KTYIFDQVF 114

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGE------ 134
           G  +DQ+++F   A+    + ++GYNCT+  YG T TGKTYTM+GD   L D E      
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFDSN 194
           L + AGIIPRVL  LF  L    +++ VK S++ELYNE LKDLL  + +  + +RIFD+ 
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETEESIRIFDN- 233

Query: 195 TITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPT---KPKRPSLNKQLLYEQSSAIYIQN 251
                                         HIP+   K ++ S N        S+I ++ 
Sbjct: 234 ------------------------------HIPSGNSKIQKSSRNNTY-----SSIMVKG 258

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS----YEGELF-R 306
           ++E +I +A EG+ +L +G   R+VASTK ND SSRSHTIFTI    +      GE + +
Sbjct: 259 MEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPVSGEQYVK 318

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 366
           I K+NLVDLAGSENISRSGA+N RA+EAG IN+SLLTLGRVIN+L D S HIP+RESKLT
Sbjct: 319 IGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLT 378

Query: 367 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXX 426
           RLLQDSLGG TKT +IAT+SPAKI+ +ET STLEYAT+AK+IKN PQ+   M KD+    
Sbjct: 379 RLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMSKDVCINE 438

Query: 427 XXXXXXXXXXDFLSTKAKEGIYMSHEHY----------QEMVNDLENYQTEIQESKRQVE 476
                     +  +++ K+G+Y++ E +           E    + N + +I++ K +  
Sbjct: 439 YVQEIERLRQELKASRQKDGVYITQEQFDLYESNGILVDEQKAKIVNMEEQIKKFKEKYV 498

Query: 477 SFSSQNSLLLKDKKASQQL-NELQDMKITRLQNTIEYLC---------DKIERQHRNEID 526
           + ++ N  L    K SQ+L N+L D + + +    EY           + I   + N ID
Sbjct: 499 NQTAINKELETSLKNSQELSNDLLDKQASLISIFGEYQSNFKLFETEINTIHENNLNLID 558

Query: 527 LVST 530
           L+ST
Sbjct: 559 LIST 562

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  347 bits (890), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 230/626 (36%), Positives = 334/626 (53%), Gaps = 119/626 (19%)

Query: 16  DGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTY 75
           +   E NI V VRCR RN REI  KS+VV++     G   +  N +     + K   +TY
Sbjct: 46  NATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTY 102

Query: 76  TVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE- 134
             DQVFG  +DQ+++F   A+    + + GYNCT+  YG T TGKTYTM+GD  +  G+ 
Sbjct: 103 QFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDV 161

Query: 135 -------LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLL----DDTP- 182
                  L + AGIIPRVL  LF  L +   ++ VK S++ELYNE LKDLL    DD P 
Sbjct: 162 QSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPT 221

Query: 183 --DYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLL 240
             D  K++RIFD+N          NN+                                 
Sbjct: 222 ANDSKKQIRIFDNN----------NNN--------------------------------- 238

Query: 241 YEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY--- 297
               S+I ++ +QE  I +A EG+++L +G   R+VA+TK ND SSRSHT+FTI      
Sbjct: 239 ----SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 298 -----KSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 352
                        +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L 
Sbjct: 295 QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 353 DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRP 412
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ +ET+STLEYAT+AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 413 QLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEH---YQEMVNDLENYQTEIQ 469
           Q+   + KD               D  +++ K+GI+++ +    Y+     ++    +I 
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIH 474

Query: 470 ESKRQVESFSSQNSLLLKDKKASQ-QLNELQDMKITRLQNTIE-YLCD------KIERQH 521
             + Q++ F        K+K  +Q  +N     +  +L N I  +  D      +I++ H
Sbjct: 475 NLREQIKKF--------KEKYLNQLDINNFLQSEKEKLINIIRNFHVDFSNFNLEIQKIH 526

Query: 522 RNEIDLVSTI--------------------------HKLKEALHTMKGSLQNYETHELRL 555
           R+ +++++ I                          +++ + L T++ SL NY +   ++
Sbjct: 527 RSNLEVMTEITQQRDLSQVNSRRQYTTNQNLQLEISNQVLQTLDTLQNSLMNYNSKFSQV 586

Query: 556 QNDIKEVLYQGITSYRESMDQHLETV 581
            N + E L   + S++   D  LE++
Sbjct: 587 INGVTEELSLNVNSHKVKHDSTLESL 612

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  346 bits (888), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 218/548 (39%), Positives = 304/548 (55%), Gaps = 82/548 (14%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V VRCR R+EREIK KS+VV++     G+  +  N +  +    K    +Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPKK----SYSFDRVF 163

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE------- 134
           G  +DQ+ +F + A+    + + GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFDSN 194
           L + AGIIPRVL  LF  L A E+D+ VK S++ELYNE LKDL        + +RIFD+N
Sbjct: 224 LGEHAGIIPRVLVNLFKML-ALENDYSVKISFLELYNERLKDLFAQNESEEETIRIFDNN 282

Query: 195 TITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQE 254
                     NN+                                    SS+I ++ ++E
Sbjct: 283 ----------NNA------------------------------------SSSIMVKGMEE 296

Query: 255 FHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----YKSYEGELF-RISK 309
            +I +A EG+ +L  G   R+VASTK ND SSRSHT+FTI           GE + +  K
Sbjct: 297 IYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDPISGEQYIKTGK 356

Query: 310 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLL 369
           +NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HIP+RESKLTRLL
Sbjct: 357 LNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLL 416

Query: 370 QDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDIXXXXXXX 429
           QDSLGG TKT +IATISPAKI+ +ET STLEYA +AK+IKN PQ+   M KD        
Sbjct: 417 QDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSMSKDTCINEYVS 476

Query: 430 XXXXXXXDFLSTKAKEGIYMSHEHY----------QEMVNDLENYQTEIQESK----RQV 475
                  +  +++ K+GI ++ +             E    + N + +IQ+ K    RQ 
Sbjct: 477 EIERLRLELKTSRQKDGICITQDQLDLYESNGILVDEQKTKIHNMEEQIQKFKEKYVRQT 536

Query: 476 ESFSSQNSLLLKDKKASQQLN----ELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTI 531
           E   +  S L ++++ ++QL     +L D+ +   Q        ++ + H + I L+  +
Sbjct: 537 ELNKNLESNLKENEQVTKQLRSEKYQLMDL-LENYQINSNSFVQRVLQIHESNIALIQNL 595

Query: 532 HKLKEALH 539
            K +  +H
Sbjct: 596 DKERNRIH 603

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  341 bits (874), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/455 (43%), Positives = 266/455 (58%), Gaps = 74/455 (16%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V VRCR RN+REI  KS+VV++     G   +  N +     + K   +TY  DQVF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 107

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE------- 134
           G  +DQ+ +F   A+    + + GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDNL 166

Query: 135 -LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLL----DDTP---DYSK 186
            L + AGIIPRVL  LF  L +   ++ VK +++ELYNE LKDLL    DD P   D  +
Sbjct: 167 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKR 226

Query: 187 RLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSA 246
           ++RIFD+N          NN+                                     S+
Sbjct: 227 QIRIFDNN----------NNN-------------------------------------SS 239

Query: 247 IYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY--------K 298
           I ++ +QE  I +A EG+++L +G   R+VA+TK ND SSRSHT+FTI            
Sbjct: 240 IMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDH 299

Query: 299 SYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHI 358
                  +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HI
Sbjct: 300 GQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHI 359

Query: 359 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFM 418
           P+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET+STLEYAT+AK+IKN PQ+   +
Sbjct: 360 PYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSL 419

Query: 419 MKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEH 453
            KD               D  +++ K+GI+++ + 
Sbjct: 420 SKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 454

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  335 bits (858), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 234/653 (35%), Positives = 351/653 (53%), Gaps = 107/653 (16%)

Query: 4   NGLTTKKRTMLDDG--NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTT 61
           NG+ T      ++G    + NI V VRCR RN+REI+ KS+VV++     G   +  N +
Sbjct: 32  NGMHTLTPPTCNNGAATSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGS 91

Query: 62  GDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKT 121
                + K   +TY  DQVFG  +DQ+ +F   A+    + + GYNCT+  YG T TGKT
Sbjct: 92  HQSYSSSK---KTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKT 148

Query: 122 YTMTGDEKLYDGE--------LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEE 173
           YTM+GD  +  G+        L + AGIIPRVL  LF  L +   ++ VK S++ELYNE 
Sbjct: 149 YTMSGDINIL-GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNEN 207

Query: 174 LKDLLDDTP-------DYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHI 226
           LKDLL D+        D  +++RIFD+N          NN+                   
Sbjct: 208 LKDLLSDSEDDDPAVNDPKRQIRIFDNN----------NNN------------------- 238

Query: 227 PTKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSS 286
                             S+I ++ +QE  I +A EG+++L +G   R+VA+TK ND SS
Sbjct: 239 ------------------SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSS 280

Query: 287 RSHTIFTIMLY--------KSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSIN 338
           RSHT+FTI                   +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN
Sbjct: 281 RSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLIN 340

Query: 339 QSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSST 398
           +SLLTLGRVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET+ST
Sbjct: 341 KSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETAST 400

Query: 399 LEYATKAKNIKNRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEH---YQ 455
           LEYAT+AK+IKN PQ+   + KD               D  +++ K+GI+++ +    Y+
Sbjct: 401 LEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYE 460

Query: 456 EMVNDLENYQTEIQESKRQVESFSSQ-------NSLLLKDKKA------------SQQLN 496
                ++    +I   + Q++ F          N+LL  +K+             S   +
Sbjct: 461 SNSILIDEQNLKIHNLREQIKKFKENYLNQLDINNLLQSEKEKLIAIIQNFNVDFSNFYS 520

Query: 497 ELQDMKITRLQ--NTI----EYLCDKIERQHRNEIDLVSTI-HKLKEALHTMKGSLQNYE 549
           E+Q +  T L+  N +    ++  +  ++Q+    ++   I  ++ + L+T++GSL NY 
Sbjct: 521 EIQKIHHTNLELMNEVIQQRDFSLENSQKQYNTNQNMQLKISQQVLQTLNTLQGSLNNYN 580

Query: 550 THELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTI 602
           +    +   + E L + + +++   D  L+++    +  NL +N   + +R+I
Sbjct: 581 SKCSEVIKGVTEELTRNVNTHKAKHDSTLKSLLN--ITTNLLMNQMNELVRSI 631

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  332 bits (851), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 237/691 (34%), Positives = 357/691 (51%), Gaps = 137/691 (19%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V VRCR RN+REI  KS+VV++     G   +  N +     + K   +TY  DQVF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 131
           G  +DQ+ +F   A+    + + GYNCT+  YG T TGKTYTM+GD          +KL 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 132 DGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKD----------LLDDT 181
            GE    AGIIPRVL  LF  L     ++ VK S++ELYNE LKD          +++DT
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDT 225

Query: 182 PDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLY 241
               +++RIFD+N          NN+                                  
Sbjct: 226 ---KRQIRIFDNN----------NNN---------------------------------- 238

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY---- 297
              S+I ++ +QE  I +A EG+++L +G   R+VA+TK ND SSRSHT+FTI       
Sbjct: 239 ---SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQ 295

Query: 298 ----KSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 353
                       +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 296 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 354 KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQ 413
            S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ +ET+STLEYAT+AK+IKN PQ
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQ 415

Query: 414 LGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEH---YQEMVNDLENYQTEIQE 470
           +   + KD               D  +++ K+GI+++ +    Y+     ++    +I  
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHN 475

Query: 471 SKRQVESFSSQ-------NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRN 523
            + Q++ F  +       N+LL  +K+  + +  ++D  I        +   KI++ H  
Sbjct: 476 LREQIKKFKEKYLTQLDINNLLQSEKE--KLVTVIRDFDI-----DYSHFYSKIQQIHYT 528

Query: 524 EIDLVSTIHKLKEALH--------------------------TMKGSLQNYETHELRLQN 557
            ++L++ + + +++ H                          +++ SL+NY +   ++ N
Sbjct: 529 NLELINQVTQQRDSSHENCQKQYTANQNMQLKISQQVLQTLNSLQNSLRNYNSKFSQVIN 588

Query: 558 DIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDM 617
            + E L   + S++ + D    T K+ M   N + N  M ++  +     +S +   SD 
Sbjct: 589 GVTEELTNSVNSHKVNHD---STFKSLM---NTTANLLMIKMNELVLSISNSFKDFQSDF 642

Query: 618 CTNIVKIVKDQPSTSYQQFKEALGDLDTKVQ 648
            ++  K + D     YQ  K  L +L + ++
Sbjct: 643 ASHCNKDLND----IYQSHKLLLRNLQSDIK 669

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  321 bits (822), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 233/654 (35%), Positives = 332/654 (50%), Gaps = 143/654 (21%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEV----------SINTTGDIGIAGKM- 70
           NI V VRCR R +REI  KS+VV++     G+  +          + N  G         
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 71  ----------------NSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYG 114
                           N RTYT D+VFG  +DQ+ +F+++A+    + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 115 MTSTGKTYTMTGD----------EKLYDGELSDSAGIIPRVLFRLFDTLEATES------ 158
            T TGKTYTM+GD          +K+  GE    AGIIPRVL  LF  L   ++      
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGE---HAGIIPRVLVYLFKELSKNDTITNTKV 227

Query: 159 -----------------------DHLVKCSYIELYNEELKDLLD----DTPDYSKRLRIF 191
                                  ++ VK S++ELYNE+L DLL     D  + + +L   
Sbjct: 228 NNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDKLINQ 287

Query: 192 DSNTIT----------NSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLY 241
            S   T          N +   +NN+  + DG +  +   +             NK    
Sbjct: 288 TSGNSTPYSITNGLNVNDKFKIKNNNLHDFDGKNVRIMSNQ-------------NKSASN 334

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----Y 297
              S+I ++ ++E +I +A EG+ +L +G   R+VASTK+ND SSRSHTIFTI+      
Sbjct: 335 CNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKV 394

Query: 298 KSYEGELF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI 356
               G+ F +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D+S 
Sbjct: 395 DPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSH 454

Query: 357 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGS 416
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ +ET STLEYAT+AK+IKN PQ+  
Sbjct: 455 HIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQ 514

Query: 417 FMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQ----------EMVNDLENYQT 466
            + KD               +    + KEGIY++ +             E    ++N + 
Sbjct: 515 SLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQLDLYESNSILITEQKAKIDNMED 574

Query: 467 EIQESKRQVESFSSQNSLLL----KDKKASQQLNELQDMKIT---RLQNTIEYLCDKIE- 518
           +I+  K +    +  N +LL    + + A+Q+L+E   + I+   R Q   +     I  
Sbjct: 575 QIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEKTKVIISLFKRYQENFKIFNSNINQ 634

Query: 519 ------------RQHRNEIDLVS--TIHKLK----------EALHTMKGSLQNY 548
                       + H++++DL S   I  LK          E L+T+K SL +Y
Sbjct: 635 IHSSNLEVFDSLQNHKDKLDLCSKKNIKTLKEIYIAEEKYTEQLNTLKASLSSY 688

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  290 bits (741), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 190/439 (43%), Positives = 244/439 (55%), Gaps = 89/439 (20%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V VRCR RN++EI  KS+VVV+     G           I I+   N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNG---------NQIIISNSTNKNKYIFDNVF 59

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS--- 138
           G  +DQ+ IF ++A     + I GYNCT+  YG T TGKTYTM+GD  +  G+L+ +   
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNSTKNI 118

Query: 139 -----AGIIPRVLFRLFDTLEATESD--------HLVKCSYIELYNEELKDLLDDTPDYS 185
                AGIIPRVL +LF +LE + S+        + VK S++ELYNE LKDLL    D  
Sbjct: 119 LLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSADADLP 178

Query: 186 KRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS 245
                                      G+SS+      ++I     + S          S
Sbjct: 179 ------------------------PNSGSSSANDPSVSSNIKIFDNKDS--------SDS 206

Query: 246 AIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIM-----LYKSY 300
           +I ++ +QE  I NA EG+++L KG   R+V STK+ND SSRSHTIFTI      L    
Sbjct: 207 SIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQT 266

Query: 301 EGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS----- 355
             E  +I K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN+L+DK+     
Sbjct: 267 NKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALSDKTNNTHG 324

Query: 356 -------------------IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETS 396
                               HIP+RESKLTRLLQDSLGG TKT +IATISPAK   DET 
Sbjct: 325 SNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETI 384

