Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30196.15ON26626613270.0
ACR011C6.15ON2532278291e-112
KLLA0D01023g6.15ON2682217511e-100
SAKL0E01056g6.15ON2692187483e-99
KLTH0C11352g6.15ON2682367334e-97
Kwal_56.223996.15ON2742247172e-94
KAFR0A050606.15ON2692157014e-92
Skud_15.1656.15ON2572206812e-89
Smik_15.1736.15ON2512156794e-89
Suva_15.1796.15ON2592286804e-89
NDAI0I022506.15ON2712196763e-88
ZYRO0C07920g6.15ON2932186722e-87
YOR004W (UTP23)6.15ON2542146657e-87
CAGL0E02673g6.15ON2632136632e-86
Kpol_1045.746.15ON2572326604e-86
KNAG0F028806.15ON2692186502e-84
TDEL0G045406.15ON2452416386e-83
NCAS0D026606.15ON2612156353e-82
TPHA0J002806.15ON2712176321e-81
TBLA0A072906.15ON2591795675e-72
Kpol_1055.185.392ON1891421461e-10
Kwal_55.200895.392ON1891421461e-10
KLTH0E02860g5.392ON1891421452e-10
CAGL0M01056g5.392ON1891421424e-10
ZYRO0A06754g5.392ON1891421416e-10
AEL102W5.392ON1891401408e-10
TPHA0D023105.392ON1891421409e-10
NDAI0C045505.392ON1891421391e-09
KNAG0C052705.392ON1891421391e-09
TBLA0H017505.392ON1891421381e-09
KAFR0D042805.392ON1891421382e-09
NCAS0F030905.392ON1891421382e-09
SAKL0G07766g5.392ON1891401382e-09
TDEL0E023305.392ON1891421363e-09
Ecym_74695.392ON1891421337e-09
Smik_4.5995.392ON1891471337e-09
Skud_4.6065.392ON1891471337e-09
Suva_2.5095.392ON1891471338e-09
YDR339C (FCF1)5.392ON1891471339e-09
KLLA0A07018g5.392ON1891471293e-08
TPHA0F024306.31ON79856780.22
NDAI0E003008.838ON664132711.6
CAGL0E06688gsingletonON97532675.5
KLLA0B12287g3.323ON85758668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3019
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   515   0.0  
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   323   e-112
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   293   e-100
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   292   3e-99
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   286   4e-97
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   280   2e-94
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   274   4e-92
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   266   2e-89
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   266   4e-89
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   266   4e-89
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   265   3e-88
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   263   2e-87
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   260   7e-87
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   259   2e-86
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   258   4e-86
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   254   2e-84
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   250   6e-83
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   249   3e-82
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   248   1e-81
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   223   5e-72
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    61   1e-10
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    61   1e-10
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    60   2e-10
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    59   4e-10
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    59   6e-10
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    59   8e-10
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    59   9e-10
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    58   1e-09
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    58   1e-09
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    58   1e-09
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    58   2e-09
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    58   2e-09
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    58   2e-09
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    57   3e-09
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    56   7e-09
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    56   7e-09
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    56   7e-09
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    56   8e-09
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    56   9e-09
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    54   3e-08
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    35   0.22 
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...    32   1.6  
CAGL0E06688g Chr5 complement(680404..683331) [2928 bp, 975 aa] {...    30   5.5  
KLLA0B12287g Chr2 (1072379..1074952) [2574 bp, 857 aa] {ON} weak...    30   8.2  

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/266 (94%), Positives = 252/266 (94%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHRYVVAT 120
           ITQCCVQKLYESKNQGAIAQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHRYVVAT
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHRYVVAT 120

Query: 121 QDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTPN 180
           QDIEIRRILRRVPGVPLIYMNRSVMVMEPL              KLVKGLNDPKYAGTPN
Sbjct: 121 QDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTPN 180

Query: 181 NTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNKAQLPSEDVFNLTDKKKGGGSM 240
           NTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNKAQLPSEDVFNLTDKKKGGGSM
Sbjct: 181 NTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNKAQLPSEDVFNLTDKKKGGGSM 240

