Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30186.14ON57557525870.0
ACR012C6.14ON54148614810.0
SAKL0E01012g6.14ON54458114360.0
KLTH0C11396g6.14ON55059013980.0
Kwal_56.223876.14ON54347213790.0
KLLA0D00979g6.14ON56148113600.0
ZYRO0C07942g6.14ON54857913480.0
TDEL0G045506.14ON56448113271e-178
Smik_5.276.14ON60847412921e-172
YEL060C (PRB1)6.14ON63547512851e-170
NCAS0F002206.14ON69555412861e-169
Skud_5.296.14ON60847412781e-169
CAGL0B03619g6.14ON46847512621e-169
TBLA0A073006.14ON57347412701e-169
Suva_5.76.14ON66447412761e-168
NDAI0K028806.14ON70450812461e-163
Kpol_1032.56.14ON68047012421e-163
Kpol_1045.756.14ON47742712201e-163
KNAG0E009206.14ON53146011991e-159
KAFR0L003606.14ON50242411671e-154
TPHA0M002306.14ON58550810921e-142
Smik_15.1726.14ON47841710351e-135
YOR003W (YSP3)6.14ON47841710331e-134
Suva_15.1786.14ON47642010181e-132
Skud_15.1646.14ON48242010091e-131
CAGL0E02651g6.14ON4854239981e-129
KAFR0B065506.14ON4563518791e-112
NCAS0D026306.14ON4514248261e-104
NDAI0I022806.14ON4824348091e-101
KNAG0F02970singletonON4203457262e-89
CAGL0L13266gsingletonON5794616815e-81
NDAI0I005606.313ON4834274183e-44
TDEL0A072806.313ON4363184145e-44
NCAS0D043906.313ON4924214141e-43
Kpol_1028.616.313ON5183354142e-43
Kpol_1018.56.313ON4653264112e-43
CAGL0L10802g6.313ON5174733983e-41
Suva_3.846.313ON5273633941e-40
ZYRO0D08822g6.313ON4903123922e-40
TBLA0F039706.313ON7343753992e-40
Smik_3.1496.313ON4913273885e-40
KNAG0I024706.313ON4753733868e-40
Skud_3.1246.313ON5403233898e-40
YCR045C (RRT12)6.313ON4913933861e-39
KLLA0F06028g6.313ON5083213833e-39
Kwal_23.61836.313ON4933353824e-39
SAKL0A02002g6.313ON4793603744e-38
KLTH0A06094g6.313ON4962643702e-37
Ecym_21056.313ON6103103742e-37
AAR069W6.313ON7683253729e-37
KAFR0J024506.313ON4783393594e-36
TPHA0D037606.313ON6073133573e-35
Kwal_33.133721.78ON3773123385e-34
TBLA0A067006.313ON4972903137e-30
KLTH0F02288g1.78ON3803113015e-29
Kpol_2000.691.78ON3863062592e-23
TDEL0C062301.78ON3643292361e-20
ZYRO0F16764g1.78ON3863112238e-19
TPHA0B045201.78ON3883132141e-17
TBLA0A054101.78ON3823421784e-13
Kwal_56.22390singletonOFF101811194e-07
Kwal_56.22389singletonOFF5959860.004
Kwal_23.6185singletonOFF8563720.60
Kwal_23.42204.251ON308175770.82
TDEL0H013001.261ON715146761.4
KAFR0A080402.6ON766112742.5
NCAS0A008802.6ON83363742.6
Skud_14.1012.6ON81967733.4
SAKL0G00440g2.6ON83663733.4
Suva_5.2147.385ON39770723.7
Kwal_23.47402.230ON61271724.2
ZYRO0F15598g2.6ON79063724.4
Smik_5.2397.385ON40068714.9
Skud_13.464singletonON18596695.3
Suva_14.1062.6ON80964715.8
YNL238W (KEX2)2.6ON81464715.8
TBLA0B001302.6ON84258715.8
KNAG0A041808.463ON85656715.9
Smik_6.25na 1ON122694716.1
TBLA0I010807.413ON155565716.2
YCR045W-AsingletonOFF11647666.7
Kwal_56.227563.78ON440125706.7
Suva_16.5177.542ON727105707.5
TPHA0F023902.61ON29486697.6
TDEL0E004102.6ON78063707.6
Kpol_526.133.403ON39866698.6
SAKL0F05170gna 2ON57657699.5
Suva_14.2362.174ON677105699.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Ecym_3018
         (1728 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...  1001   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   575   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   557   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   543   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   535   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   528   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   523   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   515   e-178
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   502   e-172
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   499   e-170
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   499   e-169
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   496   e-169
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   490   e-169
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   493   e-169
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   496   e-168
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   484   e-163
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   483   e-163
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   474   e-163
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   466   e-159
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   454   e-154
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   425   e-142
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   403   e-135
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   402   e-134
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   396   e-132
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   393   e-131
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   389   e-129
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   343   e-112
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     322   e-104
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   316   e-101
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              284   2e-89
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   266   5e-81
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    165   3e-44
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   164   5e-44
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   164   1e-43
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   164   2e-43
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   162   2e-43
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   157   3e-41
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   156   1e-40
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   155   2e-40
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   158   2e-40
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   154   5e-40
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   153   8e-40
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   154   8e-40
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   153   1e-39
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   152   3e-39
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   151   4e-39
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   148   4e-38
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   147   2e-37
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   148   2e-37
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   147   9e-37
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   142   4e-36
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   142   3e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   134   5e-34
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   125   7e-30
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   120   5e-29
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   104   2e-23
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    96   1e-20
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...    91   8e-19
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    87   1e-17
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    73   4e-13
Kwal_56.22390 s56 complement(108145..108450) [306 bp, 101 aa] {O...    50   4e-07
Kwal_56.22389 s56 complement(107750..107929) [180 bp, 59 aa] {OF...    38   0.004
Kwal_23.6185 s23 (1485516..1485773) [258 bp, 85 aa] {OFF} [conti...    32   0.60 
Kwal_23.4220 s23 complement(623740..624666) [927 bp, 308 aa] {ON...    34   0.82 
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...    34   1.4  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    33   2.5  
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    33   2.6  
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    33   3.4  
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    33   3.4  
Suva_5.214 Chr5 (324640..325833) [1194 bp, 397 aa] {ON} YER095W ...    32   3.7  
Kwal_23.4740 s23 complement(841124..842962) [1839 bp, 612 aa] {O...    32   4.2  
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    32   4.4  
Smik_5.239 Chr5 (358510..359712) [1203 bp, 400 aa] {ON} YER095W ...    32   4.9  
Skud_13.464 Chr13 (825408..825965) [558 bp, 185 aa] {ON}  (NOVEL)      31   5.3  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    32   5.8  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    32   5.8  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    32   5.8  
KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.4...    32   5.9  
Smik_6.25 Chr6 complement(43238..46918) [3681 bp, 1226 aa] {ON} ...    32   6.1  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    32   6.2  
YCR045W-A Chr3 (208751..209101) [351 bp, 116 aa] {OFF} Dubious O...    30   6.7  
Kwal_56.22756 s56 (268179..269501) [1323 bp, 440 aa] {ON} YNL283...    32   6.7  
Suva_16.517 Chr16 (889644..891827) [2184 bp, 727 aa] {ON} YPR185...    32   7.5  
TPHA0F02390 Chr6 complement(527739..528623) [885 bp, 294 aa] {ON...    31   7.6  
TDEL0E00410 Chr5 (94980..97322) [2343 bp, 780 aa] {ON} Anc_2.6 Y...    32   7.6  
Kpol_526.13 s526 (35940..37136) [1197 bp, 398 aa] {ON} (35940..3...    31   8.6  
SAKL0F05170g Chr6 (409898..411628) [1731 bp, 576 aa] {ON} simila...    31   9.5  
Suva_14.236 Chr14 (424595..426628) [2034 bp, 677 aa] {ON} YNL103...    31   9.8  

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
            Ashbya gossypii ACR012C
          Length = 575

 Score = 1001 bits (2587), Expect = 0.0
 Identities = 508/575 (88%), Positives = 508/575 (88%)
 Frame = +1

Query: 1    MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
            MKVQSVVLPVAVFSTLGAALILPWMDPEIRLD                            
Sbjct: 1    MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60

Query: 181  XXXXXXSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG 360
                  SSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG
Sbjct: 61   KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG 120

Query: 361  VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS 540
            VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS
Sbjct: 121  VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS 180

Query: 541  LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF 720
            LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF
Sbjct: 181  LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF 240

Query: 721  NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA 900
            NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA
Sbjct: 241  NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA 300

Query: 901  SKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG 1080
            SKTYG            LRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG
Sbjct: 301  SKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG 360

Query: 1081 GKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW 1260
            GKS                     GNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW
Sbjct: 361  GKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW 420

Query: 1261 GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS 1440
            GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS
Sbjct: 421  GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS 480

Query: 1441 ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG 1620
            ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG
Sbjct: 481  ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG 540

Query: 1621 KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
            KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI
Sbjct: 541  KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL060C
            (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  575 bits (1481), Expect = 0.0
 Identities = 294/486 (60%), Positives = 357/486 (73%), Gaps = 9/486 (1%)
 Frame = +1

Query: 295  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMH 474
            L  + D +RAIPH+YIV+F++GV+D +   H +LV  AH E++A+LD  H+FF +T G +
Sbjct: 61   LFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGEN 120

Query: 475  HE-GISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFE 651
            +E GI+A   EGGIE  F +   LRGY GYFT+ M+ L+R +  V  +E+DS+V ASDF 
Sbjct: 121  NEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFT 180

Query: 652  TQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGK 831
            TQ GAPWGLARVSHRE+LN GSFNKYLYDDN+G+GVT+YVIDTGINIDHV+FE RA WGK
Sbjct: 181  TQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGK 240

Query: 832  TIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVV 1011
            TIP+NDADYDGNGHGTHCAGTIASKTYG            LR+NGTG+MSDVLRGVEY V
Sbjct: 241  TIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAV 300

Query: 1012 AEHRKAS--GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTS 1185
              HRKA+   D  FKGSTANMSLGGG+S                     GNENQDACNTS
Sbjct: 301  KAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTS 360

Query: 1186 PASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASP 1365
            PA+S+K ITV ASTL+DDRAYFSNWG CVD+FAPG+NILSTYIGSDTAVATLSGTSMASP
Sbjct: 361  PAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASP 420

Query: 1366 HVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGG 1545
            HVAGLL YFLSLQPD  SE+    +ISPE LKKK++ +G+K+ L+++PARTAN LI+NGG
Sbjct: 421  HVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGG 480

Query: 1546 GGSLDSFWNSKCDGCEQEKVSS-SHGKADDFES-----ESLMDCLHSTSHSLFGEIRNFL 1707
            G  L  FW +K      +KVS      ADD E+     + L+  L S++ ++F   R  L
Sbjct: 481  GADLSDFWGNK-----PKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTIL 535

Query: 1708 DRLDLI 1725
            DR+++I
Sbjct: 536  DRMNII 541

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
            uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
            Vacuolar proteinase B (yscB) a serine protease of the
            subtilisin family involved in protein degradation in the
            vacuole and required for full protein degradation during
            sporulation
          Length = 544

 Score =  557 bits (1436), Expect = 0.0
 Identities = 293/581 (50%), Positives = 379/581 (65%), Gaps = 6/581 (1%)
 Frame = +1

Query: 1    MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
            MKVQS +LP+A  +TL AAL++P +D   +                              
Sbjct: 1    MKVQSTILPIAALTTLAAALVIPEVDKSSK------------------------------ 30

Query: 181  XXXXXXSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDN---SRAIPHRYIVIF 351
                  S   +  D ++ ++   +     +++   ++KLA L  +   +  IPHRYI++F
Sbjct: 31   ----DVSVKEINSDSQEVLASFAKEITRAAAEKGEEVKLAPLVSSPQPANIIPHRYIIVF 86

Query: 352  KDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARSVEGGIEEMFE 528
            K   T  ++  H+++++ AH E++A+LD   SFF AT+G   E GI+A+S EGGI+E F+
Sbjct: 87   KKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFD 146

Query: 529  IAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLN 708
            IA  L GY GYFTD ++D IR +  V+ IE+DS+V AS+F+TQ GAPWGL+R+SHRERLN
Sbjct: 147  IANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLN 206

Query: 709  LGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCA 888
            LGSFNKYLYDD+AGKGVT+YVIDTGIN++H +F GRA WGKT+P ND D DGNGHGTHCA
Sbjct: 207  LGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCA 266

Query: 889  GTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKAS--GDPNFKGSTA 1062
            GTIAS+ YG            LR+NG+GTMSDV++GVE+    H++AS      FKGSTA
Sbjct: 267  GTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTA 326

Query: 1063 NMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDR 1242
            NMSLGGGKS                     GNENQDACNTSPA+++  ITV ASTLSDDR
Sbjct: 327  NMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDR 386

Query: 1243 AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSE 1422
            AYFSNWG CVDIFAPGLN+LSTYIGS+TA ATLSGTSMASPHVAGLL YFLSLQPDS SE
Sbjct: 387  AYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSE 446