Query: 397 STLEYATKAKNIKNRPQLG 415
           STLEYAT+A +IKN P++ 
Sbjct: 385 STLEYATRAMSIKNNPKIN 403

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  195 bits (495), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 145/422 (34%), Positives = 208/422 (49%), Gaps = 82/422 (19%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI VAVR R    RE        VT P  +   +  I+T+  +        + +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 82  ----GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE--------- 128
                 S DQ++I+  I        + GYN  +L YG T +GK++TM G E         
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 129 KLYDGELSDSA-GIIPRVLFRLFDTLEA--TESDHL-----VKCSYIELYNEELKDLLDD 180
              D  + DSA GIIPRV   LFD      +E D +     + CSY+E+YNE+++DLL  
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL-- 180

Query: 181 TPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLL 240
                             S  GS+    +  D T+                         
Sbjct: 181 ------------------SEDGSKCRVRERADKTT------------------------- 197

Query: 241 YEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS- 299
                  +++ L EF +    E +  +++G + R V  T MN+ SSRSH IFTI + +S 
Sbjct: 198 -------FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSE 250

Query: 300 --YEGELF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI 356
               G+L  R S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA K+ 
Sbjct: 251 TTLAGDLTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNR 310

Query: 357 H--IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQL 414
              IP+R+S LT +L+++LGGN+KT +IA +SP   + +ET STL YAT AK +KN  ++
Sbjct: 311 PKLIPYRDSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARV 368

Query: 415 GS 416
            S
Sbjct: 369 NS 370

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  191 bits (485), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 140/406 (34%), Positives = 213/406 (52%), Gaps = 71/406 (17%)

Query: 22  NITVAVRCRGRNEREIKAKSAVV------VTVPDVTGSNEVSINTTGDIGIAGKMNSRTY 75
           N+ V VR +  +  E +   AVV      V  P+    N+ S  +T   G+ G+  SR++
Sbjct: 34  NVKVMVRLKPIDAPEKQYNVAVVALDESTVEFPN----NDTSPGSTN--GVQGESPSRSF 87

Query: 76  TVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGEL 135
             D VFG ++ Q  ++  +AE + D F  GYN T+L YG T +GK+YTM G         
Sbjct: 88  HFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP-------- 139

Query: 136 SDSAGIIPRVLFRLFDTLEATES----DHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
            D+ G+IPR+   +F+ +   +S    +++V  S++E+Y E++ DLL ++ + S      
Sbjct: 140 IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGESINKSA----- 194

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS-AIYIQ 250
                          SPK+                 T  KR SL    ++E S+  +Y+Q
Sbjct: 195 ---------------SPKK-----------------TSEKRTSLT---IHESSTFGVYVQ 219

Query: 251 NLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK--SYEGELFRIS 308
           +     +++  E +  +  G   R  +ST MN  SSRSH I  I L K  + EG + + S
Sbjct: 220 SATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGSIQK-S 278

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---IHIPFRESKL 365
            + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+L  K     HIP+R+S+L
Sbjct: 279 DLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPYRDSQL 338

Query: 366 TRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           TRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK I+N+
Sbjct: 339 TRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  184 bits (467), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 195/370 (52%), Gaps = 59/370 (15%)

Query: 52  GSNEVSINTTGDIGIAGKMN-SRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTV 110
           GS  V     G +  AG  + +R +  D VFG  A Q+ +F  +AE + D F  GYN T+
Sbjct: 36  GSAAVVAADEGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTI 95

Query: 111 LVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTL----EATESDHLVKCSY 166
           L YG T +GK+YTM G             G+IPR+  ++F+ +       + +++V  S+
Sbjct: 96  LAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSF 147

Query: 167 IELYNEELKDLLDDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHI 226
           +E+Y E++ DLL ++ +                    + +SPK+                
Sbjct: 148 LEIYLEKVYDLLGESIN--------------------KASSPKKN--------------- 172

Query: 227 PTKPKRPSLNKQLLYEQSS-AIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFS 285
               KR SL    ++E ++  +Y++      +++  E ++ +  G   R   ST MN  S
Sbjct: 173 --SDKRASLT---VHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLES 227

Query: 286 SRSHTIFTIMLYK--SYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 343
           SRSH I  I L K  + EG + + S + LVDLAGSE ++++ A     +EA  IN SL +
Sbjct: 228 SRSHAIVKINLLKRDNLEGNIQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSS 286

Query: 344 LGRVINSLA--DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEY 401
           LG VIN+L   +K  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL +
Sbjct: 287 LGNVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRF 346

Query: 402 ATKAKNIKNR 411
            ++AK+IKN+
Sbjct: 347 GSRAKHIKNK 356

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  180 bits (456), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 137/418 (32%), Positives = 209/418 (50%), Gaps = 103/418 (24%)

Query: 22  NITVAVRCRGRNEREI------KAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTY 75
           NI VAVR R   ERE+      + +   V+ V D    NE                +R++
Sbjct: 4   NIKVAVRLRRPLEREVDESIIARVEDGNVIQVKDRNQKNE----------------TRSF 47

Query: 76  TVDQVFGPS----ADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
             DQ F  S    ADQ  +++ ++       + GY+  V  YG T +GK++TMTG     
Sbjct: 48  HFDQCFAYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS---- 103

Query: 132 DGELSDSAGIIPRVLFRLFDTLEATES--DHL-----VKCSYIELYNEELKDLLDDTPDY 184
                +S GI+ R+   LF+  E  ES  D +     ++CSY+E+YNE ++DLL      
Sbjct: 104 ----PESPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLG----- 154

Query: 185 SKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQS 244
           + R RI +       RA          D T+                             
Sbjct: 155 TGRCRIRE-------RA----------DKTT----------------------------- 168

Query: 245 SAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY---KSYE 301
              +++ L+EF +++  + ++ +++G + R + ST +N++SSRSHTIFTI +    KS  
Sbjct: 169 ---FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSAL 225

Query: 302 GELF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH--I 358
           G +  R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     I
Sbjct: 226 GHVIERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLI 285

Query: 359 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGS 416
           P+R++ LT +L++SLGGN+KT +IA +SP   + +ET STL YAT A+N+K   QL +
Sbjct: 286 PYRDAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQLNA 341

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  179 bits (455), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 179/351 (50%), Gaps = 64/351 (18%)

Query: 71  NSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
           N R +T D+VF   + Q+ +++ +A  +   F +GYN T+L YG T +GK++TM G +  
Sbjct: 71  NDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFGPK-- 128

Query: 131 YDGELSDSAGIIPRVLFRLFDTLEATESDHL---VKCSYIELYNEELKDLLDDTPDYSKR 187
                 ++ G+IPR+   +F  +E  + +     V  S++E+Y E++ DLL  + +    
Sbjct: 129 ------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLE---- 178

Query: 188 LRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAI 247
                                                    KP    ++  L   + S I
Sbjct: 179 -----------------------------------------KPADKRISLSLHDTKDSGI 197

Query: 248 YIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE-GELFR 306
           Y++ L   ++T+ +E +  +++G   R V+ST MN  SSRSH+I  I L K     E  +
Sbjct: 198 YVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEENIQ 257

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-------KSIHIP 359
            S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L          S HIP
Sbjct: 258 HSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSAHIP 317

Query: 360 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKN 410
           +R+SKLTRLLQDSLGGN+KT LI   S ++ N  ET STL + ++AK IKN
Sbjct: 318 YRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  171 bits (433), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 128/409 (31%), Positives = 200/409 (48%), Gaps = 82/409 (20%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI VA+R R +  RE    S +         SNE+++       +   +   T+  DQVF
Sbjct: 4   NIKVAIRIRDKISRETSRPSVI-----KRKTSNEITLQKDNTANVITTVE-HTFYFDQVF 57

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDSAGI 141
             S++QK I+  +A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 142 IPRV---LFRLFDTL--EATESDHLVK----CSYIELYNEELKDLLDDTPDYSKRLRIFD 192
           IP V   LF++ D    E  + D LV      SY ++YNE++ D+L    +    LR+ D
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLSGGCNV---LRVRD 166

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
                                                P++ +             YI+ L
Sbjct: 167 G------------------------------------PRKVT-------------YIEGL 177

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK----SYEGELFRIS 308
            +  + +  E +  +++G   R VA T +N+ SSRSH I TI + +    S+   + R+S
Sbjct: 178 SDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDTVERVS 237

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-DKSIHIPFRESKLTR 367
            + LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  L+ +K   +P+RES LTR
Sbjct: 238 SIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRESLLTR 297

Query: 368 LLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGS 416
           +L+D+L GN+ T ++A ISP   + +E+ STL YA+ AK+++    L +
Sbjct: 298 VLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLNT 344

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  172 bits (436), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 177/350 (50%), Gaps = 71/350 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F   + Q+ IF++   PL D  + G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 135 LSDSAGIIPRVLFRLFDTLE-----ATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLR 189
            S+  GII R +  LF  +E     +  S   +  SY+E+YNE ++DLL           
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL----------- 192

Query: 190 IFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYI 249
                                                  KP+ PS    +  +Q+S I +
Sbjct: 193 ---------------------------------------KPETPSKKLIIREDQNSKISV 213

Query: 250 QNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTI---MLYKSYE--GEL 304
            NL      N ++ I ++ +G  +R  + T+ N+ SSRSH++  I    + K+++  G  
Sbjct: 214 TNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLKNFDDIGST 273

Query: 305 FRI-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKSIHIPFR 361
            +I S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    KS HIP+R
Sbjct: 274 NQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINKKSCHIPYR 333

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           +SKLTRLL+ SLGGN KT +I  +SP+ ++ DET +TL+YA +AK IK +
Sbjct: 334 DSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  167 bits (422), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 120/369 (32%), Positives = 176/369 (47%), Gaps = 72/369 (19%)

Query: 71  NSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
           N+  Y  D VF P  D   I+K  A PL D    G+N T+  YGMT +GKTYTM GD + 
Sbjct: 129 NNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMGDNEN 188

Query: 131 YDGELSDSAGIIPRVLFRLFDTLEATESD--HLVKCSYIELYNEELKDLLDDTPDYSKRL 188
            DG       I+P  +  LF+ +  + +D  + V  SY+E+YNE++ DLLDD        
Sbjct: 189 PDG-------IVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDD-------- 233

Query: 189 RIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIY 248
                                  D T+  +   R+T  P++     L  ++  +    + 
Sbjct: 234 -----------------------DRTNHLLTPSRFTSTPSRLNSSEL--RIRDDLEYGVK 268

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKSYEGELFR 306
           I  L E     ++E +  ++ G  +R+ + T+ N  SSRSH +  + L  +   +G    
Sbjct: 269 ITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHNVIDGSKTS 328

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---------- 356
            S + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S+          
Sbjct: 329 -STLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKHVSNPM 384

Query: 357 --------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYA 402
                         HIP+R+SKLTRLLQ +L GN+    I TI P      ET +TL +A
Sbjct: 385 GPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLRFA 444

Query: 403 TKAKNIKNR 411
           ++AKN+  R
Sbjct: 445 SRAKNVSLR 453

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  162 bits (410), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 114/367 (31%), Positives = 173/367 (47%), Gaps = 83/367 (22%)

Query: 72  SRTYTVDQVFGPS----ADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 127
           ++ +  D  FG +     DQ +I++++        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 128 EKLYDGELSDSAGIIPRVLFRLFDTLEATE---------SDHLVKCSYIELYNEELKDLL 178
           +         + GI+PR    LF+               +D  VKCS+ E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 179 DDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQ 238
                   ++R                                R+ H             
Sbjct: 161 SSLSQRKCKIR-------------------------------ERHDH------------- 176

Query: 239 LLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML-- 296
                  + +++ L+E  + N  E IS + KG ++R V ST MN  SSRSH IF I +  
Sbjct: 177 -------STFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQ 229

Query: 297 ---YKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 353
              +K     +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+
Sbjct: 230 KETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAE 289

Query: 354 ----KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
               +S  IP+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL YA+  K +K
Sbjct: 290 GDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVK 347

Query: 410 NRPQLGS 416
               + S
Sbjct: 348 TNATINS 354

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 111/348 (31%), Positives = 174/348 (50%), Gaps = 70/348 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F  ++ Q  ++K    PL D  + GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 135 LSDSAGIIPRVLFRLFDTLE--ATESDHLVKCSYIELYNEELKDLL-DDTPDYSKRLRIF 191
                G+I   +  LF+ ++    E +  +  SY+E+YNE ++DLL  +TP  SKRL I 
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLLKPETP--SKRLII- 261

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                   R  +QN+                                        I + N
Sbjct: 262 --------REDTQNH----------------------------------------IKVAN 273

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE----GELFRI 307
           L   H T   + ++++ +G  +R  + T+ N+ SSRSH +  I + ++ +          
Sbjct: 274 LSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTF 333

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSIHIPFRES 363
           + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ HIP+R+S
Sbjct: 334 ATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSRTCHIPYRDS 393

Query: 364 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 394 KLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 171/348 (49%), Gaps = 70/348 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F  ++ Q  ++K    PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 135 LSDSAGIIPRVLFRLFDTLE--ATESDHLVKCSYIELYNEELKDLL-DDTPDYSKRLRIF 191
                GII   +  LF+ +     E D  +  SY+E+YNE ++DLL  +TP  SKRL I 
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETP--SKRLVI- 261

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                   R  +QN+                                        I + N
Sbjct: 262 --------REDTQNH----------------------------------------IKVAN 273

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE----GELFRI 307
           L   H     + + ++ +G  +R  + T+ N+ SSRSH +  I + ++ +          
Sbjct: 274 LSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTF 333

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSIHIPFRES 363
           + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +S HIP+R+S
Sbjct: 334 ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDS 393

Query: 364 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 394 KLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  165 bits (417), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 107/347 (30%), Positives = 167/347 (48%), Gaps = 68/347 (19%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F  ++ Q  ++K    PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 135 LSDSAGIIPRVLFRLFDTLE--ATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
                GII   +  LF+ +     E +  +  SY+E+YNE ++DLL              
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL-------------- 250

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
                                               KP+ PS    +  +  S I + NL
Sbjct: 251 ------------------------------------KPETPSKRLVIREDTQSHIKVANL 274

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE----GELFRIS 308
              H T   + + ++ +G  +R  + T+ N+ SSRSH +  I + ++ +          +
Sbjct: 275 SYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFA 334

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSIHIPFRESK 364
            ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +S HIP+R+SK
Sbjct: 335 TLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSK 394

Query: 365 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           LTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 395 LTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  164 bits (416), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 113/358 (31%), Positives = 172/358 (48%), Gaps = 74/358 (20%)

Query: 70  MNSR-----TYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM 124
           MNSR      +  D+VF   A Q+ +++    PL D  + G+N TV  YG T  GKTYT+
Sbjct: 115 MNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTV 174

Query: 125 TGDEKLYDGELSDSAGIIPRVLFRLFDTLEATESDHL--VKCSYIELYNEELKDLLDDTP 182
           +G         +++ GII   +  LF  +E  +      +  SY+E+YNE ++DLL+   
Sbjct: 175 SGT--------AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLLE--- 223

Query: 183 DYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYE 242
                                                          P+ PS    L  +
Sbjct: 224 -----------------------------------------------PETPSKKLVLRED 236

Query: 243 QSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML-YKSYE 301
               I + NL    +    + + ++ KG  +R  ++T  N+ SSRSH +  + +  K+  
Sbjct: 237 VHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRT 296

Query: 302 GEL---FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----D 353
            EL    + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L       
Sbjct: 297 AELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRG 356

Query: 354 KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
              H+P+R+SKLTRLL+ SLGGN KT +I  ISP   + DET +TL+YAT+AK IK +
Sbjct: 357 GGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  164 bits (415), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 172/348 (49%), Gaps = 70/348 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F  ++ Q  ++K    PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 135 LSDSAGIIPRVLFRLFDTLE--ATESDHLVKCSYIELYNEELKDLL-DDTPDYSKRLRIF 191
                GII   +  LF+ +     E +  +  SY+E+YNE + DLL  +TP  SKRL I 
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLLRPETP--SKRLVI- 261

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                   R  +QN+                                        I + N
Sbjct: 262 --------REDTQNH----------------------------------------IKVAN 273

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE----GELFRI 307
           L   H T   + + ++ +G  +R  + T+ N+ SSRSH++  I + ++ +          
Sbjct: 274 LSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLTSQHTF 333

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSIHIPFRES 363
           + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      ++ HIP+R+S
Sbjct: 334 ATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTCHIPYRDS 393

Query: 364 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 394 KLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  164 bits (414), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 121/384 (31%), Positives = 187/384 (48%), Gaps = 86/384 (22%)

Query: 54  NEVSINTTGDIGIAGKMNSRTY---------TVDQVFGPSADQKLIFKNIAEPLFDDFIK 104
           N++S N    I  + +++ R Y           D++   ++ Q+ +F++  EPL D  + 
Sbjct: 80  NKISENILNSIYSSSQLSRRHYRKNGGELRFIFDKLLDQNSTQQHVFQSTTEPLLDSILD 139