Query: 241 GHRIFVTTLHRPMNIRIKFTQEYREE 266
           GHRIFVTTLHRPMNIRIKFTQEYREE
Sbjct: 241 GHRIFVTTLHRPMNIRIKFTQEYREE 266

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  323 bits (829), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 181/227 (79%), Gaps = 4/227 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAKAYKKQMLVYNHTFKFR+PYQVLVDDQ+VLETNKSSFDLLKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHRYVVAT 120
           ITQCC+QKLY++KNQ AIAQ K+YERRRCNH KEPKEP EC++SVV +NG+N HRY+VA+
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHRYIVAS 120

Query: 121 QDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTPN 180
           QDI IRR LR+VPGVPL+Y+NR+VMVMEPL              KL KGLNDPKY G   
Sbjct: 121 QDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIAE 180

Query: 181 NTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNKAQLPSEDV 227
           N+  A   P +  A  LKR  KGPK PNPLS+KK +V + Q P+ D 
Sbjct: 181 NSAPAGAQP-AEGAPTLKR--KGPKAPNPLSMKKRKVKEEQ-PTSDA 223

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  293 bits (751), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 169/221 (76%), Gaps = 4/221 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNHTFKFRQPYQVLVDDQLVLET  SSFD +KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHY-KEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LY++ NQGAI   K +ERRRCNH  KEPK   EC+ SVVD+NG+N HRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           TQD+EIRR LR++PGVPL+YMNRSVMVMEPL              KL KGLNDPK+AG  
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNKA 220
            +  D +    + +     +K KGPKEPNPLS+KK +  ++
Sbjct: 181 RDENDEA---GAENQENKPKKRKGPKEPNPLSMKKKKTTES 218

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  292 bits (748), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 166/218 (76%), Gaps = 5/218 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNHTFKFR+PYQVLVDDQ+V+ T KSSFDL KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LY +K+QGAI  AK YERRRCNH  KE K   ECI SVV+ NG+N HRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           TQDI+IRR LRRVPGVPLIYMNRSVMVMEPL              KL KGLNDPK+AG  
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGL- 179

Query: 180 NNTEDASVD-PKSPDANQLKRKIKGPKEPNPLSIKKPR 216
               D SVD   S    Q  +K  GPKEPNPLS+K+ R
Sbjct: 180 --AHDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKR 215

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  286 bits (733), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 174/236 (73%), Gaps = 7/236 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNH FKFR+PYQVLVDDQ+V +T+++SFDL+KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q +YE+KNQ AI  AK +ERRRCNH  KE K P EC++SVV +NG N HRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QD  IR+ LR+VPGVPLIYMNRSVMVMEPL              KL KGLNDPKYAG P
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRV---NKAQLPSEDVFNLTD 232
              E    D  +  +   K K KGPK PNPLSIKK +    +K + P  D  ++TD
Sbjct: 181 AEEEGGKTDNGTEVS---KNKRKGPKGPNPLSIKKKKTVPDSKDESPPSDKISVTD 233

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  280 bits (717), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 170/224 (75%), Gaps = 4/224 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNH FKFR+PYQVLVDDQ+V +T+K++FDL+KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q +YE+ +Q AI  AK +ERRRCNH  KE K P EC++SVV++NG N HRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           TQ+ EIR  LR+VPGVPL++MNRSVMVMEPL              KL KGLNDPK+AG P
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 180 NNTEDASVDPKSPD---ANQLKRKIKGPKEPNPLSIKKPRVNKA 220
              + A+    + D   A    +K KGPK PNPLSIKK + +++
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSES 224

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  274 bits (701), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 133/215 (61%), Positives = 169/215 (78%), Gaps = 3/215 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+++V  ++ S+FDL+KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE+++Q AI  AK +ERRRCNH  KEPK P EC+ SVV++NG+N HRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QDI+IRR LRRVPGVPL++++RSVM+MEPL              KL KGLNDPKYAG  
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKK 214
            + E+A+    S    +  +K +GPK PNPLS++K
Sbjct: 181 LDEEEATETQGS--GEKTAKKKRGPKGPNPLSVRK 213