Query: 1423 YYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEK 1602
            ++  S I+P  LKKK++AY +K++L  +P  T N LI+NGGG  L  FW       EQ K
Sbjct: 447  FFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGK---SEEQVK 503

Query: 1603 VSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
               S     DF+   L++   + +  LF E+R+  D+L++I
Sbjct: 504  EEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNII 544

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
            similar to uniprot|P09232 Saccharomyces cerevisiae
            YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
            protease of the subtilisin family involved in protein
            degradation in the vacuole and required for full protein
            degradation during sporulation
          Length = 550

 Score =  543 bits (1398), Expect = 0.0
 Identities = 291/590 (49%), Positives = 373/590 (63%), Gaps = 15/590 (2%)
 Frame = +1

Query: 1    MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
            MK+Q+  LPVAV +++GAAL+LP ++                                  
Sbjct: 1    MKLQTA-LPVAVVASVGAALVLPDLEEASNTVALKVKD---------------------- 37

Query: 181  XXXXXXSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSR---AIPHRYIVIF 351
                      ++   E  VS   +    D++     ++L+ L  +S    AIPHRYIV+F
Sbjct: 38   ----------VITAGESIVSSFSKQMTKDAASKGESVELSPLVSSSGKYLAIPHRYIVVF 87

Query: 352  KDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGM---------HHEGISARSVE 504
            K  ++  +V  H+ +V+ AH++++A+L+  H FF +TE           +    SA++ E
Sbjct: 88   KQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTRE 147

Query: 505  GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 684
            GGI++ F+++G L GY GYFTD ++D IR + LV  +EQDS+V A +F TQ GAPWGL+R
Sbjct: 148  GGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSR 207

Query: 685  VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 864
            +SHRE+LNLGSFNKYLYDD+AGKGVT+YVIDTG+N+DH +FEGRA WGKTIP+ND D DG
Sbjct: 208  ISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDG 267

Query: 865  NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKA--SGD 1038
            NGHGTHCAGTIASK YG            LR+NG+G+MSDV++GVE+    H+ A     
Sbjct: 268  NGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKENK 327

Query: 1039 PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVA 1218
              FKGSTANMSLGGGKS                     GNENQDACN+SPAS++  +TV 
Sbjct: 328  KGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVG 387

Query: 1219 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 1398
            ASTL+DDRAYFSNWG CVDIFAPGLN+LSTYIGSDTA ATLSGTSMASPHVAGLL YFLS
Sbjct: 388  ASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLS 447

Query: 1399 LQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNS 1575
            LQPDS SEY+     I+P  LKKK++AY +KN+L ++P  T N LIFNGGG  LD FW  
Sbjct: 448  LQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGK 507

Query: 1576 KCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
            +    E E   SS       E ES +D L   +  L+ EIR   D +++I
Sbjct: 508  ESVVDEVEDTISS-------EIESFIDALEEKTDVLYEEIREVFDHMNII 550

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
            (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  535 bits (1379), Expect = 0.0
 Identities = 272/472 (57%), Positives = 335/472 (70%), Gaps = 4/472 (0%)
 Frame = +1

Query: 322  AIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARS 498
            AIPHRYIV+FKD V   +V  H ++V+ AH +++ +LD   +FF+AT  M  E GI A S
Sbjct: 79   AIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEAT--MDEEMGIMATS 136

Query: 499  VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 678
             EGGI + F++ G LRGY GYFT  ++D IR + LV  +EQDS+V+A++F+TQ GAPWGL
Sbjct: 137  REGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGL 196

Query: 679  ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 858
            +R+SHRE+LNLGSFNKYLYDD AGKGVT+YVIDTGINIDH +FEGRA WGKT+P+ND D 
Sbjct: 197  SRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ 256

Query: 859  DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKA--S 1032
            DGNGHGTHCAGTIASK YG            LR+NG+G+MSDV++GVE+    H+ A   
Sbjct: 257  DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKK 316

Query: 1033 GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCIT 1212
                FKGSTANMSLGGGKS                     GNENQDACN+SPA+++  IT
Sbjct: 317  NKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAIT 376

Query: 1213 VAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYF 1392
            V ASTL+DDRAYFSNWG CVDIFAPGLN+LSTYIGS+TA ATLSGTSMASPHVAGLL YF
Sbjct: 377  VGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYF 436

Query: 1393 LSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 1569
            LSLQPDS SEY+     I+P  LKKK++AY +KN L ++P  T N LI+NGGG  LD FW
Sbjct: 437  LSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496

Query: 1570 NSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
                   E++   +    A +F  ES++D L   +  L+ EIR   + L++I
Sbjct: 497  ---VKDLEEKVADAKDNTASEF--ESIIDALEEKTDGLYEEIREIFEGLNII 543

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
            uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
            Vacuolar proteinase B (yscB) a serine protease of the
            subtilisin family involved in protein degradation in the
            vacuole and required for full protein degradation during
            sporulation
          Length = 561

 Score =  528 bits (1360), Expect = 0.0
 Identities = 262/481 (54%), Positives = 335/481 (69%), Gaps = 4/481 (0%)
 Frame = +1

Query: 295  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMH 474
            L++++D +  IP+RYI++FK   +  +V  HQ+LV+  H + +  L     FF AT G H
Sbjct: 87   LSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEH 146

Query: 475  HE-GISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFE 651
             E G+ A S+EGGI++ F+IAGSL GY GYFT  ++D IR S LV+ +E+DS+V ++ F 
Sbjct: 147  SEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFN 206

Query: 652  TQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGK 831
            TQ  APWGLAR+SHRE+LNLGSFNKYLYDD+AGKGVTAYV+DTG+N++H +F+GRA WGK
Sbjct: 207  TQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGK 266

Query: 832  TIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVV 1011
            TIP +D D DGNGHGTHCAGTI S  YG            LR+NG+GTMSDV++GVEYV 
Sbjct: 267  TIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVA 326

Query: 1012 AEHRKASGD--PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTS 1185
              H+KA  +    FKGSTANMSLGGGKS                     GNENQDACNTS
Sbjct: 327  EAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTS 386

Query: 1186 PASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASP 1365
            PA+++  ITV ASTLSD+RAYFSNWG CVDIF PGLNILSTYIGSDTA ATLSGTSMA+P
Sbjct: 387  PAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATP 446

Query: 1366 HVAGLLAYFLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 1542
            HV GLL YFLSLQPD+ SEY+     I+P  LKKK++ + +KN+L+++P  T N LI+NG
Sbjct: 447  HVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNG 506

Query: 1543 GGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDL 1722
            GG  LD  W       +   +        +F  ESL++ L S + ++F ++R  LD+ ++
Sbjct: 507  GGQDLDDLWG------KDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNI 560

Query: 1723 I 1725
            I
Sbjct: 561  I 561

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
            similar to uniprot|P09232 Saccharomyces cerevisiae
            YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
            protease of the subtilisin family involved in protein
            degradation in the vacuole and required for full protein
            degradation during sporulation
          Length = 548

 Score =  523 bits (1348), Expect = 0.0
 Identities = 282/579 (48%), Positives = 364/579 (62%), Gaps = 4/579 (0%)
 Frame = +1

Query: 1    MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
            MK Q  V+PVA  + LG+ALI+P +      +                            
Sbjct: 1    MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNG---------------- 44

Query: 181  XXXXXXSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDM--KLASLSDNSRAIPHRYIVIFK 354
                   SV+    E+         F    +Q+  D    L    D    + +RYI++FK
Sbjct: 45   ------ESVVATSFEKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFK 98

Query: 355  DGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIA 534
             GV   ++G H++L+   H++ ++QL   HSFF   EG+  +G+    + GGI+  F+I 
Sbjct: 99   KGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF---EGIRLDGVYDSPL-GGIDHTFDIN 154

Query: 535  GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLG 714
            G L GY GYF   +LD+IR S L++++EQDS+V+    +T+ GAPWGLAR+SHRERLNLG
Sbjct: 155  GMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLG 214

Query: 715  SFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGT 894
            S+NKYLYD+  G GVT+YVIDTG+N+ H +F GRA+WGKTIP+ D D DGNGHGTHCAGT
Sbjct: 215  SYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGT 274

Query: 895  IASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKA--SGDPNFKGSTANM 1068
            I S TYG            LR+NG+G+MSDVL+GVE+   +H+ A     P FKGSTANM
Sbjct: 275  IGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANM 334

Query: 1069 SLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRAY 1248
            SLGGGKS                     GNE+QDACNTSPAS+   ITV ASTLSDDRAY
Sbjct: 335  SLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAY 394

Query: 1249 FSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYY 1428
            FSN+G CVD+FAPGLNILSTYIGSD++ ATLSGTSMASPHVAGLLAYFLSLQP S SE+ 
Sbjct: 395  FSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFD 454

Query: 1429 TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVS 1608
             GSSISP+ LKKK++A+ +K++L+++P+ T N LI+NGGGG L  FW SK    E E   
Sbjct: 455  AGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSKEVAQELE--- 511

Query: 1609 SSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
                +  D E   L+D L S + ++FG+IR  +DRLD+I
Sbjct: 512  --FNEKVDLELHDLVDELGSKTDAVFGQIRGLMDRLDII 548

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
            Anc_6.14 YOR003W
          Length = 564

 Score =  515 bits (1327), Expect = e-178
 Identities = 262/481 (54%), Positives = 340/481 (70%), Gaps = 4/481 (0%)
 Frame = +1

Query: 295  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMH 474
            +A LS    A PHRYIV+ K    + ++ +H + +T + ++++ +L     FF A     
Sbjct: 101  VAPLSIPPNAFPHRYIVVLKHSSPE-EIALHMEAITQSQLQSVGELAQDDPFFSA----- 154

Query: 475  HEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFET 654
             +G+      GGI++ F++AG L GY GYFTD +++LIR+S +V  +E DS VHAS+F+T
Sbjct: 155  -QGVRTT---GGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT 210

Query: 655  QTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKT 834
            Q GAPWGL+R+SHRERLNLGSFNKYL+DD AGKGVT+YVIDTGIN+ H +FEGRA WGKT
Sbjct: 211  QNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKT 270

Query: 835  IPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVA 1014
            IP+ND D DGNGHGTHCAGTIASK YG            LR+NG+G+MSDV++GVE+   
Sbjct: 271  IPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQ 330

Query: 1015 EHRKASGD--PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSP 1188
             H+KA  D    FKGSTANMSLGGGKS                     GNENQDACNTSP
Sbjct: 331  SHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSP 390

Query: 1189 ASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPH 1368
            A++++ +TV ASTLSDDRAYFSN+G CVDIFAPGLNILSTYIGSD A ATLSGTSMASPH
Sbjct: 391  AAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPH 450

Query: 1369 VAGLLAYFLSLQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 1542
            VAGLL YFLSLQPDS S+++   S  ++PE LKKK++AY +K++L ++P  T N LI+NG
Sbjct: 451  VAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNG 510

Query: 1543 GGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDL 1722
            GG  L  FW    DG ++++ ++   +  D + + L D L + + +LF ++R+ LDRL++
Sbjct: 511  GGHGLKGFW----DGHDKQEANT---RFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNI 563

Query: 1723 I 1725
            I
Sbjct: 564  I 564

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
            YEL060C (REAL)
          Length = 608

 Score =  502 bits (1292), Expect = e-172
 Identities = 258/474 (54%), Positives = 326/474 (68%), Gaps = 4/474 (0%)
 Frame = +1

Query: 316  SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 495
            S+ IP+RYIV+FK GV + +V  H++ V  A ++++  L    +FF +T   +     + 
Sbjct: 149  SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTY----LST 204

Query: 496  SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 675
            S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A++F+TQ  APWG
Sbjct: 205  SEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWG 264

Query: 676  LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 855
            LAR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+NI+H +FE RA WGKTIP ND D
Sbjct: 265  LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 324

Query: 856  YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASG 1035
             DGNGHGTHCAGTIASK YG            LR+NG+GTMSDV++GVEY    H+K + 
Sbjct: 325  LDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQ 384

Query: 1036 D--PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
            +    FKGSTANMSLGGGKS                     GNENQDACNTSPAS+ K I
Sbjct: 385  EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 444

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 1389
            TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 445  TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTY 504

Query: 1390 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 1563
            FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 505  FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSA 564

Query: 1564 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
            FWN             SH      E  ++ + + S +  LF ++R+ LD+L++I
Sbjct: 565  FWND---------TKKSHPSGSKHEL-NMDEFIGSKTDLLFEQVRDVLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
            PRB1Vacuolar proteinase B (yscB), a serine protease of
            the subtilisin family; involved in protein degradation in
            the vacuole and required for full protein degradation
            during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  499 bits (1285), Expect = e-170
 Identities = 260/475 (54%), Positives = 328/475 (69%), Gaps = 5/475 (1%)
 Frame = +1

Query: 316  SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 495
            S+ IP+RYI++FK G    ++  H++ V  A ++++  L    +FF +T+    +   + 
Sbjct: 176  SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTK----DTSLST 231

Query: 496  SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 675
            S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DSIV A++F+TQ  APWG
Sbjct: 232  SEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWG 291