Query: 105 GYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTLEATES--DHLV 162
           GYN TV  YG T  GKTYT++G          ++ GII   L  LF+ +E  +   +  +
Sbjct: 140 GYNGTVFAYGATGCGKTYTISGT--------PENPGIIFLTLQSLFNKIENLKDTKEISI 191

Query: 163 KCSYIELYNEELKDLLDDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRR 222
             SY+E+YNE +KDLLD T   SK+L I         R  + N                 
Sbjct: 192 SLSYLEIYNESIKDLLDPTIS-SKKLVI---------REDANN----------------- 224

Query: 223 YTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMN 282
                                   I + NL  +      E + ++ +G  +R  +ST  N
Sbjct: 225 -----------------------KISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHAN 261

Query: 283 DFSSRSHTIFTIMLYKSYE--------GELFRISKMNLVDLAGSENISRSGAQNQRAKEA 334
           + SSRSH +  I L +  +         +LF  S ++++DLAGSE  + +  + +   E 
Sbjct: 262 ETSSRSHAVLQIHLTQQNKLNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLEG 319

Query: 335 GSINQSLLTLGRVINSL-------ADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISP 387
            +IN+SLL LG  IN+L       + + IHIP+R+SKLTRLL+ SLGGN KT +I  +SP
Sbjct: 320 ANINKSLLALGNCINALCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSP 379

Query: 388 AKINADETSSTLEYATKAKNIKNR 411
           +  + DET +TL+YA +AK IK +
Sbjct: 380 SSKHYDETLNTLKYANRAKEIKTK 403

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 110/351 (31%), Positives = 176/351 (50%), Gaps = 74/351 (21%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F   A Q+ ++++    L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHL--VKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
             +  GII RV+  LF+ +E  +      +  SY+E+YNE ++DLL              
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL-------------- 248

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSA--IYIQ 250
                                               KP+  ++ K+L+  +  A  I + 
Sbjct: 249 ------------------------------------KPE--TVPKRLIIREDGANKISVS 270

Query: 251 NLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE-GEL---FR 306
           NL   +    +E I ++ KG  +R  + T+ N+ SSRSH +  I + ++    +L     
Sbjct: 271 NLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNRTADLTSEHT 330

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKSIHIPF 360
            + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++S HIP+
Sbjct: 331 FATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNRSCHIPY 390

Query: 361 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           R+SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 391 RDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  161 bits (407), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 169/359 (47%), Gaps = 79/359 (22%)

Query: 71  NSRTYTV--DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE 128
           N+ TY+   D VF        +F  I E L    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 129 KLYDGELSDSAGIIP---RVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS 185
                 L+ + G+IP   + +F   D+L+    ++ V C +IELYNE + DL  D     
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDNG--- 543

Query: 186 KRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYE-QS 244
                                                       P + S++ ++ ++ QS
Sbjct: 544 --------------------------------------------PTKDSISHEIRHDDQS 559

Query: 245 SAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKSYEG 302
              Y+ N++ F I N  + I ++ K    R  +ST +N  SSRSH IF I L  Y     
Sbjct: 560 KITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNHKTN 619

Query: 303 ELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----------- 351
           E   ISK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L           
Sbjct: 620 EKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHLNSN 678

Query: 352 -ADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
              K+ HIPFR SKLT LL+ SL G++KT +   +S  + + +ET ++L +ATK  N K
Sbjct: 679 DLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNNTK 737

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  160 bits (406), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 116/371 (31%), Positives = 189/371 (50%), Gaps = 73/371 (19%)

Query: 54  NEVSINTTGDIGIAGKMNS-RTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLV 112
           N + + + G++    + N  + +  D++F   A Q+ +F+    PL D  + G+N TV  
Sbjct: 106 NTMLVGSRGEVRRRMRRNGEQKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFA 165

Query: 113 YGMTSTGKTYTMTGDEKLYDGELSDSAGII---PRVLFRLFDTLEATESDHLVKCSYIEL 169
           YG T  GKT+T++G          DS GII    + LF+  + L+ T++  L   SY+E+
Sbjct: 166 YGATGCGKTFTISG--------TPDSPGIIFLTMQELFQRINNLKDTKTFELT-VSYLEI 216

Query: 170 YNEELKDLLD-DTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPT 228
           YNE ++DLL+ DTP  S++L I                  +E   +++++A   Y H P 
Sbjct: 217 YNETIRDLLEPDTP--SQKLII------------------REDSDSTTTVANLSY-HTPE 255

Query: 229 KPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRS 288
                               ++++ +  I           +G  +R  + T  N+ SSRS
Sbjct: 256 T-------------------VEDVMDLVI-----------RGNVNRTTSPTDANETSSRS 285

Query: 289 HTIFTIMLYKSYEGELFRISKM----NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 344
           H +  + + +S      +  KM    +++DLAGSE  S +  + +R  E  +IN+SLL L
Sbjct: 286 HAVLQVHVVQSSRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLAL 345

Query: 345 GRVINSLA----DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLE 400
           G  IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL+
Sbjct: 346 GNCINALCMTGRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLK 405

Query: 401 YATKAKNIKNR 411
           YA +AK+IK +
Sbjct: 406 YANRAKDIKTK 416

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  161 bits (407), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 109/359 (30%), Positives = 172/359 (47%), Gaps = 73/359 (20%)

Query: 68  GKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 127
            K N   +  D++F  ++ Q  ++      L D  + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 128 EKLYDGELSDSAGIIPRVLFRLFDTLE--ATESDHLVKCSYIELYNEELKDLLDDTPDYS 185
           +        ++ GII RV+  LF+ +E    E    +  SY+E+YNE + DLL       
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL------- 288

Query: 186 KRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS 245
                                                      KP  PS    +  ++ S
Sbjct: 289 -------------------------------------------KPDTPSKKLIIREDKDS 305

Query: 246 AIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE---- 301
            I + NL   +  + ++ I ++ +G  +R  +ST+ N+ SSRSH +  I + ++      
Sbjct: 306 KISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNTKIDL 365

Query: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--------- 352
                 + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L          
Sbjct: 366 TSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNNTRRR 425

Query: 353 DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           +   HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 426 NIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 484

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  160 bits (405), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 168/348 (48%), Gaps = 69/348 (19%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D+VF   + Q  +++    PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHL--VKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
             ++ GII   +  LF  +E  +      +  SY+E+YNE ++DLL+             
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE------------- 223

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
                                                P+ P+    L  +    I + NL
Sbjct: 224 -------------------------------------PETPTKKLVLREDSHRHITVANL 246

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML-YKSYEGEL---FRIS 308
               ++   + + ++ KG  +R  ++T  N+ SSRSH +  + +  ++   EL    + +
Sbjct: 247 SHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELTEDHKFA 306

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPFRES 363
            ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H+P+R+S
Sbjct: 307 TLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYHVPYRDS 366

Query: 364 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YAT+AK IK +
Sbjct: 367 KLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  157 bits (398), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 178/351 (50%), Gaps = 72/351 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           YT D VF P A    ++    +PL D    G+N TV  YGMT +GKTYTM+G     DG 
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG----VDG- 158

Query: 135 LSDSAGIIP----RVLFRLFDTL--EATESDHLVKCSYIELYNEELKDLLDDTPDYSKRL 188
              +AG+IP     +  ++FD+   E  + D LV  SY+E+YNE++ DLL+   D  K L
Sbjct: 159 ---NAGLIPLSVAYMYSKIFDSTIHENKKYDTLV--SYLEIYNEKIYDLLETDFD-PKPL 212

Query: 189 RIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIY 248
           R                          SS+A      +P    R   N          + 
Sbjct: 213 R--------------------------SSIA------VPELKIRDDPNY--------GVR 232

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS--YEGELFR 306
           +  L E    +  E ++ ++ G KHR+ +ST  N  SSRSH I  I L  S    GE+  
Sbjct: 233 VIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLSSGEVV- 291

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK---------SIH 357
            S ++L DLAGSE ++   AQ++R +E   IN+SLL LG VI+ L+ +         + H
Sbjct: 292 TSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESVNNSH 348

Query: 358 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
           IP+R+SKLTR+LQ +L GN+    I TI  +    +E+ +TL +A++AKN+
Sbjct: 349 IPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 128/410 (31%), Positives = 185/410 (45%), Gaps = 91/410 (22%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V+VR R   ERE   +      +  V   N + +        A +  +R +  D   
Sbjct: 4   NIKVSVRLRKPLERESAER-----VIAQVVSENLIKVEQR-----AKREETRNFEFDLCC 53

Query: 82  GPSA----DQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137
             S     DQ  +++ +A       + GYN  +  YG T +GK++TMTG  +L       
Sbjct: 54  TYSESLEEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL------- 106

Query: 138 SAGIIPRVLFRLFDTLEATESD-------HLVKCSYIELYNEELKDLLDDTPDYSKRLRI 190
             GI+PR+   LF+  E  ES          ++CSY+E+YNE ++DLL      + + RI
Sbjct: 107 -PGIVPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLLG-----ANKCRI 160

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQ 250
            +    T    G Q       D            ++    +R ++   L+ EQSS     
Sbjct: 161 RERADKTTFVEGLQEFEVNSVDEI--------LDYLRQGSERKTVGATLVNEQSS----- 207

Query: 251 NLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELF----R 306
                                               RSHTIFTI + +     L     R
Sbjct: 208 ------------------------------------RSHTIFTINVEQKENSPLGHVLER 231

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH--IPFRESK 364
            S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R++ 
Sbjct: 232 RSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYRDAA 291

Query: 365 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQL 414
           LT +L++SLGGN+KT +IA +SP     +ET STL YAT A+++K   QL
Sbjct: 292 LTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 170/347 (48%), Gaps = 68/347 (19%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F   A Q  ++++   PL D  + G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 135 LSDSAGIIPRVLFRLFDTLE-ATESDHL-VKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
             +  G+I   +  LF  +E   +S H  +  SY+E+YNE ++DLL  +PD S +  +  
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL--SPDISSKKLVIR 245

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
            ++I                                                  I + NL
Sbjct: 246 EDSI------------------------------------------------KGISVANL 257

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKSYEGEL---FRIS 308
                   ++ + ++ +G  +R  + T  N+ SSRSH +  I ++ K+   EL      +
Sbjct: 258 SHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAELSEAHTFA 317

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSIHIPFRESK 364
            ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L       + H+P+R+SK
Sbjct: 318 TLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCHVPYRDSK 377

Query: 365 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           LTRLL+ SLGGN KT +I  I+P+  + DET +TL+YA +AK IK +
Sbjct: 378 LTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/348 (29%), Positives = 174/348 (50%), Gaps = 69/348 (19%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F   + QK ++++   PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 135 LSDSAGIIPRVLFRLFDTLE-ATESDHL-VKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
             ++ GII + +  LF+ +E   ++ H  +  S++E+YNE ++DLL   P+ S +  +  
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL--CPETSSKKLV-- 235

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
                                                         +L + + +I + NL
Sbjct: 236 ----------------------------------------------ILEDSNESIRVSNL 249

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFR----IS 308
             ++     + + ++ KG  +R  ++T  N+ SSRSH +  I + +       +     +
Sbjct: 250 SHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTADLKSDHTFA 309

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPFRES 363
            ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L       +S H+P+R+S
Sbjct: 310 TLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRSCHVPYRDS 369

Query: 364 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 370 KLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 187/371 (50%), Gaps = 73/371 (19%)

Query: 54  NEVSINTTGDIGIAGKMNS-RTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLV 112
           N + + + G+I    + N  + +  D++F   A Q+ +F     PL D  I G+N TV  
Sbjct: 108 NTMLVGSRGEIRRRMRRNGEQKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFA 167

Query: 113 YGMTSTGKTYTMTGDEKLYDGELSDSAGII---PRVLFRLFDTLEATESDHLVKCSYIEL 169
           YG T  GKT+T++G          ++ GII    + LF+  + L+ T++  L   SY+E+
Sbjct: 168 YGATGCGKTFTISG--------TPENPGIIFLTMQELFQRIENLKDTKTFQLT-VSYLEI 218

Query: 170 YNEELKDLLD-DTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPT 228
           YNE ++DLL+ DTP  S++L I                  +E    ++++A   Y H P 
Sbjct: 219 YNEMIRDLLEPDTP--SQKLII------------------REDTDNTTTVANLSY-HTPR 257

Query: 229 KPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRS 288
                               +Q++ +  I           KG  +R  + T  N+ SSRS
Sbjct: 258 S-------------------VQDVMDLVI-----------KGNINRTTSPTDANETSSRS 287

Query: 289 HTIFTIMLYKSYEGELFRISK----MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 344
           H +  I + +S      +  K    ++++DLAGSE  S +  + +R  E  +IN+SLL L
Sbjct: 288 HAVLQIHVVQSSRSVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLAL 347

Query: 345 GRVINSLADKS----IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLE 400
           G  IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL+
Sbjct: 348 GNCINALCMTGRRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLK 407

Query: 401 YATKAKNIKNR 411
           YA +AK+IK +
Sbjct: 408 YANRAKDIKTK 418

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  155 bits (392), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 173/370 (46%), Gaps = 86/370 (23%)

Query: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137
           D+ FG    Q   +K        D + GYNC +L YG T +GKTYTM G+ K      +D
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 138 SAGIIPRVLFRLFDTLEATE----------SDHLVKCSYIELYNEELKDLLDDTPDYSKR 187
           + G+IPR    LF  +E+ +          S++ V CS  E+YNE++ DLL         
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLL--------- 168

Query: 188 LRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAI 247
               + N +                    S +K R         R + ++ +  E  + I
Sbjct: 169 ----EMNEV-------------------QSCSKYRV--------RENRDRSMYIENITEI 197

Query: 248 YIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-----YEG 302
            + N+ +         I  ++ G ++R   ST MN  SSRSH I +I + ++        
Sbjct: 198 EVSNIDQM--------IKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNTNS 249

Query: 303 ELFRISKMNLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK------- 354
            +   S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  +       
Sbjct: 250 SIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKYNS 309

Query: 355 -------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKN 407
                  +I +PFRES LT +L+D+LGGN+KT +IA ISP   N +E++STL YA  A+ 
Sbjct: 310 NSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYADIAQT 367

Query: 408 IKNRPQLGSF 417
           IK    + ++
Sbjct: 368 IKTNSIINTY 377

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  157 bits (398), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 120/359 (33%), Positives = 176/359 (49%), Gaps = 63/359 (17%)

Query: 62  GDIGIA-GKMNSRT--YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTST 118
           GD G+   + NS+   +  D++F        IFK + + L    + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGS 439

Query: 119 GKTYTMTGDEKLYDGELSDSAGIIPRVL---FRLFDTLEATESDHLVKCSYIELYNEELK 175
           GKTYTM          L+   GI+P  +   F   D L A    + V C +IE+YNE + 
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIV 489

Query: 176 DLLDDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSL 235
           DLL                     R+G+    P +++   ++ +K    H          
Sbjct: 490 DLL---------------------RSGA----PSQENNDRNADSKHEIRH---------- 514

Query: 236 NKQLLYEQSSAIYIQNLQEFHITNAREGIS-VLQKGLKHRQVASTKMNDFSSRSHTIFTI 294
                 ++    YI N+    + ++R+ +  VL++  K R  AST  N+ SSRSH+IF I
Sbjct: 515 -----DQELKTTYITNITTC-VLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFII 568

Query: 295 MLYKSYEGELFRISK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NS 350
            L    EG   +    +NLVDLAGSE ++ S    +R +E  SIN+SL  LG VI   NS
Sbjct: 569 HLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNS 628

Query: 351 LADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
              +  HIPFR SKLT LLQ SL G++KT +   ISPA ++ +ET ++L +A+K  N K
Sbjct: 629 PDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  157 bits (397), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 109/345 (31%), Positives = 174/345 (50%), Gaps = 59/345 (17%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF P  +   +++ +A P+ D   +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 135 LSDSAGIIPRVLFRLFDTLEA--TESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
                GIIP  +  +FD +          V+ SY+E+YNE + DLL+       + +  +
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN-----LPQGKTLN 212

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
           SN +  S   +  N  K +D                          L Y     + +  L
Sbjct: 213 SNIMVPS--STLTNDLKLRD-------------------------DLKY----GVKVVGL 241

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE--GELFRISKM 310
            E ++++ +E +  +  G  +R+   T  N  SSRSH +  I ++ + E  GE   +S +
Sbjct: 242 VERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGEQV-MSTL 300

Query: 311 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI-------HIPFRES 363
           +L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S        HIP+R+S
Sbjct: 301 SLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVGHIPYRDS 357