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  266 bits (681), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 134/220 (60%), Positives = 164/220 (74%), Gaps = 7/220 (3%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLV E + S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE++N+GAI  AK +ERRRCNH +K+PK P+ECI SVVD+NG N HRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QDI +RR LR VPGVPLI++ RSVM+MEPL              KL KGLNDP      
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNV---- 176

Query: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNK 219
             TE  S +     A + KRKI GPK PNPLS+KK + ++
Sbjct: 177 EKTEKVSSESGKESAPK-KRKI-GPKAPNPLSVKKKKTSQ 214

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  266 bits (679), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 160/215 (74%), Gaps = 7/215 (3%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLVLE N S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE++N+GAI  AK +ERRRCNH +K+PK P++CI SVVDING N HRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QDI +RR LR VPGVPLI++ RSVMVMEPL              KL KGLND      P
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLND------P 174

Query: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKK 214
           N  +   +   S   +  K++  GPK PNPLS+KK
Sbjct: 175 NVDKVQEISEGSGKESVTKKRKFGPKAPNPLSVKK 209

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  266 bits (680), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 136/228 (59%), Positives = 165/228 (72%), Gaps = 12/228 (5%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLV E + S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE++N+GAI  AK +ERRRCNH +K+PK P+ECI SVV++NG N HRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QDI++RR LR VPGVPLI++ RSVM+MEPL              KL KGLNDP      
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP------ 174

Query: 180 NNTEDASVDPKSPDANQLKRKIK-GPKEPNPLSIKKPRVNKAQLPSED 226
            N E A    K  +     +K K GPK PNPLS+KK    K   PS+D
Sbjct: 175 -NIEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKK---KKKTGPSDD 218

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  265 bits (676), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 133/219 (60%), Positives = 163/219 (74%), Gaps = 3/219 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTFKFR PYQVLVD+Q+VL+ + S++DL KGLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHY-KEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE  NQ AI  A+ +ERRRCNH  KEPK   ECI SVV+ING+N HRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QD+  RR LR+VPGVPLI+++R+VM+MEPL              KL KGLNDPK+ G  
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 180 NNTEDASVDPK-SPDANQLKRKIKGPKEPNPLSIKKPRV 217
           +  +  +V  K S D  + KRKI GPK PNPLS+KK + 
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKI-GPKGPNPLSMKKKKT 218

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  263 bits (672), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 162/218 (74%), Gaps = 9/218 (4%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+YKKQMLVYN+ F+FR+PYQVL+DDQLV +  KS +DL+ GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LY +KNQ AI   K +ERRRCNH  KE K P ECI+SVV++NG N HRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAG-- 177
           +QD+ +RR LR+VPGVPLI+M+RSVMVMEPL              KL+KGLNDPK AG  
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 178 -TPNNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKK 214
            TP+   +   + + P      +K KGPK PNPLS++K
Sbjct: 181 TTPSVENELESESQPP-----AKKRKGPKGPNPLSVRK 213

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  260 bits (665), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 159/214 (74%), Gaps = 11/214 (5%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+QLVLE N S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE++N GAI  AK +ERRRCNH +K+PK P+ECI SVV+I+G N HRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QDI++RR LR VPGVPLI++ RSVMVMEPL              KL KGLNDP      
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDP------ 174

Query: 180 NNTE--DASVDPKSPDANQLKRKIKGPKEPNPLS 211
            N E    S D    ++   KRK+ GPK PNPLS
Sbjct: 175 -NIEKLQESGDGSGKESITKKRKL-GPKAPNPLS 206

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  259 bits (663), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 159/213 (74%), Gaps = 4/213 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTFKFR+PYQVL+DDQ+V+++  S +DL+K LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHY-KEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE+KN+ AI   K +ERRRC H   E   P ECI +VVD+ G+N HRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
            QD+EIRR+LR+VPGVPL++++RSVM+MEPL              KL +GLNDPKYAG  
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSI 212
              E+     +   A   KRKI GPK+PNPLS+
Sbjct: 181 GEHEEEEQSKEQTVAK--KRKI-GPKQPNPLSM 210