Query: 676  LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 855
            LAR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+NI+H +FE RA WGKTIP ND D
Sbjct: 292  LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 351

Query: 856  YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASG 1035
             DGNGHGTHCAGTIASK YG            LR+NG+GTMSDV++GVEY    H+K + 
Sbjct: 352  LDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQ 411

Query: 1036 D--PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
            +    FKGSTANMSLGGGKS                     GNENQDACNTSPAS+ K I
Sbjct: 412  EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAI 471

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 1389
            TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 472  TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTY 531

Query: 1390 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 1563
            FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 532  FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSA 591

Query: 1564 FWNSKCDGCEQEKVSSSHGKADDFESESLMD-CLHSTSHSLFGEIRNFLDRLDLI 1725
            FWN         K S S G    F+ E  MD  + S +  +F ++R+ LD+L++I
Sbjct: 592  FWN-------DTKKSHSSG----FKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
            YEL060C
          Length = 695

 Score =  499 bits (1286), Expect = e-169
 Identities = 272/554 (49%), Positives = 342/554 (61%), Gaps = 11/554 (1%)
 Frame = +1

Query: 1    MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
            MK++  VLP+A  + LG+AL++P +  E +                              
Sbjct: 1    MKIEKTVLPIAALAALGSALVIPNLAKEDKDKLAINNKKFNDITDVVAKYSEQIIESARK 60

Query: 181  XXXXXXSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG 360
                   SV L      K++P+       +    V    A+ + NS  IP+RYIV+FK  
Sbjct: 61   IGKSVQDSVNL------KMAPLVT----PTPYPVVSGASANSNANSNIIPNRYIVVFKKS 110

Query: 361  VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS 540
            +   +V  H++L+    +E+ A+L     FF A+  +  E I+    +GGI   F I+  
Sbjct: 111  ILPEEVDFHKELINQIQLESAAKLPKDDKFFSAS-AIEDESIN----QGGILTTFNISNL 165

Query: 541  LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF 720
            L GY GYFTD +L+LIR + LV+ +E+DS+V A++F+ Q  APWGLAR+SHRERLNLGSF
Sbjct: 166  LNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSF 225

Query: 721  NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA 900
            NKYLYDD+AGKGVT YVIDTGIN +H +F  RA WGKTIP ND D DGNGHGTHCAGTIA
Sbjct: 226  NKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIA 285

Query: 901  SKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGD--PNFKGSTANMSL 1074
            S  YG            LR+NG+G+MSDV++GVE+    H KA+ +    FKGSTANMSL
Sbjct: 286  STHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKGSTANMSL 345

Query: 1075 GGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRAYFS 1254
            GGGKS                     GNENQDACNTSPAS+++ ITV ASTLSDDRAYFS
Sbjct: 346  GGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFS 405

Query: 1255 NWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTG 1434
            NWG CVDIFAPGLNILSTYIG D A ATLSGTSMASPHVAGLL YFLSLQP S SE++  
Sbjct: 406  NWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDP 465

Query: 1435 SSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCD--------GC 1590
            + ++P  +KKK++ Y SK++L ++P  T N LIFNG GG+LD  WN K          GC
Sbjct: 466  TELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQEEDIKVKGGC 525

Query: 1591 EQEK-VSSSHGKAD 1629
            + +K     HG  D
Sbjct: 526  DHKKHKGKKHGSKD 539

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
            YEL060C (REAL)
          Length = 608

 Score =  496 bits (1278), Expect = e-169
 Identities = 259/474 (54%), Positives = 325/474 (68%), Gaps = 5/474 (1%)
 Frame = +1

Query: 319  RAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARS 498
            + IP+RYI++FK GV       H++ V  A ++++  L    +FF +T     +   + S
Sbjct: 150  KIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTR----DSSLSTS 205

Query: 499  VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 678
              GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A+DF+TQ  APWGL
Sbjct: 206  ETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGL 265

Query: 679  ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 858
            AR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+N++H +FE RA WGKTIP ND D 
Sbjct: 266  ARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL 325

Query: 859  DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGD 1038
            DGNGHGTHCAGTIASK YG            LR+NG+GTMSDV++GVEY    H+K + +
Sbjct: 326  DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQAQE 385

Query: 1039 --PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCIT 1212
                FKGSTANMSLGGGKS                     GNENQDACNTSPAS+ K IT
Sbjct: 386  KKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAIT 445

Query: 1213 VAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYF 1392
            V ASTLSDDRAYFSNWG CVDIFAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL YF
Sbjct: 446  VGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYF 505

Query: 1393 LSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSF 1566
            LSLQP S SE++     S++P+ LK K++ Y +K++L +VP  T N LI+NGGG  L +F
Sbjct: 506  LSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQDLSAF 565

Query: 1567 WNSKCDGCEQEKVSSSHGKADDFESESLMD-CLHSTSHSLFGEIRNFLDRLDLI 1725
            WN      + +K  SS      F+ E  MD  + S +  +F ++R+ LD+L++I
Sbjct: 566  WN------DTKKSHSSR-----FKQELNMDEFIGSKTDLIFEQVRDVLDKLNII 608

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar to
            uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
            protease B or uniprot|P25036 Saccharomyces cerevisiae
            YOR003w YSP3
          Length = 468

 Score =  490 bits (1262), Expect = e-169
 Identities = 258/475 (54%), Positives = 323/475 (68%), Gaps = 8/475 (1%)
 Frame = +1

Query: 325  IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 504
            +PH+YIV+ K GV+   V    + V+ AH   I  L   H FF+       EG+      
Sbjct: 2    VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNA---EGLP----R 54

Query: 505  GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 684
            GGI+++F I    +G  GYF + ++ L+ +S +V+ +E+DS+VHAS+F+TQ  APWGLAR
Sbjct: 55   GGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLAR 114

Query: 685  VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 864
            +SHR+RLNLG+FNKYLYD+  G+GVTAYVIDTGIN+ HVEF+GRAQWGKTIP ND D DG
Sbjct: 115  ISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDG 174

Query: 865  NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKAS-GDP 1041
            NGHGTHCAGTIASK YG            L+++G+GTMSDV++GVEY    H K S  + 
Sbjct: 175  NGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNK 234

Query: 1042 NFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA 1221
             FKGSTANMSLGGGKS                     GNENQDACNTSPAS++K ITV A
Sbjct: 235  KFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA 294

Query: 1222 STLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGLLAYFLS 1398
            STLSDDRAYFSNWG CVDIFAPGLNILSTYIG ++   A+LSGTSMASPHVAGLL YFLS
Sbjct: 295  STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS 354

Query: 1399 LQPDSGSEYYTGS--SISPEALKKKIVAYGSKNLLNNVP-ARTANNLIFNGGGGSLDSFW 1569
            LQPDS SE+Y  S   ++P  LKKK++AY +KN+L ++P   + N LI+NG GG L  FW
Sbjct: 355  LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

Query: 1570 NSKCDGCEQEKVSSSHGKADDFESESLMDCL---HSTSHSLFGEIRNFLDRLDLI 1725
            NS     EQ         A +   +SL   +   H+ + SLFG++RN LD++++I
Sbjct: 415  NS-TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] {ON}
            Anc_6.14 YOR003W
          Length = 573

 Score =  493 bits (1270), Expect = e-169
 Identities = 255/474 (53%), Positives = 313/474 (66%), Gaps = 7/474 (1%)
 Frame = +1

Query: 325  IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 504
            IPHRYI+ FK  V   ++  HQ  +     ++IAQL   H +F++ EG+         ++
Sbjct: 125  IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGL--------DLQ 176

Query: 505  GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 684
              I + F I   L+GY GYFTD ++D IR + LV+ +EQDS V+ ++F+TQ GAPWGLAR
Sbjct: 177  QPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLAR 236

Query: 685  VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 864
            +SHRERLNLGSFNKYL+DD AG+GVTAYVIDTG+N++H +FEGRA WGKTIP+ND D DG
Sbjct: 237  ISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDG 296

Query: 865  NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH-----RKA 1029
            NGHGTHCAGTIASK YG            LR+NG+G+MSDVL+GVEY  A H      K 
Sbjct: 297  NGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKK 356

Query: 1030 SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
            SG   FKGSTANMSLGGGKS                     GNENQDACNTSPAS+K  I
Sbjct: 357  SG---FKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAI 413

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 1389
            TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL+Y
Sbjct: 414  TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSY 473

Query: 1390 FLSLQPDSGSEYYTG--SSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 1563
            FLSLQP+  SE+ T     I+P  LKK++++YG+K++L ++P  T N L+FNG G  L  
Sbjct: 474  FLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSD 533

Query: 1564 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
            FWN                K  D ES  +   L      L+ +      +++L+
Sbjct: 534  FWNI--------------SKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YEL060C
            (REAL)
          Length = 664

 Score =  496 bits (1276), Expect = e-168
 Identities = 254/474 (53%), Positives = 324/474 (68%), Gaps = 4/474 (0%)
 Frame = +1

Query: 316  SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 495
            ++ IP+RYI++FK  V   +   H++ V  A ++++  L    +FF +T     +   + 
Sbjct: 204  TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTR----DAALSS 259

Query: 496  SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 675
            S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A+DF+TQ  APWG
Sbjct: 260  SEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWG 319

Query: 676  LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 855
            LARVSHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+N++H +FE RA WGKTIP ND D
Sbjct: 320  LARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED 379

Query: 856  YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASG 1035
             DGNGHGTHCAGTIASK YG            LR+NG+GTMSDVL+GVEY    H+K + 
Sbjct: 380  LDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAE 439

Query: 1036 D--PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
            +    FKGSTANMSLGGGKS                     GNENQDACNTSPAS+ K I
Sbjct: 440  EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 499

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 1389
            TV ASTLSDDRAYFSN+G CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 500  TVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTY 559

Query: 1390 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 1563
            FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 560  FLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSA 619

Query: 1564 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
            FWN             SH  +   +  +L + + S +  +F ++R+ LD+L++I
Sbjct: 620  FWND---------TKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
            Anc_6.14
          Length = 704

 Score =  484 bits (1246), Expect = e-163
 Identities = 252/508 (49%), Positives = 327/508 (64%), Gaps = 5/508 (0%)
 Frame = +1

Query: 217  DDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDL 396
            DD++ K++P+        +  F D        + R +P++YI++FKD +   ++  H++L
Sbjct: 210  DDQDIKLAPLI-------TPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKEL 262

Query: 397  VTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGM 576
            ++    ++ ++L P H FF +T     E        GGI   F I   L GY GYFT  +
Sbjct: 263  ISEIQQQSASRLPPHHHFFHSTSEEEEESFR----NGGIISSFNINNILSGYSGYFTQEV 318

Query: 577  LDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKG 756
            +DLIR + LVK +E+DSIV  ++F TQ  APWGL+R+SHRERLNLGSFNKYLYDD+AGKG
Sbjct: 319  IDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKG 378

Query: 757  VTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXX 936
            VT +VIDTGIN++HV+F  RA WGKTIPSND D DGNGHGTHCAGTIAS  YG       
Sbjct: 379  VTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEV 438

Query: 937  XXXXXLRTNGTGTMSDVLRGVEYVVAEH-RKASGDPNFKGSTANMSLGGGKSXXXXXXXX 1113
                 LR+NG+G+MSDV++GVE+    H        ++KGSTANMSLGGGKS        
Sbjct: 439  VAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVN 498

Query: 1114 XXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGL 1293
                         GNENQDACN+SPAS++  ITV ASTLSDDRAYFSNWG CVD+FAPGL
Sbjct: 499  AAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGL 558

Query: 1294 NILSTYIG-SDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS---ISPEALK 1461
            NILSTY+G  +   ATLSGTSMASPHVAGLL YFLSLQPDS S ++   S   I+PE LK
Sbjct: 559  NILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLK 618

Query: 1462 KKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFES 1641
            KK++AY + ++L ++P  T N LI+NG GG +   WN K    EQ     +H    +FE+
Sbjct: 619  KKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWNGKVQ--EQAHEEPAHEDKINFEN 676

Query: 1642 ESLMDCLHSTSHSLFGEIRNFLDRLDLI 1725
                D +   +   F +IRN  +++++I
Sbjct: 677  LVDSDSMSGKTDLFFDQIRNVFEKMNII 704

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
            [2043 nt, 681 aa]
          Length = 680

 Score =  483 bits (1242), Expect = e-163
 Identities = 251/470 (53%), Positives = 314/470 (66%), Gaps = 4/470 (0%)
 Frame = +1

Query: 325  IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 504
            IP++YI++FK  V+  D+ +H+DL+  A  +  +  D   S                S+ 
Sbjct: 232  IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSS----------------SIL 275

Query: 505  GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 684
            GGIEE F +A    GY G+F + ++  IR S +V  +EQDSIVHA++ +TQ  APWGLAR
Sbjct: 276  GGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLAR 335

Query: 685  VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 864
            +SHR+ LNLGS+NKYLYDD AG+GVTAYVIDTGINI H EF GRA WGKTIP ND D DG
Sbjct: 336  ISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDG 395

Query: 865  NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGD-- 1038
            NGHGTHCAGTIASK YG            LR++G+GTMSDVL+GVEY    H+KA  +  
Sbjct: 396  NGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKK 455