Query: 364 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
           KLTR+LQ +L G++  A I T+      + E+ +T+ +A++AKNI
Sbjct: 358 KLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 166/349 (47%), Gaps = 70/349 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F   A Q+ ++++    L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 135 LSDSAGIIPRVLFRLFDTLEATES--DHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
             ++ GI+ + +  LF  +E  +      +  S++E+YNE ++DLL              
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL-------------- 253

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
                                               KP+ PS    +  +  + I + NL
Sbjct: 254 ------------------------------------KPETPSQKLIIREDTDNKITVANL 277

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEG----ELFRIS 308
            +   T  +E + ++ +G  +R  + T+ N+ SSRSH +  I + +        E     
Sbjct: 278 SQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIKEEHTFG 337

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKSIHIPFRE 362
            ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L           H+P+R+
Sbjct: 338 TLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRCHVPYRD 397

Query: 363 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 398 SKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 173/356 (48%), Gaps = 72/356 (20%)

Query: 69  KMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE 128
           +   + +  D++F     Q+ +++N   PL D  + G+N TV  YG T  GKT+T++G  
Sbjct: 118 RFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT- 176

Query: 129 KLYDGELSDSAGIIPRVLFRLFDTLEATES--DHLVKCSYIELYNEELKDLLDDTPDYS- 185
                  S+  GII   +  LF  +E  +      ++ S++E+YNE++ DLLD  P+ S 
Sbjct: 177 -------SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLD--PNISS 227

Query: 186 KRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS 245
           K+L I         R  S N +                                      
Sbjct: 228 KKLVI---------REDSYNRT-------------------------------------- 240

Query: 246 AIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELF 305
             ++ NL +    N  E + ++ KG  +R  + T  N+ SSRSH +  I + +       
Sbjct: 241 --FVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADI 298

Query: 306 R----ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS------ 355
           +     + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L   S      
Sbjct: 299 KQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFS 358

Query: 356 IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
            H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL+YA +AK IK +
Sbjct: 359 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  155 bits (392), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 128/411 (31%), Positives = 196/411 (47%), Gaps = 70/411 (17%)

Query: 11  RTMLDDGNEELNITVAVRCRGRNE--REIKAKSAVVV-TVPDVTGSNEVSINTTGDIGIA 67
           R  L +  +EL   + V CR R     E +  S +++    +  G+  ++IN        
Sbjct: 353 RRKLHNELQELRGNIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRN-----E 407

Query: 68  GKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 127
           G++ S  +  D +F PS   K IF+ I + L    + GYN  +  YG T +GKTYTM   
Sbjct: 408 GRILSYNFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--- 463

Query: 128 EKLYDGELSDSAGIIPRVL---FRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDY 184
                  L+   G+IP  L   F+    L+    ++ ++C YIE+YNE + DLL D   +
Sbjct: 464 -------LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRDFKSH 516

Query: 185 SKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQS 244
                I DS               ++ D         R+ H                 + 
Sbjct: 517 DNIDEILDS---------------QKHDI--------RHDH-----------------EK 536

Query: 245 SAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS--YEG 302
              YI N+    +T+  +  ++L+K  K R  A+T+ N+ SSRSH++F + +     + G
Sbjct: 537 QGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTG 596

Query: 303 ELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKSIHI 358
           E  +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L    A K  +I
Sbjct: 597 ETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKR-YI 654

Query: 359 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
           PFR SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  + K
Sbjct: 655 PFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  155 bits (392), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 107/349 (30%), Positives = 171/349 (48%), Gaps = 71/349 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F  +A Q+ ++      L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHL--VKCSYIELYNEELKDLLDDTPDYS-KRLRIF 191
             +  G+I   +  LF  +E  E      +  SY+E+YNE ++DLL  +P+ S K+L I 
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL--SPEMSPKKLVI- 237

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                   R  S+N                                         I + N
Sbjct: 238 --------REDSENR----------------------------------------ISVAN 249

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKSYEGEL---FRI 307
           L         + + ++  G  +R  ++T  N+ SSRSH +  I ++  S   E+      
Sbjct: 250 LSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEITSDHTF 309

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPFRE 362
           +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L       ++ H+P+R+
Sbjct: 310 AKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCHVPYRD 369

Query: 363 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL+YA +AK IK +
Sbjct: 370 SKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  154 bits (390), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 167/342 (48%), Gaps = 61/342 (17%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           Y+ D+VF  +   + IFK ++E L    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHL---VKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
           L+   GIIP     +FD ++ +  +     V C ++E+YN+E+ DLL             
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLL------------- 478

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                             + + ++SS   R   H                + S    ++N
Sbjct: 479 ----------------RSDDNKSNSSNGPRHKIHHD--------------DASKTTVVEN 508

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEG-ELFRISKM 310
           L+   +T+     +VL+  +K R  AST  N+ SSRSH+IF I ++   EG    R   +
Sbjct: 509 LETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINEGLGEERNGLL 568

Query: 311 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTR 367
           NL+DLAGSE +S S  Q++R KE   IN+SL  LG V+NSL        HI FR+SKLT 
Sbjct: 569 NLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRHISFRDSKLTY 628

Query: 368 LLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
           LLQ SL GN+KT ++  IS +  + +ET  +L +A K  + K
Sbjct: 629 LLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  154 bits (389), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 112/347 (32%), Positives = 169/347 (48%), Gaps = 64/347 (18%)

Query: 72  SRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
           S+ Y  D++F  +     +FK I + L    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 132 DGELSDSAGIIPRVLFRLFDTLEATESDHLV---KCSYIELYNEELKDLLDDTPDYSKRL 188
              L+D+ G+IP  +  +FD  E+ +    +    C +IE+YNE + DLL D        
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRD-------- 527

Query: 189 RIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIY 248
                N+   + AGS N      D                             +++    
Sbjct: 528 -----NSTDGNEAGSPNKHEIRHD-----------------------------KETMTTS 553

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRIS 308
           + N+    + N     +VL+K  K R  A+T  N+ SSRSH++F  M+Y   + E+   S
Sbjct: 554 VTNINTIALNNKGIVNNVLKKATKLRATAATNSNERSSRSHSVF--MIYLKGKNEITGDS 611

Query: 309 K---MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKSIHIPFRE 362
               +NLVDLAGSE ++ S A   R +E  +IN+SL  LG VI++L    +   HIPFR 
Sbjct: 612 SEGILNLVDLAGSERLNSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRN 671

Query: 363 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
           SKLT LLQ SL G++KT +   ISP K + +ET ++L +A+K  + K
Sbjct: 672 SKLTYLLQYSLTGSSKTLMFVNISPTKSHLNETINSLRFASKVNSTK 718

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  153 bits (387), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 171/352 (48%), Gaps = 57/352 (16%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF  + +   ++   ++P+ D   +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 135 LSDSAGIIPRVLFRLFDTL--EATESDHL--VKCSYIELYNEELKDLLDDTPDYSKRLRI 190
             ++ G+IP  +  L+  +  E+ + D    +  SY+E+YNE++ DLLD           
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLD----------- 222

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQ 250
                          N  K    TSS M    + H+ T+  +  +  +L  +    + I 
Sbjct: 223 -------------CENELKPTAATSSRM----FAHMGTRSSKTPVELKLREDSKYGVKIV 265

Query: 251 NLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISK- 309
            L E    ++ E +  ++ G K R+   T  N  SSRSH I  I L K+   E   +S  
Sbjct: 266 GLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDLKEGTSVSST 325

Query: 310 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI------------- 356
           ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+ +S              
Sbjct: 326 LSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNGGSSSPVTG 382

Query: 357 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
           HIP+R+SKLTR+LQ +L GN     I TI      + ET +TL +A++AKN+
Sbjct: 383 HIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKNV 434

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  154 bits (389), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 167/350 (47%), Gaps = 73/350 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F   + Q  ++++    L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 135 LSDSAGIIPRVLFRLFDTLEATES--DHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
             +  GII   +  LF  +E  +   +  +  SY+E+YNE ++DLL+             
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN------------- 244

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
                                                P  PS    +  +  S I + NL
Sbjct: 245 -------------------------------------PDTPSKKLVIREDNESKISVANL 267

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS------YEGELFR 306
                   ++ + ++ KG  +R  ++T  N+ SSRSH +  I + ++          +F 
Sbjct: 268 SHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVDLTSSHVF- 326

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPFR 361
            + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +S H+P+R
Sbjct: 327 -ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTRRSCHVPYR 385

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           +SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL+YA +AK IK +
Sbjct: 386 DSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 435

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 109/359 (30%), Positives = 174/359 (48%), Gaps = 77/359 (21%)

Query: 68  GKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 127
           G  +   +  D++F     Q+ +++     L D  + G+N TV  YG T  GKTYT++G 
Sbjct: 136 GSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 195

Query: 128 EKLYDGELSDSAGIIPRVLFRLF---DTLEATESDHLVKCSYIELYNEELKDLLDDTPDY 184
                    ++ GII R +  LF   D L  T+ D  +  S++E+YNE + DLL  +PD 
Sbjct: 196 R--------ENPGIIFRTMEELFVKMDALAGTK-DFELTVSFLEIYNETIHDLL--SPD- 243

Query: 185 SKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQS 244
                                                      T P+     K ++ E S
Sbjct: 244 -------------------------------------------TPPQ-----KLVIREDS 255

Query: 245 S-AIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS---- 299
           +  I + NL      + ++ + ++ +G  +R  + T+ N  SSRSH +  I + +     
Sbjct: 256 NEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNKLV 315

Query: 300 --YEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD---- 353
              E + F    ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 316 DLKEHQTF--GTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGS 373

Query: 354 -KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
            ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 374 HRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK 432

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 105/339 (30%), Positives = 167/339 (49%), Gaps = 62/339 (18%)

Query: 74  TYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           ++  D++F        +FK + + L    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 134 ELSDSAGIIPRVLFRLFDTLEATES---DHLVKCSYIELYNEELKDLLDDTPDYSKRLRI 190
            L  + G+IP  +  +FD +E  +    ++ + C ++E+YNE + DLL            
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL------------ 567

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQ 250
                       ++N +P      ++     R+ H         L K  +   ++ +   
Sbjct: 568 ----------RSNENGTP----WVNAGKCDVRHDH--------DLGKTTITNATTCVL-- 603

Query: 251 NLQEFHITNAREGI-SVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-SYEGELFRIS 308
                    ++E +  VL++  K R  AST  N+ SSRSH+IF I L+  +++ +     
Sbjct: 604 --------ESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCG 655

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI--HIPFRESKLT 366
            +NLVDLAGSE +  S    +R +E  +IN+SL  LG VI +L DK+   HIPFR SKLT
Sbjct: 656 VLNLVDLAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLT 715

Query: 367 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKA 405
            LLQ SL GN+KT +   ISP+  + +ET ++L +A+K 
Sbjct: 716 YLLQYSLVGNSKTLMFVNISPSSSHINETINSLRFASKV 754

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 115/365 (31%), Positives = 173/365 (47%), Gaps = 75/365 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +T D VF        I+    +PL D  I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 135 LSDSAGIIPRVLFRLFDTL-EATESDHL---VKCSYIELYNEELKDLLDDTPDYSKRLRI 190
             +  G+IP  +  LF +L E T +++    V  SY+E+YNE++ DLLD           
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLDVA--------- 235

Query: 191 FDSNTITNSRAGSQ-NNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYI 249
                     +GS   N+P            R +T   T     S + ++  +    + +
Sbjct: 236 ----------SGSNVQNTPS-----------RLFTSTHTSS---SGDLKIRDDSECGVRV 271

Query: 250 QNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKSYEGELFRIS 308
             L +     + E +  + KG K+R+ + T+ N  SSRSH I  I ++ K        I 
Sbjct: 272 VGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQNIR 331

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---------------- 352
            ++L DLAGSE   R   QN+R KE   IN+SLL LG VI+ L+                
Sbjct: 332 TLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAANSQ 388

Query: 353 ---------DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAT 403
                        HIP+R+SKLTRLLQ +L G++    + TI  A  ++ ET +TL +A+
Sbjct: 389 QSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRFAS 448

Query: 404 KAKNI 408
           ++KN+
Sbjct: 449 RSKNV 453

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 103/349 (29%), Positives = 170/349 (48%), Gaps = 71/349 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F  +A+Q  ++ +    L D  + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHLVKC--SYIELYNEELKDLLDDTPDYSKRLRIFD 192
             +  GII   +  LF  +E+ +    ++   SY+E+YNE ++DLL+  P+ S +     
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN--PNVSSK----- 232

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS-AIYIQN 251
                                                       K ++ E S   I + N
Sbjct: 233 --------------------------------------------KLVIREDSDQKITVSN 248

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFR---I 307
           L        +E +  + +G  +R  + T  N+ SSRSH +  I + ++    +L      
Sbjct: 249 LSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLISNSTF 308

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPFRE 362
           + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++ H+P+R+
Sbjct: 309 ATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRTCHVPYRD 368

Query: 363 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
           SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL YA +AK+IK +
Sbjct: 369 SKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  147 bits (371), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 200/430 (46%), Gaps = 83/430 (19%)

Query: 4   NGLTTKKRTM---LDDGNEELNITVAVRCRGRNE-REIKAKSAVVVTVPDVTGSNEV-SI 58
           N +  K+ TM   L +  +EL   + V CR R     I++K    + V D    N + S+
Sbjct: 325 NEILIKEETMRRSLHNELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSM 384

Query: 59  NTTGDIGI----AGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYG 114
                I +    A ++  R +  D++F  +     +FK + + L    + GYN  +  YG
Sbjct: 385 EVMKGIEVNNNNATQIPQR-FKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYG 442

Query: 115 MTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFRLFD---TLEATESDHLVKCSYIELYN 171
            T +GKTYTM          L    GIIP  +  +F+    L+     + + C ++E+YN
Sbjct: 443 QTGSGKTYTM----------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYN 492

Query: 172 EELKDLL-----DDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHI 226
           E + DLL     DDT       R  DSN                               I
Sbjct: 493 ENIIDLLRSSSNDDT-------RNIDSN-------------------------------I 514

Query: 227 PTKPKRPSLNKQLLYEQSSA-IYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFS 285
           PTK        ++ ++Q +    I N+   ++ +     ++L++  K R  AST  N+ S
Sbjct: 515 PTK-------HEIRHDQENRNTTITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHS 567

Query: 286 SRSHTIFTIMLYKSYE---GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 342
           SRSH+IF I L  S      E + I  +NLVDLAGSE I+ S     R +E  +IN+SL 
Sbjct: 568 SRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERINSSQVTGDRLRETQNINRSLS 625

Query: 343 TLGRVINSLA---DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTL 399
            LG VI++L        HIPFR SKLT LLQ SL GN+KT +   ISP+  + +ET ++L
Sbjct: 626 CLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSL 685

Query: 400 EYATKAKNIK 409
            +A+K  + K
Sbjct: 686 RFASKVNSTK 695

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  147 bits (370), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 176/360 (48%), Gaps = 67/360 (18%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           + +D++F        I+  + +PL D    GYN T+  YGMT +GKT+TM+G +      
Sbjct: 109 FRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGTQ------ 162

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHLVK------CSYIELYNEELKDLLDDTPDYSKRL 188
             +  G+IP  +  LF+T+   E + L K       SY+E+YNE+L DLLD   +     
Sbjct: 163 --EDTGLIPLSISHLFNTI--NEENLLGKKKYEMLVSYMEIYNEKLYDLLDTNVEGVNFG 218

Query: 189 RIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIY 248
             + SN  T  R G+  NS ++                           ++  +    I 
Sbjct: 219 --YSSNLQTPPRFGNSFNSAQDL--------------------------RIRDDAQYGIK 250

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRI 307
           +  L E   ++  + +  ++ G K+++++ T+ N  SSRSH+I  + L  +  E  +   
Sbjct: 251 VVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATDLETGIVTT 310

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS------------ 355
           S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI  L+ +S            
Sbjct: 311 STLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRNADNVNHQ 367

Query: 356 -------IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
                   HIP+R+SKLTR+LQ +L GN+    I T+      + ET +TL +A++AKN+
Sbjct: 368 ETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLRFASRAKNV 427

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score =  146 bits (369), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 168/356 (47%), Gaps = 71/356 (19%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF        ++  + +P+ D   +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 135 LSDSAGIIPRVLFRLFD-----TLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLR 189
                G+IP  +  +FD     T ++TE  + VK SY+E+YNE++ DLL           
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLS---------- 246

Query: 190 IFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYI 249
           I ++N    SR          Q G +SS  K R                   +    + +
Sbjct: 247 ITEANGAVASR----------QLGRNSSGLKIRD------------------DSKYGVKV 278