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  258 bits (660), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 169/232 (72%), Gaps = 14/232 (6%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQ+RAK+Y+KQMLVYNHTFKFR+PYQ +VDDQLVL+  +S FD+LKGLKRTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LY++ NQ AI+ AK +ERRRCNH  K+PK P ECI S+VDI G N HRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QD++IRR LR++PGVP+++++R+VM++EPL              KL KGLND K+    
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 NNTEDASVDPKSPDANQL--KRKIKGPKEPNPLSIK----KPRVNKAQLPSE 225
           +       +PKS  + +    +K KGPK+PNPLS+K    KP  N+ +  +E
Sbjct: 181 D-------EPKSEKSEKTSESKKNKGPKQPNPLSMKKRKSKPASNEVEAETE 225

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  254 bits (650), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 161/218 (73%), Gaps = 6/218 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTF+FR+PYQV++DD++VL+  +S FDL K L+RT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LY + N+ AI  AK YERRRCNH  K+PK P ECI SVVDI G N HRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
            Q+I++RR LRRVPGVPLI+++R+VM+MEPL              KL  GLND K AG  
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGI- 179

Query: 180 NNTEDASVDPK---SPDANQLKRKIKGPKEPNPLSIKK 214
              E   V+ K   +P+A   KRK+ GPK+PNPLS+KK
Sbjct: 180 KAAETEKVEDKGKEAPEAKPKKRKL-GPKQPNPLSMKK 216

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  250 bits (638), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 166/241 (68%), Gaps = 19/241 (7%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAKAY+KQMLVYNHTFKFR+PYQVLVD+Q+VL+ + S+FDL+KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE+  QGAI  AK +ERRRCNH  KEPK P EC+ S+V +NG N HRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
           +QDI+ RRILRR PGVPL++  RSVMVMEPL              KL KGLNDP+ AG  
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVN-----KAQLPSEDVFNLTDKK 234
                 S+  ++             K+PNPLS+KK +       KA   +E V + T K+
Sbjct: 181 TENPQTSIKKRT-------------KQPNPLSVKKRKTESKGEPKAAQDTEPVASNTKKR 227

Query: 235 K 235
           +
Sbjct: 228 R 228

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  249 bits (635), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 128/215 (59%), Positives = 160/215 (74%), Gaps = 5/215 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTF+FR+PYQ+LVD+Q+V + + S++DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHY-KEPKEPSECIRSVVDINGRNLHRYVVA 119
           ITQCC+Q LYE+ +Q AI  A+ +ERRRCNH  K+PK P ECI SVV+ING+N HRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGTP 179
            QD+ IRR LR+VPGVPL++++R+VM+MEPL              KL KGLNDPKY G  
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKK 214
              ED  +D K     + K+   GPK PNPLS+KK
Sbjct: 181 TAAEDVKIDDKP----KPKKSKYGPKSPNPLSMKK 211

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  248 bits (632), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 125/217 (57%), Positives = 163/217 (75%), Gaps = 6/217 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAE-VKP 59
           MRQKRAK+YKKQM+VYNHTFKFR+PYQ+LVD+Q+V ++ +S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVV 118
           MITQCC+QKLY + NQ  I +AK +ERRRCNH  K+PKEP ECI S+V+I+G+N HRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 119 ATQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYAGT 178
           ATQ++E+RR LRRVPGVP+++++RSVM+MEP+              KL KGLNDPKY+  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 179 PNNTEDA-SVDPKSPDANQLKRKIKGPKEPNPLSIKK 214
           P   E     +   P A    +K KG KEPNPLS KK
Sbjct: 181 PTPKEGTPDTEGTQPAAT---KKRKGVKEPNPLSKKK 214

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  223 bits (567), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 103/179 (57%), Positives = 134/179 (74%), Gaps = 3/179 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAE--VK 58
           MRQKRAK+YKKQ++VYNHTFKFR+PYQV++DD LV ET ++ ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYV 117
           PMITQCC+  LY+S++Q +I+  K +ERRRCNH  KEP  PSEC+ S+VD+NG+N HRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 118 VATQDIEIRRILRRVPGVPLIYMNRSVMVMEPLXXXXXXXXXXXXXXKLVKGLNDPKYA 176
           VATQD+E+RR LR++PGVPLI+  RSVMVMEPL              KL  GLN  K +
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKAS 179