Query: 1039 PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVA 1218
              FKGSTANMSLGGGKS                     GNENQDACN+SPA+S+  ITV 
Sbjct: 456  KGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVG 515

Query: 1219 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 1398
            ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL+YFLS
Sbjct: 516  ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLS 575

Query: 1399 LQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWN 1572
            +QPD+ SE+++   +SISP  LKKK++AY +KNL  ++P +T N L++N  G ++  FW 
Sbjct: 576  MQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634

Query: 1573 SKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDL 1722
             K      E  +  + +A +FE E L+D     + +    I+   +R+DL
Sbjct: 635  PK-----SESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDL 679

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] {ON}
            complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  474 bits (1220), Expect = e-163
 Identities = 235/427 (55%), Positives = 299/427 (70%), Gaps = 3/427 (0%)
 Frame = +1

Query: 304  LSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEG 483
            ++ NS  IP+ YIV+F +GVT  ++ +H + ++   ++++  L   H FF  +       
Sbjct: 28   ITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTS---SD 84

Query: 484  ISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTG 663
            +++  + GG+ +MF+I   L GY G FTD +++ +R S LVK IE+DS+VH ++  TQ  
Sbjct: 85   VNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYN 144

Query: 664  APWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPS 843
            APWGLAR+SHR RLNL +FNKYLYDD  GKGV AYVIDTGINI +V+F GRA WGKTIP+
Sbjct: 145  APWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPA 204

Query: 844  NDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHR 1023
             +A+ DGNGHGTH AGTIAS  YG            LR+NG G+MSDVL+GVEYVV  H+
Sbjct: 205  GEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQ 264

Query: 1024 KASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKK 1203
            +  G   FKGS ANMSLGGGKS                     GNENQDACNTSPA++++
Sbjct: 265  RDVGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAER 324

Query: 1204 CITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLL 1383
             ITV ASTLSD RAYFSNWG CV IFAPGLNILSTYIGS  A ATLSGTSMASPH+AGL+
Sbjct: 325  AITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLV 384

Query: 1384 AYFLSLQPDSGSEYYT---GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGS 1554
            AYFLSLQP   S++Y+    ++I+P+ LKKKIVA+G+KN L ++PA T N + +NG G S
Sbjct: 385  AYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKS 444

Query: 1555 LDSFWNS 1575
            L+ FWN+
Sbjct: 445  LEDFWNA 451

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
            Anc_6.14 YOR003W
          Length = 531

 Score =  466 bits (1199), Expect = e-159
 Identities = 240/460 (52%), Positives = 303/460 (65%), Gaps = 2/460 (0%)
 Frame = +1

Query: 331  HRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGG 510
            ++YI++FK+GVT   +  H+ L+    +ET                     +SA+ +   
Sbjct: 96   NKYIILFKEGVTAEQISAHKQLLQQVLLET-------------------SDVSAQGIVAD 136

Query: 511  IEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVS 690
            + + F++ G L GY    +  +L+L+R S  V+L+EQDS VH ++F+TQ  APWGLAR+S
Sbjct: 137  VLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARIS 196

Query: 691  HRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNG 870
            HR+ L+LGSFNKYLYDD AG+GV +Y+IDTGIN+ H EFEGRAQWGKTIP ND D DGNG
Sbjct: 197  HRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNG 256

Query: 871  HGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH--RKASGDPN 1044
            HGTHCAGTIASK YG            LR+NG+G+MSDV+ GVE+   +H  +  S D  
Sbjct: 257  HGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKK 316

Query: 1045 FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAAS 1224
            FKGSTANMSLGGGKS                     GNENQDACNTSPA+S++ ITV AS
Sbjct: 317  FKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGAS 376

Query: 1225 TLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQ 1404
            TLSDDRAYFSNWGSCVDIFAPGLNILSTY GSD A ATLSGTSMASPHVAGLL YFLSLQ
Sbjct: 377  TLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQ 436

Query: 1405 PDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCD 1584
            P+  S++ T + I+PE LKKK++ Y +K +L ++P  T N LI+NGGG  L  FW  K  
Sbjct: 437  PEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDK-- 494

Query: 1585 GCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNF 1704
            G +  K   +H   + + S    D +     ++FG++  F
Sbjct: 495  GKKSHKPLFAHEYDNVWASS---DAMFEQVRAMFGKLNIF 531

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
            YOR003W
          Length = 502

 Score =  454 bits (1167), Expect = e-154
 Identities = 229/424 (54%), Positives = 290/424 (68%), Gaps = 2/424 (0%)
 Frame = +1

Query: 307  SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGI 486
            +D    IPHRYI++FKDGV+   +  H++L+TT H++  +      + +  T+    E  
Sbjct: 52   ADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPE-- 109

Query: 487  SARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGA 666
            S R   GGI   F+I+  L GY  Y +D +L  IR + L+  IE D++VH +DF TQ  A
Sbjct: 110  SMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNA 169

Query: 667  PWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSN 846
            PWGLAR+SHRE LNL +FNKYLYDD+AGK V AYVIDTG++++HVEF  RA WGKTIP N
Sbjct: 170  PWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLN 229

Query: 847  DADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH-R 1023
            D D DGNGHGTH AGTI S+ YG            LR+NG+G+MSDV++GVE+ V+ H  
Sbjct: 230  DQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLE 289

Query: 1024 KASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKK 1203
            +   + N KGS ANMSLGGGKS                     GNENQ+ACN+SPAS+++
Sbjct: 290  RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349

Query: 1204 CITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGL 1380
             +TV AST+SD+RAYFSNWG CVDIFAPGLNILSTYIG +D   ATLSGTSMASPHVAGL
Sbjct: 350  AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409

Query: 1381 LAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLD 1560
            LAY+LSLQP+  SE+ T  +IS   LKKK++ Y +K++L ++P  T N LI+NGGG  L 
Sbjct: 410  LAYYLSLQPEKSSEFST-RAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLS 468

Query: 1561 SFWN 1572
             FWN
Sbjct: 469  DFWN 472

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
            YOR003W
          Length = 585

 Score =  425 bits (1092), Expect = e-142
 Identities = 246/508 (48%), Positives = 316/508 (62%), Gaps = 12/508 (2%)
 Frame = +1

Query: 199  SSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNS--RAIPHRYIVIFKDGVTDY 372
            S++ +V D  D++   +++    +S     ++LA+L DN    A   RYI++FK GV   
Sbjct: 92   SAMEMVKDVTDQILAYYQH----ASPASRGLELAALHDNGVGTADHDRYIIVFKKGVFKE 147

Query: 373  DVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISA-RSVEGGIEEMFEIAGSLRG 549
             V  H  +++        +  P  +           G SA R     + + FE+AG+  G
Sbjct: 148  QVDQHLKMMSALFRRLSEEQRPAAA----------PGASALRDGFDRVMDTFEVAGAFSG 197

Query: 550  YFGYFTDG-MLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSFNK 726
            Y        ++D IR + LV  +E+DS+VH+ D ETQ  APWGLAR+SHRE LNLG+FNK
Sbjct: 198  YIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLGNFNK 256

Query: 727  YLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIAS 903
            YLY  N AGKGVTAYV+DTGI++ H+EF  RA+WGKTIP ND D DGNGHGTHCAGTI S
Sbjct: 257  YLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGS 316

Query: 904  KTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRK------ASGDPNFKGSTAN 1065
            + YG            LR++G+GTMSDVL+GVE+V  EH K         + N+KG+TAN
Sbjct: 317  EHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATAN 376

Query: 1066 MSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRA 1245
            MSLGGGKS                     GNENQDACN+SPA+++  ITV ASTLSDDRA
Sbjct: 377  MSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRA 436

Query: 1246 YFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEY 1425
            YFSN+G CVDIFAPGLNILSTYIG++ A ATLSGTSMASPHVAGLL Y LSLQPD GSE+
Sbjct: 437  YFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEF 496

Query: 1426 YT-GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEK 1602
            Y   S ++P  +KKKI+ Y +KN L ++PA T N LI+NGG  S D FW S     +  K
Sbjct: 497  YVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FWASAA-APQSHK 554

Query: 1603 VSSSHGKADDFESESLMDCLHSTSHSLF 1686
            V     K + +   S +D +  +++  F
Sbjct: 555  V-----KTNRYSLGSFLDSIQDSNNHWF 577

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
            (REAL)
          Length = 478

 Score =  403 bits (1035), Expect = e-135
 Identities = 203/417 (48%), Positives = 271/417 (64%), Gaps = 2/417 (0%)
 Frame = +1

Query: 325  IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 504
            IP+RYIV+F + ++   +  H+ +V  AH  ++++L     F +         I+     
Sbjct: 67   IPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS----SIAPDLQL 122

Query: 505  GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 684
            GGI+  F+I G  RGY GYFTD +L+L+ +  L+K IEQ+S V  S+   Q  APWGL R
Sbjct: 123  GGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHR 182

Query: 685  VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 864
            +SHRE+   G   +YLY+D AG+GVT+YV+DTGI+ +H +FEGRA WG  IP ND   D 
Sbjct: 183  ISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDL 242

Query: 865  NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKAS--GD 1038
            NGHGTHCAG I SK YG            LR+NG GT+SDV++G+EYV  EH ++S    
Sbjct: 243  NGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKS 302

Query: 1039 PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVA 1218
              FKGSTAN+SLG  KS                     GNEN+DAC +SPA ++K ITV 
Sbjct: 303  KEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVG 362

Query: 1219 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 1398
            AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+YFLS
Sbjct: 363  ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLS 422

Query: 1399 LQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 1569
            LQP   SEY+  +++SP+ LK+K++ + +  +L ++   T N LI+NGGG  LD  W
Sbjct: 423  LQPAPDSEYF-DNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
            precursor to the subtilisin-like protease III
          Length = 478

 Score =  402 bits (1033), Expect = e-134
 Identities = 198/417 (47%), Positives = 274/417 (65%), Gaps = 2/417 (0%)
 Frame = +1

Query: 325  IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 504
            +P+RY+++F + ++   +  H  +V   H  ++ +L    +F+          +S++S  
Sbjct: 67   LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISS----SVSSKSQF 122

Query: 505  GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 684
            GGI+  F+I G  RGY GYFTD ++ +I +  ++K +EQ++ V  S+   Q  APWGL R
Sbjct: 123  GGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHR 182

Query: 685  VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 864
            VSHRE+   G   +YLY+D AGKGVT+YV+DTGI+ +H +FEGRA+WG  IP+ND   D 
Sbjct: 183  VSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDL 242

Query: 865  NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN 1044
            NGHGTHCAG I SK +G            LR+NG GT+SDV++G+EYV  EH ++S   N
Sbjct: 243  NGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKN 302

Query: 1045 --FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVA 1218
              FKGSTAN+SLG  KS                     GNE++DAC +SPA ++K ITV 
Sbjct: 303  KEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVG 362

Query: 1219 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 1398
            AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMASPHVAG+L+YFLS
Sbjct: 363  ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLS 422

Query: 1399 LQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 1569
            LQP   SE++  +  SP+ LK+K++ + ++ +L ++   T N LI+NGGG  LD FW
Sbjct: 423  LQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
            (REAL)
          Length = 476

 Score =  396 bits (1018), Expect = e-132
 Identities = 199/420 (47%), Positives = 276/420 (65%), Gaps = 2/420 (0%)
 Frame = +1

Query: 316  SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 495
            + ++P+RYI+ F +  +   +  H+ ++     E++++L    +FF +T           
Sbjct: 64   AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQF--- 120

Query: 496  SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 675
               GGI+  F+I G  RGY GYFT+ ++  + +  ++K IEQ+S V  ++   Q  APWG
Sbjct: 121  ---GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWG 177

Query: 676  LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 855
            L R+SHRE+   G   +YLY+D AG+GVT+YV+DTGI+I+H +FEGRA WG  IP ND  
Sbjct: 178  LHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEA 237

Query: 856  YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKAS- 1032
             D NGHGTHCAG I S+ +G            LR+NG GT+SDV++G+EYVV +H  +S 
Sbjct: 238  SDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSK 297

Query: 1033 -GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
             G P FKGSTAN+SLG  KS                     GNE++DAC +SPA ++K I
Sbjct: 298  KGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSI 357

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 1389
            TV AST SDDRA+FS+WG+CVD+FAPG+NILSTYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 358  TVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSY 417

Query: 1390 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 1569
            FLSLQP S SE++  S++SP+ LK+KI+ + ++ +L +V   T N LI+NGGG  LD+FW
Sbjct: 418  FLSLQPSSDSEFF-DSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
            (REAL)
          Length = 482

 Score =  393 bits (1009), Expect = e-131
 Identities = 196/420 (46%), Positives = 269/420 (64%), Gaps = 2/420 (0%)
 Frame = +1

Query: 316  SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 495
            S+++P+RYI++F + +T+  +  H  ++  A   +++++    SF            S  
Sbjct: 66   SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSA----SASPN 121

Query: 496  SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 675
               GGI+  F+I G  RGY GYFTD +++++ +  LVK IE +S V  S+   Q  APWG
Sbjct: 122  PQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWG 181