Query: 250 QNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRI-S 308
            +L E  + +  E I  +  G K+R+   T  N  SSRSH I  + L +        + S
Sbjct: 279 VDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCELKTGTEVTS 338

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI------------ 356
            ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+  S             
Sbjct: 339 TLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGSGSNGQPPS 395

Query: 357 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
               HIP+R+SKLTR+LQ +L G++    I TI     +  ET++T+ +A++AKNI
Sbjct: 396 AMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRAKNI 451

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  145 bits (365), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 178/379 (46%), Gaps = 87/379 (22%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +T D+VF  +     I++  + P+ D  ++G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 135 LSDSAGIIPRVLFRLFD-----TLEATESDHLVKCSYIELYNEELKDLLD--------DT 181
             D AG+IP  +  LF      ++  T S + V  SY+E+YNE++ DLLD         T
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGT-SKYEVVVSYLEIYNEKIYDLLDCESENKFNST 222

Query: 182 PDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLY 241
           P      R+F S T            P+   G                P    +   L Y
Sbjct: 223 PS-----RMFLSGT------------PRSSGG----------------PVELRIRDDLKY 249

Query: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-- 299
                + I  L E    ++ E    +Q G K+R+ + T  N  SSRSH I  + L  +  
Sbjct: 250 ----GVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDL 305

Query: 300 YEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI----------- 348
             GE    S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI           
Sbjct: 306 RSGETVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKN 361

Query: 349 -------NSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEY 401
                   +  + + HIP+R+SKLTR+LQ +L GN+    I TI      A ET +T+ +
Sbjct: 362 GPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRF 421

Query: 402 ATKAKN----IKNRPQLGS 416
           A++AKN    +  RP +G+
Sbjct: 422 ASRAKNVTLQVAKRPAVGT 440

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  145 bits (365), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 113/348 (32%), Positives = 169/348 (48%), Gaps = 58/348 (16%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F  +     +FK + + L    + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 135 LSDSAGIIPRVLFRLFD---TLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
           L    GIIP  +  +F+    L+     + ++C ++E+YNE + DLL +  D + ++   
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNNGKVNDL 561

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
            +       + SQ+NS K +          + T+I T             +  S I + N
Sbjct: 562 LA-------SPSQSNSTKHEIRHDPETQTTKVTNITT------------CKLDSKITVDN 602

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE--GELFRISK 309
                         +L++  K R  AST  N+ SSRSH+IF I L  + E  GE      
Sbjct: 603 --------------ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEK-SYGI 647

Query: 310 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD--------KSIHIPFR 361
           +NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI++L          K  HIPFR
Sbjct: 648 LNLVDLAGSERINSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFR 707

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
            SKLT LLQ SL GN+KT +   ISP+    +ET ++L +A+K  + K
Sbjct: 708 NSKLTYLLQYSLIGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  143 bits (361), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 106/359 (29%), Positives = 168/359 (46%), Gaps = 73/359 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D+VF P  +   +++ I +P+ D   +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 135 LSDSAGIIPRVLFRLFDTL---EATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
             D AG+I   + ++F  +         + V+ SY+E+YNE++ DLL+    Y       
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN----YP------ 241

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS--AIYI 249
                          S K   GT  S   +           P    +L     +   + +
Sbjct: 242 ---------------SAKSPGGTYGSFQSKNV---------PGAGAELPVRDDARHGVRV 277

Query: 250 QNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFR--- 306
             L E  + ++ + +  ++ G  +R+   T  N  SSRSH I TI +  +   EL     
Sbjct: 278 VGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCT---ELLSGTD 334

Query: 307 -ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---------- 355
             S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+  S          
Sbjct: 335 TTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGAATP 391

Query: 356 ------IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
                  H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ +A++AKN+
Sbjct: 392 PPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAKNV 450

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  143 bits (360), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 106/347 (30%), Positives = 167/347 (48%), Gaps = 65/347 (18%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           ++ D VF P+ D   +++  A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHL---VKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
            S+  G+IP  +  +F  + +   ++    VK SY+E+YNE++ DLL+    Y      F
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN----YQVSKGSF 254

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
            + T                            T I  K +  S            + +  
Sbjct: 255 GTKT----------------------------TGIELKIRDDS---------KYGVKVIG 277

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRISKM 310
           L E  +  + + +  +  G  +R+   T  N  SSRSH I  I L  +  +  L   S +
Sbjct: 278 LTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGLETTSTL 337

Query: 311 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---------HIPFR 361
           +L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ +S          HIP+R
Sbjct: 338 SLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGGGHHIPYR 394

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
           +SKLTR+LQ +L G+     I T+     ++ ET +T+ +A++AKNI
Sbjct: 395 DSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 108/340 (31%), Positives = 161/340 (47%), Gaps = 64/340 (18%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTM--TGDEKLYD 132
           +  D++F      + +FK + + L    + GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 133 GELSDSAGIIPRVL---FRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLR 189
                  GIIP  +   F   + L+    D+ V C +IE+YNE + DLL           
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL----------- 531

Query: 190 IFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYI 249
                         +N+S  + D  ++S  + R+                  +++    I
Sbjct: 532 --------------RNDSIGKDDTNTNSKHEIRHD-----------------QETKTTMI 560

Query: 250 QNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRIS 308
            N+    + +      +L+K  K R  AST  N+ SSRSH+IF I L  S  +       
Sbjct: 561 TNVTSCQLESEERVDMILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYG 620

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKL 365
            +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L        HIPFR SKL
Sbjct: 621 TLNLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKL 680

Query: 366 TRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKA 405
           T LLQ SL G++KT +   ISP+  + +ET ++L +A+K 
Sbjct: 681 TYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 110/338 (32%), Positives = 161/338 (47%), Gaps = 60/338 (17%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F        +FK + + L    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 135 LSDSAGIIPRVL---FRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
           L+   GIIP  +   F   + L+    D+ V C +IE+YNE + DLL             
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL------------- 531

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                   R+ + N     +D TSSS+ K    H                +++    I N
Sbjct: 532 --------RSDNIN-----RDDTSSSL-KHEIRH---------------DQETKTTVITN 562

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRISKM 310
           +    + + +    +L+K  K R  AST  N+ SSRSH+IF I L  S  +        +
Sbjct: 563 VTTCKLESEKMVDMILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTL 622

Query: 311 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTR 367
           NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L        HIPFR SKLT 
Sbjct: 623 NLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTY 682

Query: 368 LLQDSLGGNTKTALIATISPAKINADETSSTLEYATKA 405
           LLQ SL G++KT +   ISP+  + +ET ++L +A+K 
Sbjct: 683 LLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  140 bits (354), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 171/354 (48%), Gaps = 56/354 (15%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D V+ P      I+++I +P+ D   +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGG----D 190

Query: 135 LSDSAGIIPRVLFRLFDTL----EATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRI 190
             D  G+IP  +  LF  +       E    V  SY+E+YNE + DLLD           
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLD----------- 239

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS-AIYI 249
                 + S  G          GT++            +    S N+  + + S   + +
Sbjct: 240 ------SESLVG----------GTTTPSRGFGSGGGRNESV--STNELKIRDDSKYGVRV 281

Query: 250 QNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISK 309
             L+E    ++ E +  +++G  HR+ A T  N  SSRSH I  I L  +   +   IS 
Sbjct: 282 MGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGTSISS 341

Query: 310 -MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI------------ 356
            ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S             
Sbjct: 342 TLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSPNANG 398

Query: 357 --HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
             HIP+R+SKLTR+LQ +L G++    I TI   K +A ET +TL +A++AKN+
Sbjct: 399 NGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score =  141 bits (355), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 171/372 (45%), Gaps = 79/372 (21%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF        +++  ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 135 LSDSAGIIPRVLFRLFDTL--EATESDHL--VKCSYIELYNEELKDLLDDTPDYSKRLRI 190
           L    G+IP  +  LF  +  ++   D    V  SY+E+YNE + DLL+           
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLE----------- 263

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS--AIY 248
                           S  E+ G+  S   R Y    +K     L  +L     S   + 
Sbjct: 264 ----------------SGLEESGSRISTPSRLYM---SKSNSNGLGVELKIRDDSQYGVK 304

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRI 307
           +  L E    ++ E +  +  G K R++  T  N  SSRSH I  I L  +  +    R 
Sbjct: 305 VIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTSRS 364

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------------ 354
           S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK            
Sbjct: 365 STLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPS 421

Query: 355 ------------------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETS 396
                             S HIP+R+SKLTRLLQ +L G++    I T+      A ET 
Sbjct: 422 ASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETM 481

Query: 397 STLEYATKAKNI 408
           +TL +A++AKN+
Sbjct: 482 NTLRFASRAKNV 493

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  141 bits (355), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 166/350 (47%), Gaps = 60/350 (17%)

Query: 68  GKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 127
           G+  S  +  D++F P      +F+ I + L    + GYN  +  YG T +GKTYTM   
Sbjct: 410 GRCFSYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM--- 465

Query: 128 EKLYDGELSDSAGIIPRVLFRLFDTLEATESD---HLVKCSYIELYNEELKDLLDDTPDY 184
                  L+   G+IP  L  +F   E        + + C YIE+YNE + DLL      
Sbjct: 466 -------LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL------ 512

Query: 185 SKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQS 244
               R F+SN   +    SQ +               R+ H                  +
Sbjct: 513 ----REFNSNDNIDDILESQKHEI-------------RHDH-----------------DN 538

Query: 245 SAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKSYEG 302
            A  I N+ +  +T+  +  S+L++  + R  A T+ N+ SSRSH++F + +  +    G
Sbjct: 539 HATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTG 598

Query: 303 ELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSLADKSIHIP 359
           E+    K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI   NS      HIP
Sbjct: 599 EVSH-GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIP 657

Query: 360 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
           FR SKLT LLQ SL G++KT +   I   + + +ET ++L +A+K  + K
Sbjct: 658 FRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  140 bits (354), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 170/352 (48%), Gaps = 69/352 (19%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF      + +++ +  P+ D   +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 135 LSDSAGIIPRVLFRLFDTLEATESD----HLVKCSYIELYNEELKDLLDDTPDYSKRLRI 190
                G+IP+ +  +FD + +        + VK SY+E+YNE++ DLL+    Y  R   
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN----YVDR--- 250

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQ 250
                    +AGS                         +P R +   ++  +    + + 
Sbjct: 251 ---------QAGSTG-----------------------QPSRNATGLKIRDDSKYGVKVV 278

Query: 251 NLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKSYEGELFRIS 308
           +L E  +++  + +  +  G ++R+   T  N  SSRSH I  + L  Y    G     S
Sbjct: 279 DLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGS-EATS 337

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------------DKSI 356
            ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+              + 
Sbjct: 338 TLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQPSPAAG 394

Query: 357 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
           HIP+R+SKLTR+LQ +L G++    I TI     ++ ET++T+ +A++AKNI
Sbjct: 395 HIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNI 446

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 109/343 (31%), Positives = 165/343 (48%), Gaps = 62/343 (18%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F P      IF+ I + L    + GYN  +  YG T +GKTYTM          
Sbjct: 413 FKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 461

Query: 135 LSDSAGIIPRVL---FRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
           L    G+IP  L   F+    L+    ++ +   +IE+YNE + DLL             
Sbjct: 462 LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL------------- 508

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                     G  N++   +D T S   + R+                  ++S   ++ N
Sbjct: 509 ---------RGLNNDT---EDITESLKHEIRHD-----------------QESQTTHVTN 539

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKSYEGELFRISK 309
           +    +T+     ++L++  K R  A+T  N+ SSRSH++F I L  Y S  GE  +   
Sbjct: 540 VTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GT 598

Query: 310 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLT 366
           +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++LA       HIPFR SKLT
Sbjct: 599 LNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLT 658

Query: 367 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
            LLQ SL G++KT +   ISP   + +ET ++L +A+K  + +
Sbjct: 659 YLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKVNSTR 701

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  139 bits (350), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 113/372 (30%), Positives = 168/372 (45%), Gaps = 79/372 (21%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF        +++   +P+ D  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 135 LSDSAGIIPRVLFRLFDTL--EATESDHL--VKCSYIELYNEELKDLLDDTPDYSKRLRI 190
           L    G+IP  +  LF  +  ++ + D    V  SY+E+YNE + DLL+           
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLE----------- 263

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS--AIY 248
                           S  E+ G+      R Y     K    ++  +L     S   + 
Sbjct: 264 ----------------SGLEESGSRPGTPSRSYMG---KSNSNAMGVELKIRDDSKYGVK 304

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRI 307
           +  L E    +  E +  +  G K R++  T  N  SSRSH I  I L  +       R 
Sbjct: 305 VIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDVNNGTSRS 364

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADKSI---------- 356
           S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK+           
Sbjct: 365 STLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNISTTP 421

Query: 357 --------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETS 396
                               HIP+R+SKLTRLLQ +L G++    I T+      A ET 
Sbjct: 422 TGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETM 481

Query: 397 STLEYATKAKNI 408
           +TL +A++AKN+
Sbjct: 482 NTLRFASRAKNV 493

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  138 bits (348), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 108/345 (31%), Positives = 162/345 (46%), Gaps = 75/345 (21%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F      + +FK + + L    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 135 LSDSAGIIPRVL---FRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
           L+   GIIP  +   F   + L+    D+ V C +IE+YNE + DLL +           
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRN----------- 533

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                       +NN    +D T++++ K    H                +++    I N
Sbjct: 534 ------------ENN----KDDTNTNL-KHEIRH---------------DQETKTTMITN 561

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--------YKSYEGE 303
           +    + +      VL++  K R  AST  N+ SSRSH+IF I L         +SY   
Sbjct: 562 VTSCKLESEEMVDRVLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSY--- 618

Query: 304 LFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPF 360
                 +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L        HIPF
Sbjct: 619 ----GTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPF 674

Query: 361 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKA 405
           R SKLT LLQ SL G++KT +   ISP+  + +ET ++L +A+K 
Sbjct: 675 RNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 719

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  138 bits (347), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 112/348 (32%), Positives = 168/348 (48%), Gaps = 67/348 (19%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F        +F+ I + L    + GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 135 LSDSAGIIPRVLFRLFD---TLEATESDHLVKCSYIELYNEELKDLL--DDTPDYSKRLR 189
           L+ + GIIP  +  +F+    L+     + V C ++E+YNE + DLL  ++ P       
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLLRREEKP------- 504

Query: 190 IFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYI 249
                      AGS +      D  S++  + R+                  +++    I
Sbjct: 505 -----------AGSASGD----DTNSNTKLEIRHN-----------------QETKETTI 532

Query: 250 QNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISK 309
            N+    +T+      +L++  K R  AST  N+ SSRSH+IF + L     GE     +
Sbjct: 533 TNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSRSHSIFIVHL----SGENVLTGE 588

Query: 310 -----MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL--ADKSI-HIPFR 361
                +NLVDLAGSE I+ S    +R +E  SIN+SL  LG VI++L  AD S  HIPFR
Sbjct: 589 RSHGILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFR 648

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
            SKLT LLQ SL GN+KT +   IS    + +ET ++L +A+K  + K
Sbjct: 649 NSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  137 bits (346), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 125/400 (31%), Positives = 184/400 (46%), Gaps = 77/400 (19%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVV-TVPDVTGSNEVSINTTGDIGIAGKMNSRT--YTVD 78
           NI V  R R   E E  + S++ +    D TG   ++I          K +S+   +T D
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEIEKFSDETGMQSITI----------KRDSKQHKFTFD 412

Query: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138
           + F        +F  I + L    + GYN  +  YG T +GKT+TM          L+ +
Sbjct: 413 RCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPN 461

Query: 139 AGIIPRVLFRLFDTLEATESDHLV---KCSYIELYNEELKDLLDDTPDYSKRLRIFDSNT 195
            GIIP  L  +F  +E  +    V      ++E+YNE +KDL  +               
Sbjct: 462 DGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKE--------------- 506

Query: 196 ITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQEF 255
                    N++  +  G S     R                     +S   +I N+   
Sbjct: 507 ---------NDADVDDTGESLKFEIRHDN------------------ESRTTHITNITVC 539

Query: 256 HITNAREGIS-VLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKSYEGELFRISKMNL 312
            +T +RE ++ +L++ LK R  A+T  N  SSRSH++F I L  Y +  GE      +NL
Sbjct: 540 KLT-SREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK-STGTLNL 597

Query: 313 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL--ADKSI-HIPFRESKLTRLL 369
           VDLAGSE I     Q +R +E  +IN+SL  LG VI++L  AD S  HIPFR SKLT LL
Sbjct: 598 VDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLL 657

Query: 370 QDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
           Q SL G++KT +   +SP   +  ET ++L +A K  + K
Sbjct: 658 QYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  137 bits (344), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 168/370 (45%), Gaps = 75/370 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF        I++ I  P+ D   +G+N T+  YGMT +GKTYTM G       E
Sbjct: 137 FKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----E 191