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYESK 73
           L + +    + PYQVL+D   +  + +   D++KG+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQGAI----AQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            +  I    A+    +R  C+H  +     +CI     +N    H+ Y+VAT D+ +++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH--KGTYADDCI-----VNRVLQHKCYIVATNDVGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R+VPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLMSVGGHSYVIEKL 185

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   DL++G+  TL A+  P+IT C + +L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            K + A+  A+    +R  C+H  +     +C+     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALKLARDPRIQRLSCSH--KGTYADDCL-----VNRVLQHKCYIVATNDAALKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R+VPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLMSVGGHAYVIEKL 185

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+  TL A+  PMIT C + +L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            K + A+  A+    +R  C+H  +     +C+     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALKLARDPRIQRLTCSH--KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R+VPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLMSVGGHAYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D++KG+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            K + A+  A+    +R  C H  +     +CI     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLTCTH--KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    R PYQVL+D   +  + +   D++KG+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            K + A+  A+    +R  C H  +     +C+     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCTH--KGTYADDCL-----VNRVMQHKCYIVATNDAPLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVIEKL 185

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 73/140 (52%), Gaps = 8/140 (5%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRILR 130
            K + A+  A+    +R N   +     +C+     +N    H+ Y+VAT D  +++ +R
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYADDCL-----VNRVLQHKCYIVATNDAGLKQRIR 165

Query: 131 RVPGVPLIYMNRSVMVMEPL 150
           +VPG+PL+ +     V+E L
Sbjct: 166 KVPGIPLMSVGGHSYVIEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 58.5 bits (140), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYESK 73
           L +      R PYQVL+D   +  + +   D++KG+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQGAI----AQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            +  I    A+    +R  C+H  +     +CI     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH--KGTYADDCI-----VNRVLQHKCYIVATNDQGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHAYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            K + A+  A+    +R  C+H  +     +CI     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVIEKL 185

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            K + A+  A+    +R  C+H  +     +C+     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHAYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYESK 73
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C V +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 74  NQGAI----AQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            +  I    A+    +R  C+H        +CI     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKFRIALKLARDPRIKRLSCSH--RGTYADDCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVVEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            K + A+  A+    +R  C+H  +     +CI     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 73/142 (51%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYESK 73
           L + +    + PYQVL+D   +  + +   DL+KG+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQGAI----AQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            +  I    A+    +R  C+H  +     +CI     +N    H+ ++VAT D  +++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH--KGTYADDCI-----VNRVLQHKCFIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 73/140 (52%), Gaps = 8/140 (5%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRILR 130
            K + A+  A+    +R N   +     +C+     +N    H+ Y+VAT D  +++ +R
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYADDCL-----VNRVLQHKCYIVATNDAALKQRIR 165

Query: 131 RVPGVPLIYMNRSVMVMEPL 150
           +VPG+PL+ +     V+E L
Sbjct: 166 KVPGIPLMSVGGHSYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 71/142 (50%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYESK 73
           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  NQGAI----AQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            +  I    A+    +R  C H  +     +CI     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKFRIALKLARDPRIKRLSCTH--KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R++PG+PL+ +      +E L
Sbjct: 164 VRKIPGIPLMSVGGHAYAIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR-YVVATQDIEIRRI 128
            K + A+  A+    +R  C+H        +C+     +N    H+ Y+VAT D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLTCSH--RGTYADDCL-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRRVPGVPLIYMNRSVMVMEPL 150
           +R+VPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLLSVGGHSYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 74/147 (50%), Gaps = 22/147 (14%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR------YVVATQDI 123
            K + A+  A+    +R  C+H  +     +C+          +HR      Y+VAT D 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCL----------VHRVLQHKCYIVATNDA 158

Query: 124 EIRRILRRVPGVPLIYMNRSVMVMEPL 150
            +++ +R++PG+PL+ +     V+E L
Sbjct: 159 GLKQRIRKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 74/147 (50%), Gaps = 22/147 (14%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR------YVVATQDI 123
            K + A+  A+    +R  C+H  +     +C+          +HR      Y+VAT D 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCL----------VHRVLQHKCYIVATNDA 158