Query: 676  LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 855
            L R+SHRER   G   +YLY+D AG GVT+YV+DTGI+ +H +FEGRA+WG  IP ND  
Sbjct: 182  LHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA 241

Query: 856  YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKAS- 1032
             D NGHGTHCAG I S+ +G            LR+NG GT+SDV++G+EYV   H  +S 
Sbjct: 242  SDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSK 301

Query: 1033 -GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
                 FKGSTAN+SLG  KS                     GNE++DAC +SPA ++K I
Sbjct: 302  KRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSI 361

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 1389
            TV AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 362  TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSY 421

Query: 1390 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 1569
             LSLQP   SE++   ++SP+ LK+KI+ + ++ +L +V   T N L++NGGG  LD FW
Sbjct: 422  LLSLQPAQDSEFFY-DTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar to
            uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3 or
            uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  389 bits (998), Expect = e-129
 Identities = 207/423 (48%), Positives = 264/423 (62%), Gaps = 2/423 (0%)
 Frame = +1

Query: 313  NSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISA 492
            N   IP+RYIV+FKD VTD ++  H   +   +  +I   D      D  +   +  IS 
Sbjct: 70   NDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDS-----DFGKATQYNDIST 124

Query: 493  RSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPW 672
            R +  G++  F I  S+ GY GYFT+     I  S LV+L+E DSIV  ++++ Q   PW
Sbjct: 125  RGI--GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPW 182

Query: 673  GLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDA 852
            GL R+S RE+L +     Y YDD  GK    +VIDTGI +DH +FEGRA WGKTI  ND 
Sbjct: 183  GLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDN 242

Query: 853  DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVV-AEHRKA 1029
            DYD NGHGTHCAGTIASK YG            LR++G+G+MSDV+RGVEY V A +   
Sbjct: 243  DYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLK 302

Query: 1030 SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
                N KG+  NMSLG  KS                     GNE+ DACN+SPAS+   I
Sbjct: 303  KTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPI 362

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 1389
            TV  STLSDD A+FSN+G CVDIFAPG+NI+STYIGS  A  +LSGTSM+SPHVAG+LAY
Sbjct: 363  TVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAY 422

Query: 1390 FLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSF 1566
            +LSLQPD  S++Y   S+ISP+ LKKK++ Y +   L+ +PA T N L++NGGG +L  F
Sbjct: 423  YLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKF 482

Query: 1567 WNS 1575
            W +
Sbjct: 483  WGT 485

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
            YOR003W
          Length = 456

 Score =  343 bits (879), Expect = e-112
 Identities = 176/351 (50%), Positives = 226/351 (64%), Gaps = 1/351 (0%)
 Frame = +1

Query: 520  MFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRE 699
            +F+I  +L GY        L L+R+  +V+LIE DS VHA   + Q   PWGL+R+S R 
Sbjct: 107  IFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRP 166

Query: 700  RLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGT 879
            R+ +G    Y YDD     VTAYV+DTGI I H +F GRA+WGKTI  ND D D +GHGT
Sbjct: 167  RVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGT 226

Query: 880  HCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNF-KGS 1056
            H AG IAS  +G            LR+NG G MSDVL+G+E+VV +H K   + N+ KGS
Sbjct: 227  HVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK---NKNYSKGS 283

Query: 1057 TANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSD 1236
              N+SLG  KS                     GNEN DAC TSPA +++ ITV AS  SD
Sbjct: 284  VVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSD 343

Query: 1237 DRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSG 1416
            +RA+FSNWG CVD+FAPG+N++STYIGSD A  +LSGTS A+P+ AGL+AY+LSLQPD  
Sbjct: 344  ERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKD 403

Query: 1417 SEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 1569
            S Y+TG  ++P  LK+KIVA+GSK++L  +P  T N +I+NG G +L  FW
Sbjct: 404  SGYFTG-EMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  322 bits (826), Expect = e-104
 Identities = 178/424 (41%), Positives = 237/424 (55%), Gaps = 7/424 (1%)
 Frame = +1

Query: 325  IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 504
            IP++YIV+FK   TD     H   + +  + T  Q    HSF                  
Sbjct: 53   IPNQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYTILHSF------------------ 94

Query: 505  GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 684
                   ++A  L+GY     + ++  +    +++ IEQDS VHA   + Q  +PWGLAR
Sbjct: 95   -------QLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLAR 147

Query: 685  VSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTI-PSNDADY 858
            +S RERL L     Y YDD+ A      Y++DTGIN +H EF+GRA+WG    P      
Sbjct: 148  ISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQE 207

Query: 859  DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHR---KA 1029
            D NGHGTHCAG I S  YG            L   G G MS V+RG+EYV  +H    K 
Sbjct: 208  DENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKK 267

Query: 1030 SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
                 FKGS  N+SLG GKS                     GNE+ DAC+TSPA S   +
Sbjct: 268  QDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHAL 327

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGLLA 1386
            TV AS+ SDDR +FSNWG CVD+FAPG+NI+STYIG  +    +LSGTSM++P V GL+A
Sbjct: 328  TVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIA 387

Query: 1387 YFLSLQPDSGSEYYTG-SSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 1563
            YFLSLQPD+ S++YTG +S +P  LK KI+++ ++ +L+ +P  T N +++NGGG SL  
Sbjct: 388  YFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKD 447

Query: 1564 FWNS 1575
            FWN+
Sbjct: 448  FWNN 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  316 bits (809), Expect = e-101
 Identities = 172/434 (39%), Positives = 243/434 (55%), Gaps = 17/434 (3%)
 Frame = +1

Query: 325  IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 504
            IP +YIV+F++  TD  +   +  +++   E   + +   ++                  
Sbjct: 63   IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY------------------ 104

Query: 505  GGIEEMFEIAGSLRGYF------GYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGA 666
              +   F+I+   +G         +  D   ++     ++K+IE+DS VH + F TQ  +
Sbjct: 105  SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDS 164

Query: 667  PWGLARVSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPS 843
             WGL+R+S R  L L     Y YDDN +GKGV  Y++DTGIN +H+EFEGRA WG ++P 
Sbjct: 165  SWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPV 224

Query: 844  NDADY-DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH 1020
             +    D NGHGTHCAG I SKTYG            L   G G+MSDV+ G+E+V   H
Sbjct: 225  TEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSH 284

Query: 1021 RKASGD--------PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDAC 1176
               + +          FKGS  N+SLG  KS                     GNE++DAC
Sbjct: 285  TNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDAC 344

Query: 1177 NTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTS 1353
             TSPA S   ITV AS+ SDDRA+FSNWG CVD+FAPG+NI STYIG ++    +LSG+S
Sbjct: 345  MTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSS 404

Query: 1354 MASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLI 1533
            M+SP V+GL AY+LSLQPD  S+++  S ++P+ LK+KI+ + +  +L  +P  TAN L+
Sbjct: 405  MSSPFVSGLTAYYLSLQPDVSSQFH-DSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLV 463

Query: 1534 FNGGGGSLDSFWNS 1575
            +NGGG  L  FWN+
Sbjct: 464  YNGGGKDLSGFWNA 477

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  284 bits (726), Expect = 2e-89
 Identities = 151/345 (43%), Positives = 207/345 (60%), Gaps = 3/345 (0%)
 Frame = +1

Query: 517  EMFEIAGSLRGY-FGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSH 693
            E F IA  L G+    F    +  + +   V+++E +S V+A +   Q   PWGL R+S 
Sbjct: 75   EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 694  RERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNG 870
            R+R+ +G    Y YD   + K V  Y++DTGI +DH EFEGRA+WGKTI  ND D D NG
Sbjct: 135  RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 871  HGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFK 1050
            HGTHCAG +   TYG            L   G G MSDV+RG+E+ V EH   + D   +
Sbjct: 195  HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQD-EVR 253

Query: 1051 GSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTL 1230
            GS  N+SLG G+S                     GNE+ +AC +SPA+    +TV  ST 
Sbjct: 254  GSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTF 313

Query: 1231 SDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGLLAYFLSLQP 1407
            SDDRA+FSNWG C+D+FAPG+N+ S+Y+G +     +LSGTS ++PHVAGL+AY LSL+P
Sbjct: 314  SDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEP 373

Query: 1408 DSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 1542
            D+ S+++T  S +P  LK+K+V+  ++  L  VP  TAN +IFNG
Sbjct: 374  DTKSQFHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
            similarities with uniprot|P09232 Saccharomyces cerevisiae
            YEL060c or uniprot|P25036 Saccharomyces cerevisiae
            YOR003w YSP3
          Length = 579

 Score =  266 bits (681), Expect = 5e-81
 Identities = 156/461 (33%), Positives = 238/461 (51%), Gaps = 10/461 (2%)
 Frame = +1

Query: 295  LASLSDN----SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDAT 462
            +A L +N    +  +P+RYIV+FK+     ++ +H   V    +     L P   FF   
Sbjct: 55   VAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFF--- 111

Query: 463  EGMHHEGISARSVE--GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVH 636
               HH      S E  GG+   F+I     GY GYFTD +++ IR+  +V  +E DSI+ 
Sbjct: 112  ---HHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILT 168

Query: 637  ASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGR 816
              D ET + + W LAR+SHR +L L +FN+Y +D N G+ + AY++DTG+   H  +  R
Sbjct: 169  IDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIER 228

Query: 817  AQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRG 996
               G  I  N+ + D NGHGT  AG +  +  G            L   G GT+S++++G
Sbjct: 229  TIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKG 288

Query: 997  VEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDAC 1176
            + +V   H +        G+    S+ G KS                     G +  +AC
Sbjct: 289  LSFVNHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINAC 348

Query: 1177 NTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSD----TAVATLS 1344
            N+SPASS K ITVA  +++D+     NWGSCVDI+ PG  + +TY   +    T   +++
Sbjct: 349  NSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVT 408

Query: 1345 GTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTAN 1524
            G+S A+  VAGLLAYF SLQP  G+       ++PE LK++++ +G+K  L N+   + N
Sbjct: 409  GSSAAAAQVAGLLAYFASLQPGLGTPDVI--PLTPEELKERLIDFGTKGKLTNLERMSPN 466

Query: 1525 NLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESES 1647
             + FNG GG+LDSF+N   DG E    ++ +    D  +E+
Sbjct: 467  IIAFNGAGGNLDSFFN---DGSEIVPTATKNVDPSDVPTET 504

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  165 bits (418), Expect = 3e-44
 Identities = 140/427 (32%), Positives = 188/427 (44%), Gaps = 46/427 (10%)
 Frame = +1

Query: 400  TTAH--METIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDG 573
            T AH  + ++   D   SF D+T    H  +    + G I + F   GS RG     T  
Sbjct: 19   TAAHEYLVSLKNSDSIQSFMDSTYA--HGQLMKDYLHGKISKTFSF-GSFRGLTVNLTKD 75

Query: 574  MLDLIRESGLVKLIEQDSIVHASDFE--------------------------TQTGAPWG 675
            ++  I+E+ LV  +  +  +HA D++                           Q GAP  
Sbjct: 76   VVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDKNSYLVKVQNGAPRH 135

Query: 676  LARVSHRERLNLGSFNKYLYDDNA---------GKGVTAYVIDTGINIDHVEFEGRAQWG 828
            LAR+S R  L     +K  Y+D+          G  V AY+ID+GI+I+  EFEGRA  G
Sbjct: 136  LARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDINQEEFEGRATHG 195

Query: 829  KTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYV 1008
              + + +   D NGHGTH AG + SKTYG            L   G+G++  V+  +E+V
Sbjct: 196  LDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSGSLITVISALEFV 254

Query: 1009 VAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSP 1188
            V    K+      K   AN+SLG                         GN N DAC  SP
Sbjct: 255  VNHCGKSKS----KKCVANLSLGAFMMPLLNEAIKATVDSGVVVVVAAGNGNIDACWCSP 310

Query: 1189 ASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSM 1356
            AS K  ITV A    DDR    A FSNWGSCVDIFAPG+ I S  I  +      SGTSM
Sbjct: 311  ASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAPGVAISSLSIKDNQKSVEFSGTSM 367

Query: 1357 ASPHVAGLLAYFLSLQPDSGSEY-----YTGSSISPEALKKKIVAYGSKNLLNNVPARTA 1521
            ASP VAG+++  L    D G E      Y     + +  +K+ + +           RT 
Sbjct: 368  ASPQVAGIVSILL----DQGVENEDIRDYLFELATDDVFQKRTLLF---------KPRTP 414

Query: 1522 NNLIFNG 1542
            N + FNG
Sbjct: 415  NRITFNG 421

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] {ON}
            Anc_6.313 YCR045C
          Length = 436

 Score =  164 bits (414), Expect = 5e-44
 Identities = 115/318 (36%), Positives = 149/318 (46%), Gaps = 11/318 (3%)
 Frame = +1

Query: 655  QTGAPWGLARVSHRERLNL----------GSFNKYLYDDNAGKGVTAYVIDTGINIDHVE 804
            Q GAP  L+R+S R +L            GSFN Y  + + G G+ AY+IDTGI  +H E
Sbjct: 114  QRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAE 173