Query: 135 LSDSAGIIPRVLFRLF-----DTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLR 189
                G+IP  +  LF     +TL+  +   +V  SY+E+YNE++ DLL D  + +    
Sbjct: 192 REQKDGLIPLSVSYLFTKIMEETLDGDKKFEIV-LSYLEIYNEKIYDLLGDENNNNNNNN 250

Query: 190 ---IFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSA 246
               F + T  N+    QN      D         +Y                       
Sbjct: 251 GTLAFGTPTRNNNNICFQNELKIRDDS--------KY----------------------G 280

Query: 247 IYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFR 306
           + +  L E    ++ E ++ + KG K R+ A T  N  SSRSH I  I L  S   +   
Sbjct: 281 VRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDMKDGTS 340

Query: 307 ISK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---------- 355
           IS  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S          
Sbjct: 341 ISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTLPS 397

Query: 356 -----------------IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSST 398
                             HIP+R+SKLTRLLQ +L G++    I TI     ++ ET +T
Sbjct: 398 PPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLNT 457

Query: 399 LEYATKAKNI 408
           L +A++AKNI
Sbjct: 458 LRFASRAKNI 467

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  137 bits (344), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 112/344 (32%), Positives = 168/344 (48%), Gaps = 63/344 (18%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F      K +F  I + L    + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 135 LSDSAGIIPRVLFRLFD---TLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
           L+ + G+IP  +  +FD   +L+    ++ V C ++E+YNE + DLL +  + S  L   
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLRE--ETSAEL--- 500

Query: 192 DSNTITNS-RAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQ 250
             + ITN+ R   +++S K            R T I       ++   +L  + S  ++ 
Sbjct: 501 --DEITNNGRHDIRHDSDK------------RITTIT------NIKTSILKSKDSVDFL- 539

Query: 251 NLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS--YEGELFRIS 308
                           ++K  K R  A+T  N+ SSRSH+IF I L  S    GE     
Sbjct: 540 ----------------IKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGE-SSYG 582

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKL 365
            +NLVDLAGSE ++ S  +  R +E  +IN+SL  LG VI++L        HIPFR SKL
Sbjct: 583 ILNLVDLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKL 642

Query: 366 TRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
           T LLQ SL GN+KT +   ISP +    ET ++L +A+K    K
Sbjct: 643 TYLLQYSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  137 bits (344), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 103/341 (30%), Positives = 168/341 (49%), Gaps = 58/341 (17%)

Query: 72  SRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
           S  +  D++F      + +F  + E L    + G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 132 DGELSDSAGIIPRVLFRLFD---TLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRL 188
              L++  GIIP  L  + D   +++     + +K  ++E+YN+ + DLL+D     K  
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLNDGKGKHKEC 513

Query: 189 RIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIY 248
            +                               R+  I    +R  L   +  E      
Sbjct: 514 EV-------------------------------RHDDIG---RRTELTNVITRE------ 533

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRIS 308
            Q  ++   +N RE   ++Q+  K R+ A T MN+ SSRSH++F + +    +    R  
Sbjct: 534 FQLEEDLIESNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCK 593

Query: 309 K-MNLVDLAGSENISRSG-AQNQRAKEAGSINQSLLTLGRVINSL--ADKSIHIPFRESK 364
             +NLVDLAGSE ++RSG    +R +E   IN+SL ++G VI++L     S+HIPFR +K
Sbjct: 594 GVLNLVDLAGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTK 653

Query: 365 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKA 405
           LT LL+ SL G++KT ++ T+SP+  + +ET ++L +ATK 
Sbjct: 654 LTYLLKHSLQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 101/347 (29%), Positives = 163/347 (46%), Gaps = 52/347 (14%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF P ++   +++ I +P+ D   +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT------- 191

Query: 135 LSDSAGIIPRVLFRLFDTLEA---TESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
             + AG+I   +  +F  + +         V  SY+E+YNE++ DLL+ +   S      
Sbjct: 192 -PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLNQSSLKSPGGGSG 250

Query: 192 DSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQN 251
                 +S+       P    GT           +P +            +    + +  
Sbjct: 251 GGYGSFSSK-------PTHAAGT----------ELPVRD-----------DSKHGVRVMG 282

Query: 252 LQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRISKM 310
           L E  + ++ + +  +  G  +R+   T  N  SSRSH I T+ L  +         S +
Sbjct: 283 LTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDLVSGAETTSTL 342

Query: 311 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH---------IPFR 361
           +L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+  S+H         IP+R
Sbjct: 343 SLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSFGNSHIPYR 399

Query: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
           +SKLTR+LQ +L G +    I TI        ET +T+ +A++AKN+
Sbjct: 400 DSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNV 446

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 114/378 (30%), Positives = 170/378 (44%), Gaps = 85/378 (22%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF        +++  ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 135 LSDSAGIIPRVLFRLFDTL--EATESDHL--VKCSYIELYNEELKDLLDDTPDYSKRLRI 190
           L    G+IP  +  LF  +  ++   D    V  SY+E+YNE + DLL+           
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLE----------- 263

Query: 191 FDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSS--AIY 248
                           S  E+ G+      R Y    +K    +L  +L     S   + 
Sbjct: 264 ----------------SGLEESGSRLGTPSRSYM---SKNNSNALGVELKIRDDSQYGVK 304

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRI 307
           +  L E    ++ + +  +  G K R++  T  N  SSRSH I  I L  +       R 
Sbjct: 305 VIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDVRDGTSRS 364

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------------ 354
           S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK            
Sbjct: 365 STLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGSIIPTTP 421

Query: 355 ------------------------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 390
                                   S HIP+R+SKLTRLLQ +L G++    I T+     
Sbjct: 422 TSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRND 481

Query: 391 NADETSSTLEYATKAKNI 408
            A ET +TL +A++AKN+
Sbjct: 482 AAAETMNTLRFASRAKNV 499

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 118/395 (29%), Positives = 183/395 (46%), Gaps = 73/395 (18%)

Query: 22  NITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVDQVF 81
           NI V  R R   E E++  S + V       SN  + N +  I I+ +  +  +  D+VF
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHV-------SNFDNRNGSQAIEISNEDRNSRFLFDKVF 410

Query: 82  GPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDSAGI 141
             +A  + +F+ + + L    + GYN  +  YG T +GKTYTM          ++D  G+
Sbjct: 411 SSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDGV 459

Query: 142 IPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFDSNTITNSRA 201
           IP  L            DH+   +++      LK+   D    ++ + I++   +   R+
Sbjct: 460 IPMTL------------DHIFDWTHL------LKERGWDYSFEAQFIEIYNEQIVDLLRS 501

Query: 202 GSQNNSPKE----QDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQEFHI 257
            +    P +     DG S   +    T I  +                            
Sbjct: 502 LNPEPGPTKYEIRHDGDSQRTSITNVTSIKLE---------------------------- 533

Query: 258 TNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY--KSYEGELFRISKMNLVDL 315
           T AR   +VL+   K + +A+T  N+ SSRSH++FTI ++   S  GE      +NLVDL
Sbjct: 534 TRARVN-TVLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD-GVLNLVDL 591

Query: 316 AGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI-HIPFRESKLTRLLQDSLG 374
           AGSE I  S     R +E  +IN+SL  LG VI +L  K + HIPFR SKLT LLQ SL 
Sbjct: 592 AGSERIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLI 651

Query: 375 GNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
           G++KT +   +SP+  +  ET ++L +A+K  + K
Sbjct: 652 GDSKTLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  129 bits (324), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 108/170 (63%), Gaps = 5/170 (2%)

Query: 248 YIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRI 307
           ++Q++  F +    E +  L  G   R VAST+MN  SSRSH IFT+ + +       R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 308 SKMNLVDLAGSENISRS-GAQN-QRAKEAGSINQSLLTLGRVINSLADKSIH-IPFRESK 364
           S + LVDLAGSE  + + G  N +R KE  +IN+SL TLGR I+ LA  S H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 365 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQL 414
           LT +L+++LGGN+KT +IA ISP  I+ +E+ STL YAT AK IK R  +
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATM 316

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 61/118 (51%), Gaps = 12/118 (10%)

Query: 73  RTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 132
           R++  D +F  S+ Q  I   +        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 133 GELSDSAGIIPRVLFRLFDTLEATESD-HLVKCSYIELYNEELKDLLDDTPDYSKRLR 189
              + + GIIP +   LFD LE  ++    V  +Y E+YNE+L DLL DT   S R+R
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGDT---SPRVR 141

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score =  130 bits (326), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 113/377 (29%), Positives = 170/377 (45%), Gaps = 89/377 (23%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VF        +++  ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 135 LSDSAGIIPRVLFRLF-DTLEAT---ESDHLVKCSYIELYNEELKDLLDDT-------PD 183
           L    G+IP  +  LF + +E +   +    V  SY+E+YNE + DLL+         P 
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSRPS 274

Query: 184 YSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQ 243
              RL +   N+                +G S+ +  R  T                   
Sbjct: 275 TPSRLYMGKGNS----------------NGLSAELKIRDDTQY----------------- 301

Query: 244 SSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEG 302
              + +  L E    ++ E +  +  G K R++  T  N  SSRSH I  I L  +  E 
Sbjct: 302 --GVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDLES 359

Query: 303 ELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------S 355
              R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK      +
Sbjct: 360 GTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTGSN 416

Query: 356 IHIP------------------------FRESKLTRLLQDSLGGNTKTALIATISPAKIN 391
           IH                          +R+SKLTRLLQ +L G++    I T+      
Sbjct: 417 IHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDA 476

Query: 392 ADETSSTLEYATKAKNI 408
           A ET +TL +A++AKN+
Sbjct: 477 AAETINTLRFASRAKNV 493

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score =  126 bits (317), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 152/350 (43%), Gaps = 75/350 (21%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D VFGP+A  + +F  +   L +    G N T+L YG T +GKTYTM G     DG 
Sbjct: 127 FQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGHN---DGI 183

Query: 135 LSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFDSN 194
           +         V  R+ +  +  +    V  SY+E+YNE++ DLL+               
Sbjct: 184 VKMCGDC---VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLN--------------- 225

Query: 195 TITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQE 254
             +N R    N   K +D                    P L           + +  + E
Sbjct: 226 --SNCR----NEELKVRDD-------------------PVL----------GVKVHGVLE 250

Query: 255 FHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRISKMNLV 313
                A E +  +  G   R+   T  N  SSRSH I  + L  +         + ++L 
Sbjct: 251 QKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGTTHFNTLSLC 310

Query: 314 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---------------IHI 358
           DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +S                HI
Sbjct: 311 DLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRPSSGSLNNSHI 367

Query: 359 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
           P+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++AKN+
Sbjct: 368 PYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 188/445 (42%), Gaps = 99/445 (22%)

Query: 66  IAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMT 125
           +AG+ N + + VDQ+F P A  K    +I          GYN  ++ YG T +GKT TM 
Sbjct: 63  LAGQ-NLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMF 121

Query: 126 GDEKLYDGELSDSAGIIPRVLFRLFDTLEATES---DHLVKCSYIELYNEELKDLLDDTP 182
           G  K          G+I  V  ++F T+E       D+ +  S IE+  E ++DLL    
Sbjct: 122 GYNK--------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL---- 169

Query: 183 DYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYE 242
                                                       P   ++P   K  L  
Sbjct: 170 -------------------------------------------APLSEQKPL--KLRLDS 184

Query: 243 QSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML-YKSYE 301
           + S+I I+NL+  ++T+  E +S  +KG   R +AS       SRS  I  I +  +   
Sbjct: 185 KKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNV 234

Query: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKSI--- 356
            E+F+     LVDL  S+ I +        +    INQS++TL  V  SLA  ++S+   
Sbjct: 235 KEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNG 294

Query: 357 -------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIK 409
                  +IP++ES LT+LLQ+++GGN KT L+   S AK + +ET +TL +    K +K
Sbjct: 295 RPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVK 354

Query: 410 NRPQLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQ 469
           N         ++               DF    AKE  Y SH      +  LE     ++
Sbjct: 355 N------LFQQNKAGTNSKAMLDLLMKDF---DAKEKNYQSH------IQLLEKELMNLK 399

Query: 470 ESKRQVESFSSQNSLLLKDKKASQQ 494
           + +   E+   QN ++L++KK   Q
Sbjct: 400 KLQYGSETADKQNEIMLENKKLKAQ 424

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score =  115 bits (287), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 94/327 (28%), Positives = 149/327 (45%), Gaps = 73/327 (22%)

Query: 90  IFKNIAEPLFD----DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRV 145
           IF    +PL      D I G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQ-- 168

Query: 146 LFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFDSNTITNSRAGSQN 205
              + D L     +  +  SY+E+YNE L DLL    D +K LRI D +     R     
Sbjct: 169 -LSIRDLLTQLSKNCQITISYLEIYNERLHDLL---CDGTKELRILDDSAPIACRLHGLK 224

Query: 206 NSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGIS 265
            +    D +  S+++                                           + 
Sbjct: 225 ETTITLDDSEQSVSRV------------------------------------------LE 242

Query: 266 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSG 325
           ++ +G ++R+V ST+ N  SSRSH +  + +  S  G   R+  + L DLAGSE   R+ 
Sbjct: 243 LVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSM-GSKARV--LTLCDLAGSE---RAS 296

Query: 326 AQNQRAK-EAGSINQSLLTLG---RVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTAL 381
             ++  + E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN    +
Sbjct: 297 VHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLVTM 356

Query: 382 IATISPAKINADETSSTLEYATKAKNI 408
           + T+S +  + +++  TL +A +A  +
Sbjct: 357 VCTVSLSGTDYEQSLGTLRFARRASGV 383

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/340 (27%), Positives = 152/340 (44%), Gaps = 63/340 (18%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +T D++FG   D   +F +I + L    + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 135 LSDSAGIIPRVL---FRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIF 191
           L++  GII + +         L     ++ ++  +IE+YNE ++DLL+    +   +R  
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLNPEAKHQHVIRHD 492

Query: 192 D---SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIY 248
           D   +  +TN+   +   +  E D  + S   R+                          
Sbjct: 493 DKKGTTEVTNTHKITIKLTHNEDDEIAKSAQIRQ-------------------------- 526

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE-GELFRI 307
                            +++ G   R   ST MN+ SSRSH++F + +       +    
Sbjct: 527 -----------------LIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHST 569

Query: 308 SKMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKL 365
            ++NLVDLAGSE + +       +  KE  SIN+SL  L  VI+S+  +  +IPFR SKL
Sbjct: 570 GRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKL 629

Query: 366 TRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKA 405
           T LL++SL   +KT +   ISP   +  ET ++L  A K 
Sbjct: 630 TYLLKNSLINKSKTLMYVNISPNINSIRETINSLRLARKV 669

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 90/148 (60%), Gaps = 4/148 (2%)

Query: 266 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KSYEGELFRISKMNLVDLAGSENISRS 324
           VL +  K R  ASTK N+ SSRSH+IF I L+ K+ +        +NLVDLAGSE I+ S
Sbjct: 555 VLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGILNLVDLAGSERINSS 614

Query: 325 GAQNQRAKEAGSINQSLLTLGRVI---NSLADKSIHIPFRESKLTRLLQDSLGGNTKTAL 381
               +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+KT +
Sbjct: 615 QVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTLM 674

Query: 382 IATISPAKINADETSSTLEYATKAKNIK 409
              IS +  + +ET ++L +A+K  + K
Sbjct: 675 FVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (48%), Gaps = 14/121 (11%)

Query: 61  TGDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGK 120
           T  + I    N+  Y  D++F        IFK + + L    + GYN  +  YG T +GK
Sbjct: 407 TQTMEITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGK 465

Query: 121 TYTMTGDEKLYDGELSDSAGIIP---RVLFRLFDTLEATESDHLVKCSYIELYNEELKDL 177
           T+TM          L+ S GIIP   R +F   D L+    ++ + C ++E+YNE + DL
Sbjct: 466 TFTM----------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDL 515

Query: 178 L 178
           L
Sbjct: 516 L 516

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 131/533 (24%), Positives = 239/533 (44%), Gaps = 118/533 (22%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           Y  D+VF  S D  +  +   E   +  ++GYN +++ YG + TGK++ + G+++     
Sbjct: 73  YKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQQ----- 126

Query: 135 LSDSAGIIPRVLFRLFDTLEATESD------HLVKCSYIELYNEELKDLLDDTPDYSKRL 188
                G+I ++L +LF+ ++    +      + VK S++E+Y E++ DL+D +P   K L
Sbjct: 127 ----DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLMD-SPSVKKHL 181