Query: 124 EIRRILRRVPGVPLIYMNRSVMVMEPL 150
            +++ +R++PG+PL+ +     V+E L
Sbjct: 159 GLKQRIRKIPGIPLMSVGGHAYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 74/147 (50%), Gaps = 22/147 (14%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR------YVVATQDI 123
            K + A+  A+    +R  C+H  +     +C+          +HR      Y+VAT D 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCL----------VHRVLQHKCYIVATNDA 158

Query: 124 EIRRILRRVPGVPLIYMNRSVMVMEPL 150
            +++ +R++PG+PL+ +     V+E L
Sbjct: 159 GLKQRIRKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 74/147 (50%), Gaps = 22/147 (14%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR------YVVATQDI 123
            K + A+  A+    +R  C+H  +     +C+          +HR      Y+VAT D 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCL----------VHRVLQHKCYIVATNDA 158

Query: 124 EIRRILRRVPGVPLIYMNRSVMVMEPL 150
            +++ +R++PG+PL+ +     V+E L
Sbjct: 159 GLKQRIRKIPGIPLMSVGGHAYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 73/147 (49%), Gaps = 22/147 (14%)

Query: 14  LVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLYE-- 71
           L + +    + PYQVL+D   +  + +   D++KG+   L A+   +IT C + +L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 72  SKNQGAIAQAK--MYERRRCNHYKEPKEPSECIRSVVDINGRNLHR------YVVATQDI 123
            K + A+  A+    +R  C+H  +     +CI          +HR      Y+VAT D 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH--KGTYADDCI----------VHRVLQHKCYIVATNDA 158

Query: 124 EIRRILRRVPGVPLIYMNRSVMVMEPL 150
            +++ +R+VPG+PL+ +     V+E L
Sbjct: 159 GLKQRVRKVPGIPLMSVGGHSYVIEKL 185

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 12  QMLVYNHTFKFRQPYQVLVDDQLVLET--NKSSFDLLKGLKRTLQAEVKPMITQCC 65
           Q L Y+H  KF   ++  ++  ++LE   N S  DLLK  K   +AEVK M TQ C
Sbjct: 145 QNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVC 200

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 9/132 (6%)

Query: 17  NHTFKFRQPY------QVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPMITQCCVQKLY 70
           +HT+KF   +      + L+  +LV E  KS   LL  LK    A+    I    +    
Sbjct: 190 DHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSP 249

Query: 71  ESKNQGAIAQAKMYERRRCNHYKEPKEPSECIRSVVDINGRN---LHRYVVATQDIEIRR 127
              N+G I      E++  N  ++ +E +  I   +D+N  N   L  Y   +Q  EI R
Sbjct: 250 SLSNEGPITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIER 309

Query: 128 ILRRVPGVPLIY 139
                P +  I+
Sbjct: 310 DSSSKPNIISIH 321

>CAGL0E06688g Chr5 complement(680404..683331) [2928 bp, 975 aa] {ON}
           some similarities with uniprot|P36170 Saccharomyces
           cerevisiae YKR102W FLO10 Lectin-like protein
          Length = 975

 Score = 30.4 bits (67), Expect = 5.5,   Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 173 PKYAGTPNNTEDAS-VDPKSPDANQLKRKIKG 203
           P  +GTP N  DAS VDP+ P    LKRK+ G
Sbjct: 62  PIVSGTPPNCYDASYVDPEYPRTGYLKRKMVG 93

>KLLA0B12287g Chr2 (1072379..1074952) [2574 bp, 857 aa] {ON} weakly
           similar to uniprot|P38250 Saccharomyces cerevisiae
           YBR086C IST2
          Length = 857

 Score = 30.0 bits (66), Expect = 8.2,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 173 PKYAGTPNNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVN-KAQLPSEDVFN 229
           PK A T NN +    +      N++K++  GP  P PL + +P    +A LP +DV N
Sbjct: 631 PKTAVT-NNAKSTGANITGEHDNKVKKR--GPVSPVPLPVAQPPTQTEAPLPPKDVSN 685

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,085,344
Number of extensions: 1096948
Number of successful extensions: 3316
Number of sequences better than 10.0: 51
Number of HSP's gapped: 3341
Number of HSP's successfully gapped: 51
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)