Query: 805  FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSD 984
            F GRA +G+ + + +   DGNGHGTH AG + S  YG            L   G G ++ 
Sbjct: 174  FGGRAVFGEDL-TGEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTT 232

Query: 985  VLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNEN 1164
            V+  +E+ V   R + G    KG   N+SLG  ++                     GN N
Sbjct: 233  VISAMEFAVNHCRSSEG----KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSN 288

Query: 1165 QDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATL 1341
             +AC  SPAS+ + ITV A    +D  A FSNWGSCVDIFAPG+ + S            
Sbjct: 289  INACLNSPASAPEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILF 348

Query: 1342 SGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTA 1521
            SGTSMASP + GL A  L    D G  Y     I    LK        +  L   P  T 
Sbjct: 349  SGTSMASPSITGLAAILL----DEGVPY---DKIKDYILKMATNDVFQRRTLVFKPG-TP 400

Query: 1522 NNLIFNGGGGSLDSFWNS 1575
            N + FNG   + D F N+
Sbjct: 401  NRVAFNGVKKNDDKFSNA 418

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
            Anc_6.313
          Length = 492

 Score =  164 bits (414), Expect = 1e-43
 Identities = 142/421 (33%), Positives = 197/421 (46%), Gaps = 43/421 (10%)
 Frame = +1

Query: 409  HMETIAQLDPGHSFFDATEGMHHEGISARS-VEGGIEEMFEIAGSLRGYFGYFTDGMLDL 585
            ++ ++ Q D   SF D+T      G S +  +   I + F I GS +G+    TD +L+ 
Sbjct: 26   YLVSLKQNDSIQSFMDSTIT---RGRSVKEYLRDKIGKTFSI-GSFKGFTVDLTDDLLEA 81

Query: 586  IRESGLVKLIEQDSIVHASD------------------------FETQTGAPWGLARVSH 693
            I+++ LV  +  +  VHA +                         + Q GAP  LAR+S 
Sbjct: 82   IKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSVKVQYGAPRHLARLSR 141

Query: 694  RERLNLGSFNK--------YLYDDNA-GKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSN 846
            R++L     +K        Y YD  + G  V AY+ID+GI ++H EF GRA  G  + + 
Sbjct: 142  RKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLEHEEFNGRAIPGIDL-TG 200

Query: 847  DADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRK 1026
            +   D NGHGTH AG + SK+YG            L   G G+++ VL G+E+ V   ++
Sbjct: 201  EGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLAMVLGGIEFAVKHCQE 260

Query: 1027 ASGDPNFKGS-TANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKK 1203
             S     KG   AN+SLG  ++                     GN N +AC  SPAS+ +
Sbjct: 261  TSK----KGRCVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAGNNNLNACWYSPASAPE 316

Query: 1204 CITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHV 1371
             ITV A    DDR    A FSNWG C+DIFAPG+ I S  I  D    T SGTSMASP V
Sbjct: 317  AITVGAF---DDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKDKEDVTYSGTSMASPTV 373

Query: 1372 AGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----VPARTANNLIFN 1539
            AGL A  L    D G        +S E +K  I+  G+ N+ +         T N + FN
Sbjct: 374  AGLAALTL----DQG--------VSAEEVKDYILEMGTDNVFHRRSLLFKPGTPNKICFN 421

Query: 1540 G 1542
            G
Sbjct: 422  G 422

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
            (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  164 bits (414), Expect = 2e-43
 Identities = 119/335 (35%), Positives = 164/335 (48%), Gaps = 19/335 (5%)
 Frame = +1

Query: 655  QTGAPWGLARVSHRERL--------NLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEF 807
            Q GAP  L R+S R +L            F  Y Y+D   G  + AY++DTGI  +H +F
Sbjct: 154  QYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPDF 213

Query: 808  EGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDV 987
            E R   G  + + +   D NGHGTH AG + SKT+G            L   G+G ++ V
Sbjct: 214  ENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTTV 272

Query: 988  LRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQ 1167
            L G+++ V +H +   +   K   ANMSLG  ++                     GN N 
Sbjct: 273  LSGIQFAV-DHCRLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNSNV 331

Query: 1168 DACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYIGSDTA 1329
             AC TSPAS+K  ITV A    DDR    AYFSNWG+CVDIFAPG+ I  LS    S   
Sbjct: 332  SACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESHHK 388

Query: 1330 VATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVP 1509
              T SGTSMASP VAGL A  L    D G        + P  +K K++   +K++ N + 
Sbjct: 389  HVTHSGTSMASPVVAGLAAILL----DKG--------VEPFDVKDKLLHLSTKDVFNKLT 436

Query: 1510 A----RTANNLIFNGGGGSLDSFWNSKCDGCEQEK 1602
                  T N + +NG    ++ F+ ++ D  ++E+
Sbjct: 437  LFFKYGTPNKIAYNG----IEDFFENEDDAVDEEE 467

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
            (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  162 bits (411), Expect = 2e-43
 Identities = 123/326 (37%), Positives = 165/326 (50%), Gaps = 22/326 (6%)
 Frame = +1

Query: 655  QTGAPWGLARVSHRERL--NLGSFNKYLYDDNA----------GKGVTAYVIDTGINIDH 798
            Q  AP  L+R+S R +L  ++ + ++Y   DNA          G  V AY+IDTGI  +H
Sbjct: 115  QREAPRHLSRLSRRGQLPYDINNIDRY---DNAFDYYFDAKYQGSSVNAYIIDTGIYKEH 171

Query: 799  VEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTM 978
             EFEGR ++   + + +   D NGHGTH AG + SKT+G            L   G G +
Sbjct: 172  PEFEGRVKFAIDL-TQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQL 230

Query: 979  SDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGN 1158
            S +L+ +E+ +  H K S D   K   AN+S G  ++                     GN
Sbjct: 231  STILKALEFTI-RHCKESVD---KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGN 286

Query: 1159 ENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYIGS 1320
             N DAC  SPASSK  ITV A    DDR    A FSNWGSCVD+FAPG+ +  LS   GS
Sbjct: 287  SNIDACWNSPASSKDVITVGAF---DDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGS 343

Query: 1321 DTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLN 1500
            D  V  LSGTSMASP V+G+ A  L    D G        ++P+ +K KI+   +KN+ +
Sbjct: 344  D--VLLLSGTSMASPSVSGIAAILL----DKG--------LNPKFVKSKIIESSTKNIFH 389

Query: 1501 N----VPARTANNLIFNGGGGSLDSF 1566
                 +   T N ++FNG     DSF
Sbjct: 390  QGTIMIKPNTPNLIVFNGIEKMDDSF 415

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
            {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
            YCR045c
          Length = 517

 Score =  157 bits (398), Expect = 3e-41
 Identities = 150/473 (31%), Positives = 203/473 (42%), Gaps = 50/473 (10%)
 Frame = +1

Query: 274  QDFVDMKLASLSDNSRAIPHRYIVIFKDG-VTDYDVGMHQD-LVTTAHMETIAQLDPGHS 447
            Q F+D +L      S+ I  R I  +  G    + + +  + L+       ++Q+ P  S
Sbjct: 30   QRFMDSQLVQEILESKPIRKRIIKTYSFGNFRGFVIDLPNEWLIKIRRSPFVSQVVPNFS 89

Query: 448  F--FDA----TEGMHHEGISARSVEGGIEEMFEIAGS-LRG---YFGYFTDGMLDLIRES 597
            F  FD     +E      I AR   GG  E+        RG   YF  F     D+ + +
Sbjct: 90   FKAFDEETALSEVYRGRTIVARGENGGSPELQGFKKEECRGDSVYFDKFEASGKDMPQVN 149

Query: 598  GLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDNAG 750
            G  KL+ +         +TQ+ AP  LAR+S R +L             FN Y Y  + G
Sbjct: 150  G--KLLSRY-------IKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQG 200

Query: 751  KGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXX 930
            + V AYV+D+G+ IDH +FEGRA +G     +    D NGHGTH AG I SKTYG     
Sbjct: 201  RSVNAYVLDSGVMIDHCDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKV 260

Query: 931  XXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASG---------------------DPNF 1047
                   L + G+GT+  V+ G+E+ V+ H    G                     D   
Sbjct: 261  NIIDVKVLDSVGSGTLDTVMSGLEF-VSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVES 319

Query: 1048 KGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA-S 1224
            K    N+SLG  +S                     GN N +AC TSPAS    ITV A  
Sbjct: 320  KRCVINLSLGTFRSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGAFD 379

Query: 1225 TLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQ 1404
               D  A FSNWG+CVDIFAPG+ + S            +GTSMA+P V GL+A  L   
Sbjct: 380  DRIDSIAKFSNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL--- 436

Query: 1405 PDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPAR-------TANNLIFNG 1542
             DSG        I P  +KK++    + N+    P R       T N + FNG
Sbjct: 437  -DSG--------IKPTQIKKRLNELATDNIF---PRRTLLFKPGTPNRIAFNG 477

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
            YCR045C (REAL)
          Length = 527

 Score =  156 bits (394), Expect = 1e-40
 Identities = 118/363 (32%), Positives = 167/363 (46%), Gaps = 14/363 (3%)
 Frame = +1

Query: 628  IVHASDFETQTGAPWGLARVSHRERLNLGS---------FNKYLYDDNAGKGVTAYVIDT 780
            I  A +   Q  AP  LAR+S   +L             FN Y  D+  G+GV AY++DT
Sbjct: 152  IDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDT 211

Query: 781  GINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRT 960
            GI+ +H EFE R   G  + + +   D NGHGTH AG + S+T+G            L  
Sbjct: 212  GIHAEHPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGK 270

Query: 961  NGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXX 1140
            +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S                 
Sbjct: 271  DGSGEASNVLSGLEFIV-EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVF 329

Query: 1141 XXXXGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIG 1317
                GN N DA   SPAS++  ITV A     D  A FSNWG CV+IFAPG+ I S    
Sbjct: 330  VAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHL 389

Query: 1318 SDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLL 1497
            +D     LSGTSM++P V G+ A  LS              I PE + ++I    ++N+ 
Sbjct: 390  NDNESLVLSGTSMSTPIVTGVAAVLLS------------KGIEPELIAQEIEYLSTRNVF 437

Query: 1498 NN----VPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLH 1665
            +         T N +++NG     D + +        E ++    + +     ++ D LH
Sbjct: 438  HRRTLFFKPSTPNQILYNGVDKLDDPYDDETFPRLNVEAIAKELEEYNATLQGAMTDDLH 497

Query: 1666 STS 1674
            S S
Sbjct: 498  SGS 500

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar to
            uniprot|P25381 Saccharomyces cerevisiae YCR045C
            Hypothetical ORF
          Length = 490

 Score =  155 bits (392), Expect = 2e-40
 Identities = 112/312 (35%), Positives = 147/312 (47%), Gaps = 14/312 (4%)
 Frame = +1

Query: 649  ETQTGAPWGLARVSHRERLNLG---------SFNKYLYDDNAGKGVTAYVIDTGINIDHV 801
            + Q  AP  LAR+S R  L            SFN Y Y  + G+ + AY+IDTGI  +H 
Sbjct: 124  KVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHK 183

Query: 802  EFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMS 981
            +F GRA +G+   + +   D NGHGTH AG + S  +G            L   G G ++
Sbjct: 184  DFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLT 242

Query: 982  DVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNE 1161
             V+  VE+ V  H K+SG    KG  AN+SLG  ++                     GN 
Sbjct: 243  TVISAVEFAV-NHCKSSGK---KGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNS 298

Query: 1162 NQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVAT 1338
            N +AC  SPAS+ + ITV A    +D  A FSNWG CVDIFA G+ + S           
Sbjct: 299  NINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIA 358

Query: 1339 LSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----V 1506
             SGTSMASP V GL+A  L    D G        + PE +K K+V   + +LL       
Sbjct: 359  FSGTSMASPSVTGLVAILL----DKG--------VEPENIKAKLVELATHDLLQRRTLFF 406

Query: 1507 PARTANNLIFNG 1542
               T N + FNG
Sbjct: 407  KPGTPNRIAFNG 418

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
            Anc_6.313 YCR045C
          Length = 734

 Score =  158 bits (399), Expect = 2e-40
 Identities = 127/375 (33%), Positives = 174/375 (46%), Gaps = 20/375 (5%)
 Frame = +1

Query: 640  SDFETQTGAPWGLARVSHRERL-----NLGSFNK---YLYDDN-AGKGVTAYVIDTGINI 792
            S F+ Q GAP  LAR+S R++L     N   F +   Y YDDN  G+GV AYVIDTGI  
Sbjct: 282  SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 793  DHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTG 972
            +H +FE R ++G  +    A  D NGHGTH AG I SKTYG            +   G+ 
Sbjct: 342  EHKDFEDRVEFGTDLTGEGAG-DLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 973  TMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXX 1152
             +S ++  +EY V +    +   + K    NMSLG                         
Sbjct: 401  QLSHIIEAIEYTVND---CNSRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAA 457

Query: 1153 GNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGS 1320
            GN N DAC +SP SSK  ITV A    DDR    A FSNWG CVDIFA G+ + S     
Sbjct: 458  GNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQV 514