Query: 189 RIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIY 248
           +I DS   T +  G Q             +   R T + T                    
Sbjct: 182 KINDS---TYAMNGFQ-------------VENLRTTQVLT-------------------- 205

Query: 249 IQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE-GELFRI 307
              L+E  I      I +L +  +H        N+   RSHTI  + + K  +  E   +
Sbjct: 206 ---LEELKIL---INICLLNQKERH--------NNLIQRSHTIMEVSIEKRNKLDESITM 251

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----------DKS-- 355
           S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L           D S  
Sbjct: 252 SSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTDISTL 311

Query: 356 IH-IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQL 414
           +H +P++ S LTRLL D LGGN KT  + T S  K + +ET STL++    K+    P++
Sbjct: 312 MHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANTNPRI 371

Query: 415 GSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQ 474
             F                     L++KA   I+++    +E     +N+ +       Q
Sbjct: 372 NRFG--------------------LNSKATMDIFLTDMKLKE-----DNFISITNNLTNQ 406

Query: 475 VESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIER-QHRNEIDLVSTIHK 533
           V +  +Q + L  + K ++     ++  I  L++ +E L + +    +R+++DL +  ++
Sbjct: 407 VNNLMTQANSLEDELKNNETKYNKKETNI--LKSQVETLTELLNNPNNRSQVDLRNQ-NE 463

Query: 534 LKEALHTMKGSLQNYETHELRLQNDIKEVL--------YQGITSYRESMDQHL 578
             E L  +    ++  + EL L + +KE+L        Y+   +  E+M+QHL
Sbjct: 464 NTEILTKLLEKCEHNASLELSLDDKMKEILILRRRESEYKARIASTETMNQHL 516

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 4/144 (2%)

Query: 266 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS-YEGELFRISKMNLVDLAGSENISRS 324
           +L+K  K R  AST  N+ SSRSH+IF I L  S  +        +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 325 GAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTAL 381
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 382 IATISPAKINADETSSTLEYATKA 405
              ISP+  + +ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 52/107 (48%), Gaps = 14/107 (13%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  D++F        +FK + + L    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 135 LSDSAGIIPRV---LFRLFDTLEATESDHLVKCSYIELYNEELKDLL 178
           L+   GIIP     +F   + L+    D+ V C +IE+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 90/149 (60%), Gaps = 6/149 (4%)

Query: 266 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKS--YEGELFRISKMNLVDLAGSENISR 323
           +L+K  + R  AST  N+ SSRSH++F I L  S    GE      +NLVDLAGSE I+ 
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQ-SDGILNLVDLAGSERINS 624

Query: 324 SGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTA 380
           S    +R +E  +IN+SL  LG V+++L        HIPFR SKLT LLQ SL GN+KT 
Sbjct: 625 SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTL 684

Query: 381 LIATISPAKINADETSSTLEYATKAKNIK 409
           +   IS  + + +ET ++L +A+K  + K
Sbjct: 685 MFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 79/171 (46%), Gaps = 20/171 (11%)

Query: 19  EELNITVAVRCRGRNEREIKAKSAVVVTV---PDVTGSNEVSINTTGDIGIAGKMNSRTY 75
           +EL   + V CR R   + +  +   +TV    D  G   + I  + + G +   N   +
Sbjct: 372 QELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---F 428

Query: 76  TVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGEL 135
             D++F  +   + +F+ I + L    + GYN  +  YG T +GKTYTM          L
Sbjct: 429 KFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------L 477

Query: 136 SDSAGIIPRVLFRLFDTLEATES---DHLVKCSYIELYNEELKDLLDDTPD 183
           +   GIIP  +  +F  +E  +    ++ + C +IE+YNE + DLL    D
Sbjct: 478 NPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQD 528

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 105/368 (28%), Positives = 160/368 (43%), Gaps = 81/368 (22%)

Query: 59  NTTGDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTST 118
           NTTGD          T+  D+VF  +A QK +   + +P  +D + GYN T+L YG + +
Sbjct: 67  NTTGDT-------HSTFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 119 GKTYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTLEATE----SDHLVKCSYIELYNEEL 174
           GK+Y++ G +        D  GI+P +   LF TLE  E    ++  V     E+Y E+ 
Sbjct: 120 GKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKT 171

Query: 175 KDLLDDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPS 234
            DLL   P+  K L++  S                     SS+M       +  K  RP+
Sbjct: 172 YDLLVPLPER-KPLKLHRS---------------------SSTM------DLEIKDIRPA 203

Query: 235 LNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTI 294
                   +S   YIQ++Q       R G S    G   R           SRSH +F +
Sbjct: 204 HVNSFEDLKS---YIQSVQN---PANRMGYS----GKAER-----------SRSHVVFQL 242

Query: 295 ML-YKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 353
            +  ++   ++ + S + L+DL G+E   +             +NQS+  L   + SL  
Sbjct: 243 HVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEALKNTVQSLEI 302

Query: 354 KSI----------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAT 403
           KS+             +RES+LT +L+DSLGGN KT +I T   +  N   T STL++  
Sbjct: 303 KSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPTTLSTLKFGD 360

Query: 404 KAKNIKNR 411
             + I NR
Sbjct: 361 SIRQINNR 368

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/367 (23%), Positives = 158/367 (43%), Gaps = 75/367 (20%)

Query: 74  TYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           ++    +F   ++  LI   I   + D+ ++GYN  ++ YG   +GKTY+      LY  
Sbjct: 83  SFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGN 136

Query: 134 ELSDSAGIIPRVLFRLFDTLEATESD------HLVKCSYIELYNEELKDLLDDTPDYSKR 187
           ++ DS G+   +   LF  +  + +D       +VK S++E++ +++ DLL         
Sbjct: 137 DVDDSFGLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL--------- 187

Query: 188 LRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAI 247
                                          A +  T +P    R          +   +
Sbjct: 188 -------------------------------APQNLTKLPHLKIRH-------VSEHKGL 209

Query: 248 YIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE-GELFR 306
            + NL++ H+ + +E +    + +    V ++K ++   R++TIF I + K  +  E   
Sbjct: 210 PVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDESTT 266

Query: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH--------- 357
            S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+  S           
Sbjct: 267 SSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEFSL 326

Query: 358 ---IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQL 414
              +P+  SKL +LL++ LGGN KT  + TIS      D+    L+  T  ++ K  PQ+
Sbjct: 327 ENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVPQI 386

Query: 415 GSFMMKD 421
             F + +
Sbjct: 387 NKFGLNE 393

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 97/353 (27%), Positives = 151/353 (42%), Gaps = 74/353 (20%)

Query: 74  TYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           T+  D+VF  +A QK +   +  P   D + GYN T+L YG + +GK+Y++ G +  Y+ 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 134 ELSDSAGIIPRVLFRLFDTLEATE----SDHLVKCSYIELYNEELKDLLDDTPDYSKRLR 189
                 G++P +   LF+TLE  E    ++  V     E+Y E+  DLL   P+  K L+
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLLVPLPER-KPLK 184

Query: 190 IFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYI 249
           +  S                     SS M        P   K         YE     Y+
Sbjct: 185 LHRS---------------------SSKMDLEIKDICPAHIKS--------YEDLRG-YV 214

Query: 250 QNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGE-LFRIS 308
           Q++Q    T  R G     +G K  +          S+SH +F + + +    E + + S
Sbjct: 215 QSVQN---TENRVG-----RGGKAER----------SKSHLVFQLHVEQRNRREDILKNS 256

Query: 309 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----------SIHI 358
            + L+DL G+E   +             +NQS+  L  ++  LA K          S   
Sbjct: 257 SLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEALKNIVQLLAVKNPDSAYSTKASHSS 316

Query: 359 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNR 411
            +RES+LT +L+DSLGGN K  +I T   +  N   T STLE+    + I N+
Sbjct: 317 TYRESQLTEVLRDSLGGNRKMKVILTCFLS--NVPTTISTLEFGDNIRQIINK 367

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 162/374 (43%), Gaps = 81/374 (21%)

Query: 53  SNEVSINTTGDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLV 112
           ++E S  TTGD          T+  D+VF  +A Q+ +   +  P  DD + GYN T++ 
Sbjct: 60  TSEPSHETTGD-------TYSTFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIIT 112

Query: 113 YGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTLEATE----SDHLVKCSYIE 168
           YG + +GK+Y++ G +   +GE     GI+P +   LF+TLE  +    ++  V     E
Sbjct: 113 YGPSFSGKSYSLLGSQ---EGE-----GILPNICKVLFETLEKNKETKGNNFSVSVLAFE 164

Query: 169 LYNEELKDLLDDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPT 228
           ++ E+  DLL   P             +TN +    + S  + D     +      HI +
Sbjct: 165 IFMEKTYDLL--VP-------------LTNRKPLKLHRSSSKMDLEIKDICP---AHIRS 206

Query: 229 KPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRS 288
                S             YIQ++Q    T+ R G S                N   S+S
Sbjct: 207 YKDLKS-------------YIQSVQN---TDNRMGYS---------------GNTERSKS 235

Query: 289 HTIFTIML-YKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV 347
           H +F + +  ++   ++ R S + L+DL G+E   +             +NQS+  L  +
Sbjct: 236 HLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEALKNI 295

Query: 348 INSLADK----------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSS 397
           +  L+ K          S    +RES+LT +L+DSLGGN KT +I T   +  N   T S
Sbjct: 296 VRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVSTTLS 353

Query: 398 TLEYATKAKNIKNR 411
           TLE+    + I N+
Sbjct: 354 TLEFGECIRQITNK 367

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 119/298 (39%), Gaps = 63/298 (21%)

Query: 11  RTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKM 70
           R  L +  +EL   + V CR R   + + + +  +++   +  N      T  I I  + 
Sbjct: 349 RRKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDEN-----GTQCITIKREA 403

Query: 71  NSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
               +T D+ FG     K IF  I + L    + GYN  +  YG T +GKTYTM      
Sbjct: 404 KYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------ 456

Query: 131 YDGELSDSAGIIPRVLFRLF---DTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKR 187
               L+   GIIP  L  +F   + L+     + +   +IE+YNE +KDL  D       
Sbjct: 457 ----LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD------- 505

Query: 188 LRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAI 247
                             +  +  DG+ +   + R+                    S   
Sbjct: 506 ------------------HDTENDDGSEALKHEIRHD-----------------SDSQTT 530

Query: 248 YIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKSYEGE 303
           +I N+    +TN     S+L + +K R  A+T  N  SSRSH++F I L  Y +  GE
Sbjct: 531 HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 119/298 (39%), Gaps = 63/298 (21%)

Query: 11  RTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKM 70
           R  L +  +EL   + V CR R   + + + +  +++   +  N      T  I I  + 
Sbjct: 349 RRKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDEN-----GTQCITIKREA 403

Query: 71  NSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
               +T D+ FG     K IF  I + L    + GYN  +  YG T +GKTYTM      
Sbjct: 404 KYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------ 456

Query: 131 YDGELSDSAGIIPRVLFRLF---DTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKR 187
               L+   GIIP  L  +F   + L+     + +   +IE+YNE +KDL  D       
Sbjct: 457 ----LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD------- 505

Query: 188 LRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAI 247
                             +  +  DG+ +   + R+                    S   
Sbjct: 506 ------------------HDTENDDGSEALKHEIRHD-----------------SDSQTT 530

Query: 248 YIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKSYEGE 303
           +I N+    +TN     S+L + +K R  A+T  N  SSRSH++F I L  Y +  GE
Sbjct: 531 HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 68/134 (50%), Gaps = 12/134 (8%)

Query: 54  NEVSINTTGDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVY 113
           N V   T   +    K    T+  D+VF  +A Q+ + K +  P+ +D + GYN TV+ Y
Sbjct: 54  NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITY 113

Query: 114 GMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTLEA---TESDHL-VKCSYIEL 169
           G + +GK+Y++ G +        +S GI+P +   LFDTLE    T+ D   V     E+
Sbjct: 114 GPSFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEI 165

Query: 170 YNEELKDLLDDTPD 183
           Y E+  DLL   P+
Sbjct: 166 YMEKTYDLLVPLPE 179

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (49%), Gaps = 13/137 (9%)

Query: 286 SRSHTIFTIML-YKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 344
           SRSH +F + +  ++ + ++ + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 345 GRVINSL----------ADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADE 394
              + SL          A  S    +RES+LT +L+DSLGGN KT +I T   +  N   
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPT 350

Query: 395 TSSTLEYATKAKNIKNR 411
           T STLE+    + I N+
Sbjct: 351 TLSTLEFGDSIRQINNK 367

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/351 (21%), Positives = 141/351 (40%), Gaps = 92/351 (26%)

Query: 90  IFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFRL 149
           I K+++E +  D   GY+ +++ YG   +GK++T+ G+E        DS GII      +
Sbjct: 102 IHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE--------DSDGIIALTFQDI 153

Query: 150 FDTLEATESDHL----VKCSYIELYNEELKDLLDDTPDYSKRLRIFDSNTITNSRAGSQN 205
                  E D      ++ S +E+  E++ D+L    D                      
Sbjct: 154 IQKKRELEKDQNTIVNIQISALEISLEKVYDMLHSADDRK-------------------- 193

Query: 206 NSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGIS 265
                                P K    +    L Y++++  YI +++EF          
Sbjct: 194 ---------------------PLKSHHETKKFGLYYQEANNEYINSIKEFD--------R 224

Query: 266 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRI------SKMNLVDLAGSE 319
           V++    +++ +  KM+   S SH +    +      +L R+      S +   DL GS 
Sbjct: 225 VMKLIQDNKEASEKKMDSKRSTSHVVIRCSVE-----QLDRVHGTITSSNIMFADLCGSN 279

Query: 320 NISRSGAQNQRAKEAGSINQSLLTLGRVINS-----------LADKSI---------HIP 359
              +   Q    +    +N S+  L  V+NS           + +K +          +P
Sbjct: 280 RFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIENKLVPSVNSSDLQRVP 339

Query: 360 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKN 410
           +++S+LT L+Q++LGGN++T ++      K + +ET +TL +  + +NI N
Sbjct: 340 YKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGVQLQNILN 390

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 94/186 (50%), Gaps = 19/186 (10%)

Query: 227 PTKPKRP-SLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFS 285
           PTK K P  L +    + +S++ I+NL++ ++ +  E  S L +G  +R      M   +
Sbjct: 216 PTKDKTPLKLIRPNFKKNNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLT 270

Query: 286 SRSHTIFTIMLYKSY-EGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 344
           SRS+ +  I L + + E +L + S + L+D+A S+ I ++ +    AKEA  +N  + + 
Sbjct: 271 SRSNIVIKINLEQVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESF 330

Query: 345 GRVINSLADKSIHIPFRE-----------SKLTRLLQDSLGGNTKTALIATISPAKINAD 393
              IN LA+     P+ +           S L  ++   +GGN KT  I+TISP   N +
Sbjct: 331 TSYINLLAETGTS-PYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQN 389

Query: 394 ETSSTL 399
           ET  TL
Sbjct: 390 ETFITL 395

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 75  YTVDQVFGPSADQK-LIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
           + VD+VF     Q  L+  +I +    +   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 70/141 (49%), Gaps = 16/141 (11%)

Query: 48  PDVTGS----NEVSINTTGDIGIAGKM----NSRTYTVDQVFGPSADQKLIFKNIAEPLF 99
           PD  GS    +E S+       + G      + RT+++D+VF PSA Q  +   +  P+ 
Sbjct: 9   PDSEGSALDISETSVTFRSHASVGGSHGVDPHERTFSLDKVFPPSASQADVTAVLLGPIV 68

Query: 100 DDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFRLFDTLEATESD 159
           D+   G N  +   G + TGKT+TM G + +       S G++ R+L ++F  +   E  
Sbjct: 69  DNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-------SQGLLQRILTKVFQLMNENEGV 121

Query: 160 HL-VKCSYIELYNEELKDLLD 179
            +    S +EL N+++ DLL+
Sbjct: 122 TVQYSLSAVELVNDKVYDLLN 142

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 80/345 (23%), Positives = 140/345 (40%), Gaps = 70/345 (20%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           Y  D V   S +   ++  I   L ++  +GY+  V+ YG   TGK+    G +  Y+G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 135 LSDSAGIIPRVLFRLFDTLEATESD-HL-VKCSYIELYNEELKDLLDDTPDYSKRLRIFD 192
                G++   +  L+D +++  +D H  V  S IE++ E++ DLL              
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL-------------- 159

Query: 193 SNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNL 252
                                    +  RR    P K    +       +Q    Y ++L
Sbjct: 160 -------------------------VNDRR----PLKLHHET-------KQDDEYYFKDL 183