Query: 1321 DTAVATLSGTSMASPHVAGLLAYFLS--LQPDSGSEYYTGSSISPEALKKKIVAYGSKNL 1494
                   SGTSMASP V G ++  LS  ++P+   E     S   +  ++ ++       
Sbjct: 515  PYKYIKYSGTSMASPIVCGFVSILLSQGVKPNDVQEEMVKLSTKGDFTRRSLI------- 567

Query: 1495 LNNVPARTANNLIFNGGGGSLDSFWNSKCDG-----CEQEKVSSSHGKADDFESESLMDC 1659
                   T+N ++FN G    DS+ N + +       E+E +  +  K    +S  L+  
Sbjct: 568  ---FKPFTSNRILFN-GMDPRDSYENDEMENDCGEDYEEEIIDRNSNKLLMEKSSKLV-- 621

Query: 1660 LHSTSHSLFGEIRNF 1704
            L      ++ +IRNF
Sbjct: 622  LDLDLDLIYEDIRNF 636

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
            YCR045C (REAL)
          Length = 491

 Score =  154 bits (388), Expect = 5e-40
 Identities = 118/327 (36%), Positives = 157/327 (48%), Gaps = 16/327 (4%)
 Frame = +1

Query: 610  LIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGS---------FNKYLYDDNAGKGVT 762
            L E+ +I + SD      AP  LAR+S   +L             FN Y  DD  G+ V 
Sbjct: 116  LDEEQNITYQSD------APRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVN 169

Query: 763  AYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXX 942
            AY++DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG         
Sbjct: 170  AYIMDTGIFADHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVE 228

Query: 943  XXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXX 1122
               L  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S           
Sbjct: 229  VKVLGKDGSGEASNVLSGLEFIV-EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAI 287

Query: 1123 XXXXXXXXXXGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNI 1299
                      GN N DA   SPAS++  ITV A     D  A FSNWG CV+IFAPG+ I
Sbjct: 288  EEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEI 347

Query: 1300 --LSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIV 1473
              LS    +DT V  LSGTSM++P V G+ A  LS              I PE + +++ 
Sbjct: 348  ESLSHLNFNDTLV--LSGTSMSTPIVTGVAAVLLS------------KGIEPEMIAQELE 393

Query: 1474 AYGSKNLLNN----VPARTANNLIFNG 1542
               ++N+ +         T N +++NG
Sbjct: 394  YLSTRNVFHRRTLFFKPSTPNQILYNG 420

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
            Anc_6.313 YCR045C
          Length = 475

 Score =  153 bits (386), Expect = 8e-40
 Identities = 121/373 (32%), Positives = 170/373 (45%), Gaps = 27/373 (7%)
 Frame = +1

Query: 505  GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASD------------F 648
            G I + F+I G L+G     +  +LD I+    VK +  + +V A +             
Sbjct: 50   GKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 649  ETQTGAPWGLARVSHRERLNLGSFNKYLYDDN---------AGKGVTAYVIDTGINIDHV 801
            + Q GAP  LAR+S R +L     NK  Y D+          G    AY++DTG+  DH 
Sbjct: 109  KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 802  EFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMS 981
            EFE R ++G T  + + + D NGHGTH AG + SKT+G            L   G GT+ 
Sbjct: 169  EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 982  DVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNE 1161
             +L  +E+ V + ++            NMSLG  KS                     GN 
Sbjct: 228  SILSALEFAVQDCQEHEDSQ----CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNF 283

Query: 1162 NQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSDTA 1329
            N +AC TSP+S+   ITV A    DDR    A FSNWG CVDIFAPG+N+ S       +
Sbjct: 284  NMNACWTSPSSATGAITVGAF---DDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDWPS 340

Query: 1330 VATLSGTSMASPHVAGLLAYFL--SLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN 1503
                SGTSMASP V G++A  L   + P+   +Y    +      K+ +V          
Sbjct: 341  FVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELATDGVFKKRTLV---------- 390

Query: 1504 VPARTANNLIFNG 1542
                T N++++NG
Sbjct: 391  FKPGTPNSVLYNG 403

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
            YCR045C (REAL)
          Length = 540

 Score =  154 bits (389), Expect = 8e-40
 Identities = 116/323 (35%), Positives = 154/323 (47%), Gaps = 16/323 (4%)
 Frame = +1

Query: 622  DSIVHASDFETQTGAPWGLARVSHRERLNLGS---------FNKYLYDDNAGKGVTAYVI 774
            + I  A +   Q+ AP  LAR+S   +L             FN Y  DD  G+ V AY++
Sbjct: 163  EDIDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIM 222

Query: 775  DTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXL 954
            DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG            L
Sbjct: 223  DTGIFSDHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVL 281

Query: 955  RTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXX 1134
              +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S               
Sbjct: 282  GKDGSGEASNVLSGLEFIV-EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGI 340

Query: 1135 XXXXXXGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNI--LS 1305
                  GN N DA   SPAS++  ITV A     D  A FSNWG CV+IFAPG+ I  LS
Sbjct: 341  VFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS 400

Query: 1306 TYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGS 1485
                 DT +  LSGTSM++P V G+ A  LS              I P  + ++I    +
Sbjct: 401  HLNYEDTLI--LSGTSMSTPIVTGVAAVLLS------------KGIEPALIAQEIEYLST 446

Query: 1486 KNLLNN----VPARTANNLIFNG 1542
            +N+ +         TAN +++NG
Sbjct: 447  RNVFHRRTLFFKPSTANQILYNG 469

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
            RRT12Probable subtilisin-family protease with a role in
            formation of the dityrosine layer of spore walls;
            localizes to the spore wall and also the nuclear envelope
            and ER region in mature spores
          Length = 491

 Score =  153 bits (386), Expect = 1e-39
 Identities = 130/393 (33%), Positives = 180/393 (45%), Gaps = 45/393 (11%)
 Frame = +1

Query: 499  VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLV---------KLIEQDSIVHASDFE 651
            ++  IE+ F I GS RG     +  +++ +++S LV         +  E DS+  A    
Sbjct: 45   IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSY 103

Query: 652  T--------------------QTGAPWGLARVSHRERL--NLGS-------FNKYLYDDN 744
            T                    Q  AP  LAR+S   +L  ++G        FN Y   D 
Sbjct: 104  TFNATAKYSYEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDY 163

Query: 745  AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXX 924
             G+ V AY++DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG   
Sbjct: 164  QGQDVNAYIMDTGIFADHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAK 222

Query: 925  XXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXX 1104
                     L  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S     
Sbjct: 223  RVNLVEVKVLGKDGSGEASNVLSGLEFIV-EHCTKVSRPQGKKCVANLSLGSFRSPIINM 281

Query: 1105 XXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIF 1281
                            GN N DA   SPAS++  ITV A     D  A FSNWG CV+IF
Sbjct: 282  AVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIF 341

Query: 1282 APGLNI--LSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEA 1455
            APG+ I  LS    +DT +  LSGTSM++P V G+ A  LS              I PE 
Sbjct: 342  APGVEIESLSHLNYNDTLI--LSGTSMSTPIVTGVAAILLS------------KGIEPEM 387

Query: 1456 LKKKIVAYGSKNLLNN----VPARTANNLIFNG 1542
            + ++I    ++N+ +         T N +++NG
Sbjct: 388  IAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNG 420

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
            similarities with uniprot|P25036 Saccharomyces cerevisiae
            YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  152 bits (383), Expect = 3e-39
 Identities = 117/321 (36%), Positives = 159/321 (49%), Gaps = 11/321 (3%)
 Frame = +1

Query: 637  ASDFETQTGAPWGLARVSHRERL------NLGSFNKYLY-DDNAGKGVTAYVIDTGINID 795
            + DF +Q+ AP  LAR+S R +L      +  S  KY Y +++ G+GV  YV+D+G+N D
Sbjct: 148  SDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHD 207

Query: 796  HVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGT 975
            H +FEGRA  G    + +   D  GHGTH AG I SKTYG            L + G GT
Sbjct: 208  HPDFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGT 266

Query: 976  MSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG-GKSXXXXXXXXXXXXXXXXXXXXX 1152
            +++++ G+EYVV    +  G    +    NMSLG  G                       
Sbjct: 267  VTNIIEGLEYVV---NQCIGKK--RKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAG 321

Query: 1153 GNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILS-TYIGSDT 1326
            GN   +AC  SPA  +K ITVAA    +D  A FSNWG+C+DI+APG+N+ S +  G  T
Sbjct: 322  GNSGLNACWYSPAKVRKAITVAAMDDRTDLMAPFSNWGACIDIWAPGVNVKSLSNKGRGT 381

Query: 1327 AVATLSGTSMASPHVAGLLAYFLSLQPDSGS-EYYTGSSISPEALKKKIVAYGSKNLLNN 1503
             V  LSGTSMASP VAG  A +L    D          + +    KK+ +A         
Sbjct: 382  FV--LSGTSMASPIVAGAAAIYLDQGADPAEVRKILSKTATRGVFKKRAIA--------- 430

Query: 1504 VPARTANNLIFNGGGGSLDSF 1566
            V  RT N +++ G     D F
Sbjct: 431  VRPRTPNKVLYTGNNQEDDEF 451

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] {ON}
            YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  151 bits (382), Expect = 4e-39
 Identities = 113/335 (33%), Positives = 158/335 (47%), Gaps = 14/335 (4%)
 Frame = +1

Query: 643  DFETQTGAPWGLARVSHRERLNLGSFN--------KYLYDDN-AGKGVTAYVIDTGINID 795
            DF  Q  AP  LAR+S R  L     N         Y YDD+  G  V AYVIDTGI  +
Sbjct: 129  DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 796  HVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGT 975
            H +F+GRA++G  +   +   D NGHGTH AG I S+ YG            L   G G 
Sbjct: 189  HRQFQGRAKFGADLVG-EGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 976  MSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXG 1155
            ++ V+  +E+ V   RK+      +G  AN+SLG  ++                     G
Sbjct: 248  LTSVISAIEFTVNHCRKSK-----RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAG 302

Query: 1156 NENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAV 1332
            N N +AC +SPASS   I+V A    +D  A FSNWG+CVD+FAPG+ I S         
Sbjct: 303  NSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFKS 362

Query: 1333 ATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN--- 1503
               SGTSMASP V G++A  L    DSG        I P  +K++++   + ++ +    
Sbjct: 363  VAYSGTSMASPLVTGMVAVLL----DSG--------IHPFDIKEELINTATDSVFHKRAL 410

Query: 1504 -VPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKV 1605
                 T N + F G     D F ++   G + +++
Sbjct: 411  LFKPGTPNRVAFTGVEKEDDIFEDAVYPGVDIDQL 445

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar to
            uniprot|P25381 Saccharomyces cerevisiae YCR045C
            Hypothetical ORF
          Length = 479

 Score =  148 bits (374), Expect = 4e-38
 Identities = 115/360 (31%), Positives = 160/360 (44%), Gaps = 24/360 (6%)
 Frame = +1

Query: 535  GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASD------------FETQTGAPWGL 678
            G   G+   F    ++ ++++ LV  +  +S+ +  D            ++ Q  AP  L
Sbjct: 59   GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 679  ARVSHRERLNLGS-------FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTI 837
            AR+S R  L           FN Y    + G  V AY+IDTGI   H +  GRA +G  +
Sbjct: 119  ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 838  PSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAE 1017
               +   D NGHGTH AG + S+T+G            L   G G ++ V+  +E+ V  
Sbjct: 179  VG-EGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV-N 236

Query: 1018 HRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASS 1197
            H K SG        AN+SLG  ++                     GN N +AC  SPAS+
Sbjct: 237  HCKKSG----MLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASA 292

Query: 1198 KKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVA 1374
               ITV A    +D  A FSNWG CVD+FA G+ ++S            SGTSMASP VA
Sbjct: 293  ISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVA 352

Query: 1375 GLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----VPARTANNLIFNG 1542
            GL A  L    DSG        I P  +K+KI+   ++N+           T N + FNG
Sbjct: 353  GLAAVLL----DSG--------IDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFNG 400

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
            similar to uniprot|P25381 Saccharomyces cerevisiae
            YCR045C Hypothetical ORF
          Length = 496

 Score =  147 bits (370), Expect = 2e-37
 Identities = 102/264 (38%), Positives = 134/264 (50%), Gaps = 10/264 (3%)
 Frame = +1

Query: 655  QTGAPWGLARVSHR-------ERLNLGSFN-KYLYDDN-AGKGVTAYVIDTGINIDHVEF 807
            Q  AP  LAR+S R       E +++ + N  Y YDD  +G  V AYVIDTGI  +H + 
Sbjct: 135  QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 808  EGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDV 987
            EGRA++G  +   +   D NGHGTH AG I S+ +G            L   G G ++ V
Sbjct: 195  EGRAKFGADLVG-EGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 988  LRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQ 1167
            +  +E+ V   RK+      +G  AN+SLG  ++                     GN N 
Sbjct: 254  ISAIEFTVNHCRKSR-----RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSNA 308

Query: 1168 DACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLS 1344
            +AC +SPASS   ITV A    +D  A FSNWG+CVDIFAPG+ I S            S
Sbjct: 309  NACWSSPASSLSAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKPVAFS 368