Query: 253 QEFHITNAREGISVLQKGLKHRQVASTKMNDF--SSRSHTIFTIML-YKSYEGELFRISK 309
               +T+  E I+ +     +R   S    ++   S+SH I  I +  ++   ++ +   
Sbjct: 184 HVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRNLNEDVVKRGS 243

Query: 310 MNLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKSIH----IPFRES 363
           ++  DLA  + I +    +    + E   +N    TL   I S+++ S +    IP++ S
Sbjct: 244 ISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSENPNAVIPYKNS 303

Query: 364 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNI 408
            LT+LL     GN KT +I T S  K N  ET  TL+   K ++I
Sbjct: 304 NLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESI 348

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/377 (21%), Positives = 165/377 (43%), Gaps = 100/377 (26%)

Query: 69  KMNSRTYTVDQVFGPSADQ-KLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 127
           K++S+ +  D +F  +++Q +++  +  + LFD    GYN + + YG +++GK+ T+   
Sbjct: 63  KLDSQDFKFDNIFPTNSEQNEMLTVSTIKDLFD----GYNQSFITYGKSNSGKSDTL--- 115

Query: 128 EKLYDGELSDSAGIIPRVLF-RLFDTLEATESDHL--------------VKCSYIELYN- 171
                   ++  G+I R+LF +LF  +++  +D+                  S +E+++ 
Sbjct: 116 -------FNEKDGLI-RLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLSMMEIFSS 167

Query: 172 EELKDLLD-----DTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHI 226
           E++ DLL      D P   K L++   + I N   G +                      
Sbjct: 168 EKIYDLLSNEYTKDNP-ILKSLKVHQHDIIENGIKGDK---------------------- 204

Query: 227 PTKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLK-HRQVASTKMNDFS 285
                                +++NL    I      +  LQK  K   Q +S  +N  +
Sbjct: 205 ---------------------HVKNLSHIQIA----SLDDLQKWFKIGCQRSSAIINAGT 239

Query: 286 SRSHTIFTIMLYKSY------EGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQ 339
           ++     +I++ K +      + +L+++S ++ +DL G +  ++   Q     E   +N 
Sbjct: 240 AKEKRSNSIIISKIHLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNT 298

Query: 340 SLLTLGRVINSLADKSIHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKINAD 393
            + +   +I +L+D    +P+     ++S L ++LQD +GGN+KT  I    SP+ I  +
Sbjct: 299 LMSSFQNLITTLSDPK-SLPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHE 357

Query: 394 ETSSTLEYATKAKNIKN 410
           E    L++A   K+IKN
Sbjct: 358 ELIEMLKFAMGLKSIKN 374

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (55%), Gaps = 5/133 (3%)

Query: 287 RSHTIFTIMLYKSYEGE-LFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 345
           RS TI  I L +  E E L   S +  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 346 RVINSLAD-KSIHIP---FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEY 401
            ++ +LA+ +SI I    +R S LTR+L D L GN KT LI + S  K +  ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 402 ATKAKNIKNRPQL 414
           ++ A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 71/174 (40%), Gaps = 52/174 (29%)

Query: 56  VSINTTGDIGIAGKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGM 115
           +++N++ + G  G  N   Y  D++F P      I   ++    +D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQ--YRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 116 TSTGKTYTMTGDEKLYDGELSD-------------------------------------- 137
           T TGKTYT+ G    ++   +D                                      
Sbjct: 99  TGTGKTYTLYG--TAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSIL 156

Query: 138 ---SAGIIPRV---LFRLFDTLEATESD--HLVKCSYIELYNEELKDLL--DDT 181
              + G+I +V   LF + D + A       LV  S++E+Y EE+ DLL  DDT
Sbjct: 157 QKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLLQHDDT 210

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDG 133
           Y  D +F   + +   + +I + L DD  KGYN T++ YG TS+GK++ + GD +   DG
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 134 ELSDSAGIIPRVLF-RLFDTLEATESDHLVKCSYIELYNEELKDLL 178
            ++    I  R+LF +  D L+      L   S  ELY +++ DLL
Sbjct: 146 LIN---HIADRLLFPQCEDNLKT-----LCSISMWELYIDKVYDLL 183

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 82/171 (47%), Gaps = 14/171 (8%)

Query: 248 YIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRI 307
           +I++L + H+T+  E    L+ G K+     + ++   S+    F +      + ++ R 
Sbjct: 198 HIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCI-DRKDDVTRC 252

Query: 308 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----SIHIPFRES 363
           S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    S H  F++S
Sbjct: 253 SSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FKDS 310

Query: 364 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQL 414
            L ++L D LGG+TK  L+  I     N       ++   KAK IKN P +
Sbjct: 311 SLNKILMDYLGGDTKMTLVVAIDG---NTGGYEDAVKLGAKAKLIKNYPTM 358

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 53/108 (49%), Gaps = 12/108 (11%)

Query: 75  YTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGE 134
           +  ++V+     Q+ + ++I      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 135 LSDSAGIIPRVLFRLFDTLEATESD----HLVKCSYIELYNEELKDLL 178
                GI+ R+   +FD L+    D      +  ++ EL+ E + DLL
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 150/335 (44%), Gaps = 47/335 (14%)

Query: 286 SRSHTIFTIML-YKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 344
           SRS     I +  ++ + E  + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 345 GRVINSLAD--------KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETS 396
            +V+  L++         S     R S+L + LQ ++GG++KT  +   S  K + + T 
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTV 343

Query: 397 STLEYATKAKNIKNRP-----QLGSFMMKDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSH 451
            TL   ++ ++I N P      L S  + D+                +ST  +E  Y++ 
Sbjct: 344 ITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKN------------MST--REDSYLTR 389

Query: 452 EHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIE 511
             Y E  +++      IQ++K QV   S+  SL  K+ K   QL   +  + T+   + E
Sbjct: 390 IKYLE--DEVSKLGGTIQQNKNQV---STNKSLTEKNMKLMDQLELYRKSQQTQKSGSEE 444

Query: 512 YLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDI--KEVLYQGITS 569
              + +  Q    I      +++ E L  +    +     ++RL  ++  K  + Q + +
Sbjct: 445 ---ENLTSQQNGRIQ-----NEMSEVLDNLMEKCERVIQLQMRLDEELRQKSQMSQQL-N 495

Query: 570 YRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFH 604
           Y+ES  Q LE +  ++L++   +N N +E+R + +
Sbjct: 496 YKESKAQALEAMNVKLLEQ---LNTNENEMRNVLN 527

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 86/418 (20%), Positives = 167/418 (39%), Gaps = 85/418 (20%)

Query: 69  KMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE 128
           K+  ++++  +V    A +   F  +A  + DD + G NC V  YG      +  M G +
Sbjct: 84  KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGLAADSLVMFGPQ 143

Query: 129 KLYDGELSDS---AGIIPRVLFRLFDTLEA-TESDHLVKCSYIELYNEELKDLLDDTPDY 184
                E  DS   +G++ +    +F+ +++ + S++ V  S  E+Y +++ DLL   P  
Sbjct: 144 SGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDKVFDLL--VP-- 199

Query: 185 SKRLRIFDSNTITNSRAGSQNNSPKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQS 244
                                            + KR+    P K + PSL      +  
Sbjct: 200 ---------------------------------VRKRK----PLKLQHPSL------QNM 216

Query: 245 SAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDF---SSRSHTIFTIMLYKSYE 301
           S  Y+ + +E ++   R+  SV+            ++N     S +SH    + + +  E
Sbjct: 217 STDYLASQRETNVYVVRDLHSVVLCRFDDLLTYVNEINSAYHQSKKSHIFVRMKITQVNE 276

Query: 302 -GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADKSIHIP 359
             +  +   +  V+LA     S   +Q +  K +  +      L  V+  L +D+S    
Sbjct: 277 LKDTLKEGIVQFVNLASDFKDSPGISQEESKKSSAGV----ALLREVVADLSSDESKASR 332

Query: 360 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMM 419
           ++E+ LT+L+ + L  N KT+ +   S    N ++T   L++  + + I+ +     F  
Sbjct: 333 YKEAHLTKLMYEPLMVNFKTSFVLCCSNNSKNRNDTLQLLQFGAQLQQIRTQVSGNVFG- 391

Query: 420 KDIXXXXXXXXXXXXXXDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVES 477
                              L++K K  +Y+S    +E     ENY+  I+  +RQ+ES
Sbjct: 392 -------------------LNSKRKMELYLSDMKLKE-----ENYKERIRFLQRQLES 425

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 125/319 (39%), Gaps = 89/319 (27%)

Query: 96  EPLFDDFI----KGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFRLFD 151
           EPL  D I    +G +C+++ YG ++TGKT+       L+D       GIIP  + +L+ 
Sbjct: 66  EPLVIDNINELTRGVDCSMVTYGQSATGKTHV------LFD----QVRGIIPLFIEQLY- 114

Query: 152 TLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKRLRIFDSNTITNSRAGSQNNSPKEQ 211
                            +Y E   DL      Y   L +++++                 
Sbjct: 115 -----------------IYLEAQSDL-----QYQIGLSVWEAD----------------- 135

Query: 212 DGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGL 271
                S  K R   +P     P   K L ++ S+   ++ L+E  +++  E    LQ  L
Sbjct: 136 -----SKGKIRDLLVPLND--PQQQKSLKWD-STIGAVKGLKEVFVSSRCE----LQDYL 183

Query: 272 KHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRA 331
                A+  + + +  +    ++ L   +E   FR   +  VDL   E++          
Sbjct: 184 N----AACDLQNSTFHTFVKISLQLVNCHEDS-FRKCCIEFVDLCAQEDVL--------- 229

Query: 332 KEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN 391
                  Q + +L  V+++  DK I     +S+  +LL +S+GGN KT  I   S  + N
Sbjct: 230 -------QLVCSLVAVLSNDNDKKIG--KEKSQFCKLLSNSIGGNRKTTFILACSTLEQN 280

Query: 392 ADETSSTLEYATKAKNIKN 410
              +  TLE+  K   + N
Sbjct: 281 EKISLETLEFGLKVSQVVN 299

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 15/127 (11%)

Query: 262 EGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRI---------SKMNL 312
           + I +L    K+  V S  +N     S T   + L +  +   F           S+  +
Sbjct: 372 DAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNSEFTI 431

Query: 313 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHI---PFRESKLTRLL 369
           VD+ G++++ +S  QN   K    +N SLLTLG+ IN+L    + I   P  E  + R L
Sbjct: 432 VDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFLIRRAL 488

Query: 370 QDSLGGN 376
           ++S  GN
Sbjct: 489 KNSRLGN 495

>ZYRO0G12562g Chr7 complement(992906..994966) [2061 bp, 686 aa] {ON}
           conserved hypothetical protein
          Length = 686

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 572 ESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIV-KDQPS 630
            ++D  L  ++ R   K  + ++ +D +   F + L+SVR +GS    ++  +V + Q  
Sbjct: 114 HTVDPDLHVMQCRFFLKQGTHHYPLDALLPYFDKMLESVRMSGSTPNVHVEALVSRAQLL 173

Query: 631 TSYQQFKEALGDLDTKV 647
             Y +F++AL DL+T +
Sbjct: 174 YKYSEFEKALIDLETAM 190

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 42/74 (56%), Gaps = 4/74 (5%)

Query: 583 TRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPST---SYQQFKEA 639
           T + D + ++N++MDE+R + +     ++S  +  C N ++I+++Q  T    Y  + +A
Sbjct: 371 TFLSDPSPNLNNDMDELRDLIYIFAKILKSTVTFNCYNAIRIIREQLPTHLGKYMPWCQA 430

Query: 640 -LGDLDTKVQTYSV 652
            LG L  ++Q Y +
Sbjct: 431 QLGKLHYEIQNYKM 444

>NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 18/101 (17%)

Query: 489 KKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDL-------VSTIHKLKEALHTM 541
           K+  Q L +L D+  +R+ N   Y   K+E QHR    L          + KL    H+ 
Sbjct: 20  KRPQQPLTDLTDL-YSRIANESIYYS-KLEEQHRYTAALQGWKALSTDAMFKLTCIEHSY 77

Query: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVK 582
             ++Q+Y   E+ LQN I+E+  + +T        H+ETV+
Sbjct: 78  P-NVQSYSRDEVSLQNGIRELYLKSLT--------HIETVQ 109

>KLLA0E00903g Chr5 (92292..98297) [6006 bp, 2001 aa] {ON} similar to
            uniprot|P39960 Saccharomyces cerevisiae YER155C BEM2 Rho
            GTPase activating protein (RhoGAP) involved in the
            control of cytoskeleton organization and cellular
            morphogenesis required for bud emergence
          Length = 2001

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 23/105 (21%)

Query: 443  AKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKK-ASQQLNELQDM 501
            A+   Y+ +EHY +  +D+ N                  N LLL   K   Q++ +  D+
Sbjct: 1108 AEALFYLINEHYSDFNDDMHN------------------NKLLLDIIKIMDQEIIDEWDL 1149

Query: 502  KITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQ 546
            +IT L +++E    K E +    IDL S   KLKE L  +K S Q
Sbjct: 1150 RITALSDSVE----KSEAEKSLVIDLNSYHDKLKELLQKIKSSYQ 1190

>KAFR0G03250 Chr7 (674757..675566) [810 bp, 269 aa] {ON} Anc_4.250
           YDL065C
          Length = 269

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 7/130 (5%)

Query: 503 ITRLQNTIEYLCDKIERQHRNEID----LVSTIHKLKEALHTMKGSLQNYETHELRLQND 558
           +  LQ+ + YL  + +  H NE      + ST+ +LK+    +  SL N E++   + ++
Sbjct: 58  VKNLQSLLHYLGGEAKSDHINEPGFNNVISSTLDRLKKNGGKIDASLNNEESNSDDMLSN 117

Query: 559 IKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMC 618
           +   +  G     E+MD  + T+  +M  K + +   M E++T F E  +  R+ G D  
Sbjct: 118 LFSQMLDGNLGDDENMDSAILTILNQMSSKEV-LYQPMKEMQTDFIEWFE--RNEGKDEY 174

Query: 619 TNIVKIVKDQ 628
            + + + K Q
Sbjct: 175 KDSMPVYKKQ 184

>Kpol_1056.34 s1056 complement(84006..88406) [4401 bp, 1466 aa] {ON}
           complement(84006..88406) [4401 nt, 1467 aa]
          Length = 1466

 Score = 32.3 bits (72), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 6/94 (6%)

Query: 437 DFLSTKAKEGIY----MSHEHYQEMV-NDLENYQTEIQESKRQVESFSSQNSLLLKDKKA 491
           +  ST  +EG++    + H H  +M+ +D+EN   + +  K QVESF +  S   KDK +
Sbjct: 596 ELFSTLRREGVFEGVELLHSHLDDMMSDDIENDTYDTESEKVQVESFLTDESKTKKDKGS 655

Query: 492 SQQLNELQDMKITRLQNTIEYLCDKIERQHRNEI 525
             +  E  +M I       +   + ++R+  N+I
Sbjct: 656 DSEY-EYDEMNIPEYVKPKKISFELLKRKSHNQI 688

>KLLA0F15334g Chr6 complement(1410456..1416293) [5838 bp, 1945 aa]
           {ON} uniprot|O60014 Kluyveromyces lactis UBR1 N-END-
           RECOGNIZING PROTEIN (UBIQUITIN-PROTEIN LIGASE E3
           COMPONENT) (N-RECOGNIN)
          Length = 1945

 Score = 32.3 bits (72), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 141 IIPRVLFRLFDTLEATESDHLVKCSYIELYNEELK--DLLDDTPDY 184
           ++ R  ++ FDTLE T+  ++      +LY E L   DLL+D PDY
Sbjct: 869 LVERDFYKKFDTLEETQLYNIKNAIIYKLYAEPLSYTDLLNDIPDY 914

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score = 32.0 bits (71), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 19/99 (19%)

Query: 801 FEGIVRQASAKESI-----------VKQMNDINDKHKMLEDHFENNIKYFKESSKGFEEM 849
           +EG+ R  + K+SI           + Q ++ ND    +E +F+  +KY+K   +  +  
Sbjct: 320 YEGMTRNINTKDSIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYK---RRIQPN 376

Query: 850 DC----SIKKIIR-EMSPEVGDIKQIEALLERVNSRSFG 883
            C    S  KI + E+ P   D ++I+ + E  N R +G
Sbjct: 377 SCEQVKSFNKISKPEILPISNDPQRIQWINESTNKRYYG 415

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,108,627
Number of extensions: 3867880
Number of successful extensions: 15856
Number of sequences better than 10.0: 447
Number of HSP's gapped: 16088
Number of HSP's successfully gapped: 612
Length of query: 944
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 825
Effective length of database: 39,836,145
Effective search space: 32864819625
Effective search space used: 32864819625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)