Query: 1345 GTSMASPHVAGLLAYFLSLQPDSG 1416
            GTSMASP V+G++A  L    DSG
Sbjct: 369  GTSMASPIVSGMVANLL----DSG 388

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
            Ashbya gossypii AAR069W
          Length = 610

 Score =  148 bits (374), Expect = 2e-37
 Identities = 111/310 (35%), Positives = 154/310 (49%), Gaps = 14/310 (4%)
 Frame = +1

Query: 655  QTGAPWGLARVSHRERLNLGS-------FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG 813
            Q+GAP  LAR   R  L   +       FN Y   ++ G+ V  Y++D+GI+  H EFEG
Sbjct: 270  QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 814  RAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLR 993
            RA +G    +N+   D NGHGTH AG + SKTYG            +  +G G+ S+++ 
Sbjct: 330  RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 994  GVEYVVAEHRKASGDPNFKGSTANMSLGG---GKSXXXXXXXXXXXXXXXXXXXXXGNEN 1164
            GVE+ V +H + SG    K   ANMSLGG   G S                     GN  
Sbjct: 389  GVEFAV-KHCQQSG----KKCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAA-GNSK 442

Query: 1165 QDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATL 1341
            + AC  SPA  K  ITV A    SD  A FSN+G CVDIFAPG+ + S        V  L
Sbjct: 443  ERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVRVL 502

Query: 1342 SGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN---VPA 1512
            +GTSM++P  AG++A  L    D G        +  E +K++++   +K + +    V +
Sbjct: 503  NGTSMSAPITAGVVAVLL----DQG--------VKHEDVKERLIDLSTKGVFHRRRLVSS 550

Query: 1513 RTANNLIFNG 1542
            RT +  +FNG
Sbjct: 551  RTPDRTLFNG 560

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  147 bits (372), Expect = 9e-37
 Identities = 112/325 (34%), Positives = 155/325 (47%), Gaps = 14/325 (4%)
 Frame = +1

Query: 646  FETQTGAPWGLARVSHRERLNLG-------SFNKYLYDDNAGKGVTAYVIDTGINIDHVE 804
            +  Q  AP  LAR   R  L          +FN Y  +++ G+GV  YV+D+GI   H E
Sbjct: 425  YAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPE 484

Query: 805  FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSD 984
            F+GRA +G    + +   D NGHGTH AG + S+T+G            +  +G G+ S+
Sbjct: 485  FDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSN 543

Query: 985  VLRGVEYVVAEHRKASGDPNFKGSTANMSLGG---GKSXXXXXXXXXXXXXXXXXXXXXG 1155
            ++ GVE+ V +H + SG    K   ANMSLGG   G S                     G
Sbjct: 544  IIAGVEFAV-KHCQQSG----KRCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAA-G 597

Query: 1156 NENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAV 1332
            N  + AC  SPA  K  ITV A    SD  A FSN+G CVDIFAPG+ + S        +
Sbjct: 598  NSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTM 657

Query: 1333 ATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN--- 1503
              L+GTSM++P  AG++A  L    D G        I P  +K  +++  +K L +    
Sbjct: 658  RVLNGTSMSAPITAGVVAVLL----DQG--------IEPHEVKDHLLSISTKGLFHKRRL 705

Query: 1504 VPARTANNLIFNGGGGSLDSFWNSK 1578
            V +RT +  +F G     DSF   K
Sbjct: 706  VSSRTPDRALFTGVKREDDSFSTEK 730

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
            Anc_6.313 YCR045C
          Length = 478

 Score =  142 bits (359), Expect = 4e-36
 Identities = 113/339 (33%), Positives = 157/339 (46%), Gaps = 25/339 (7%)
 Frame = +1

Query: 601  LVKLIEQDSIVHASDFE-----TQTGAPWGLARVSHRERLNLG---------SFNKYLYD 738
            L K  E D + +    E      Q+ AP  LAR+S R++L            SFN Y   
Sbjct: 96   LFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGK 155

Query: 739  DNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGX 918
            ++ G  V AY++D+G++ +  +FEGR ++G    + D + D NGHGTH AG + SKTYG 
Sbjct: 156  EHKGADVRAYILDSGVSRNLTDFEGRVEFGFDF-TGDGEGDSNGHGTHVAGLVGSKTYGV 214

Query: 919  XXXXXXXXXXXLRTNGTGTMSDVLRGVEYVV---AEHRKASGDPNFKGSTANMSLGGGKS 1089
                       L   G GT+  VL  +E+ V    EH +       K   AN+SLG  K+
Sbjct: 215  AKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE-------KRCVANLSLGSFKN 267

Query: 1090 XXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDR----AYFSN 1257
                                 GN N +AC TSPAS+++ ITV A    DDR    A FSN
Sbjct: 268  AIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITVGA---FDDRIDTIAKFSN 324

Query: 1258 WGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGS 1437
            WG CVDI+APG+ + S          + SGTSMASP V G +A  L    D G       
Sbjct: 325  WGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQVAILL----DKG------- 373

Query: 1438 SISPEALKKKIVAYGSKNLLNN----VPARTANNLIFNG 1542
             I  + +K  ++   + ++           T N ++FNG
Sbjct: 374  -IPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
            Anc_6.313 YCR045C
          Length = 607

 Score =  142 bits (357), Expect = 3e-35
 Identities = 109/313 (34%), Positives = 140/313 (44%), Gaps = 15/313 (4%)
 Frame = +1

Query: 649  ETQTGAPWGLARVSHRERL--------NLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHV 801
            + Q GAP  L ++S R +L            F  Y YD    G     Y+IDTG+  +H 
Sbjct: 148  DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 802  EFEGRAQWGKT-IPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTM 978
            EF  R  +G   I     DY  NGHGTH AG I SKT+G            L   G G +
Sbjct: 208  EFGNRVHFGGDFIGEGKGDY--NGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNL 265

Query: 979  SDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGN 1158
            + VL G+E+ V  + K    P  K    NMSLG  ++                     GN
Sbjct: 266  TSVLEGIEFAV-NNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGN 324

Query: 1159 ENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVA 1335
             N  AC TSPASS   ITV A    +D  A FSNWG CVDIFAPG+ I S          
Sbjct: 325  NNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENGV 384

Query: 1336 TLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPA- 1512
              SGTSMASP VAGL+A  +                  + +K+K++   SK++ + +   
Sbjct: 385  IHSGTSMASPIVAGLVAILME------------KGYKCDEIKQKLIDDSSKSIFSKLTLF 432

Query: 1513 ---RTANNLIFNG 1542
                T N +I+NG
Sbjct: 433  FKYGTPNRVIYNG 445

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
            Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  134 bits (338), Expect = 5e-34
 Identities = 95/312 (30%), Positives = 146/312 (46%), Gaps = 4/312 (1%)
 Frame = +1

Query: 478  EGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQ 657
            E  +  S  GG+  +  +  S R  +G F   +L+ +   G +  +  D I+  +++  Q
Sbjct: 35   ERYAQMSDNGGVGAI-SLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQ 93

Query: 658  TGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTI 837
              AP  LAR+S +  L  GS   Y+Y  N G GV  Y++DTGI+  H E EGR Q    +
Sbjct: 94   EHAPAHLARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADL 152

Query: 838  PSNDADY-DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVA 1014
             SN   + D +GHGT  AG I S T+G              + G  T+  V+R +     
Sbjct: 153  TSNPVSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRAL----- 207

Query: 1015 EHRKASGDPNFKGSTANMSLGGGKS-XXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPA 1191
            EH         + S   +     K+                      GN NQ+AC++SPA
Sbjct: 208  EHASKLASVTQRPSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPA 267

Query: 1192 SSKKCITVAA--STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASP 1365
            S+   +T+ +   T  D  A F+N+G C+D FA G+NI S   G   +    SGTS+++ 
Sbjct: 268  SAYGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAG 327

Query: 1366 HVAGLLAYFLSL 1401
              +G++AY++SL
Sbjct: 328  IASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6.313
            YCR045C
          Length = 497

 Score =  125 bits (313), Expect = 7e-30
 Identities = 94/290 (32%), Positives = 128/290 (44%), Gaps = 4/290 (1%)
 Frame = +1

Query: 646  FETQTGAPWGLARVSHRERLNLGS---FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGR 816
            + TQ  AP  L+R S   +L   S   +N Y   D  G  VT YV+D+GI +DH EFEGR
Sbjct: 142  YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 817  AQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRG 996
                     +    D  GHGT  AG I SKTYG            L   G G +  +L+G
Sbjct: 202  ILEAYDFTDSGVG-DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQG 260

Query: 997  VEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDAC 1176
            ++++  +H + + + N      N SLG                         GN   +AC
Sbjct: 261  LQFIT-KHCEENTNGN---CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVNAC 316

Query: 1177 NTSPASSKKCITVAASTLSDDR-AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTS 1353
              +PA SK   TV +    DD  A FSNWG CVD+ APG+ + +    +       SGTS
Sbjct: 317  WITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSGTS 376

Query: 1354 MASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN 1503
            +++P V GL A  LS              +  E L  +I   GS++LL N
Sbjct: 377  VSTPIVTGLAAILLS------------KGVPKENLYDEIRKMGSRDLLRN 414

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
            similar to uniprot|P25381 Saccharomyces cerevisiae
            YCR045C Hypothetical ORF
          Length = 380

 Score =  120 bits (301), Expect = 5e-29
 Identities = 89/311 (28%), Positives = 147/311 (47%), Gaps = 7/311 (2%)
 Frame = +1

Query: 490  ARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAP 669
            A +V GG      +  S R  +G F   +L+    SG +  +  D  +  +++  Q  AP
Sbjct: 38   AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAP 97

Query: 670  WGLARVSHRERLNLGSFNK---YLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIP 840
              LAR+S +  L  G+ +    Y+Y  NAG GV  Y++DTGI+  H  FEGR Q      
Sbjct: 98   NHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFS 157

Query: 841  SND-ADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAE 1017
            S+  A  D +GHGT  AG I S  +G              + G  ++  VLR +E+  ++
Sbjct: 158  SDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEH-ASK 216

Query: 1018 HRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASS 1197
                +  P+       M      +                     GNEN+ AC+ SPA +
Sbjct: 217  LAAVTKRPSLITIPLEMP---RNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGA 273

Query: 1198 KKCITVAASTL--SDDRAYFSNWGSCVDIFAPGLNILSTYIGSD-TAVATLSGTSMASPH 1368
               +T+ +  +  +D  A F+N+  CVD+F  G+++ +  +G D ++   LSGTS+++  
Sbjct: 274  YGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGV 331

Query: 1369 VAGLLAYFLSL 1401
             +GL+AY++S+
Sbjct: 332  ASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] {ON}
            complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  104 bits (259), Expect = 2e-23
 Identities = 82/306 (26%), Positives = 138/306 (45%), Gaps = 15/306 (4%)
 Frame = +1

Query: 529  IAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSH---RE 699
            I     G+ G F D ++  +     V  I  D +++  ++  Q  AP  LAR+S+     
Sbjct: 57   IGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNS 116

Query: 700  RLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY---DGNG 870
            R++  + N +++  +AG GV  Y++D+GI+  H  F  R    K I   D      D +G
Sbjct: 117  RVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHG 175

Query: 871  HGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGT-MSDVLRGVEYVVAEHRKASGDPNF 1047
            HGT  AG + S T+G            +     G  +S +L+ +E+ +  H +A+  P+ 
Sbjct: 176  HGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRATMRPSV 234

Query: 1048 KGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAAST 1227
                 +MS                           GN++  ACN SPAS++   ++ +  
Sbjct: 235  AVLPFSMS-----KNAILNSAIESMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVG 289

Query: 1228 LSDDR-----AYFSNWGSCVDIFAPGL---NILSTYIGSDTAVATLSGTSMASPHVAGLL 1383
              D R     A FSN+G CVD+F  G+    + +T    +  ++ +SGTSM+    AG +
Sbjct: 290  SLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTV 349

Query: 1384 AYFLSL 1401
             Y++SL
Sbjct: 350  GYYMSL 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] {ON}
            Anc_1.78
          Length = 364

 Score = 95.5 bits (236), Expect = 1e-20
 Identities = 81/329 (24%), Positives = 136/329 (41%), Gaps = 12/329 (3%)
 Frame = +1

Query: 517  EMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHR 696
            EM  +    +   G F+   L+ +     V  I +D  +   +++ Q G+P  L+++S  
Sbjct: 45   EMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS-- 102

Query: 697  ERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY------ 858
                  S   + +D  +G  V  YV DTGI+  H   +         P   AD+      
Sbjct: 103  ------SGGSFTFDPVSGNLVDVYVFDTGIDFKHPGLQN------VNPHKLADFTSSPVP 150

Query: 859  ---DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKA 1029
               D +GHGT  AG IAS+T+G               +G   +S +++G+   VA  R  
Sbjct: 151  RGADPHGHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASVAHARFT 210

Query: 1030 SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 1209
                  + S   + +  GK                      GN+  DAC+ SP +    +
Sbjct: 211  K-----RPSVFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNIL 265

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNIL---STYIGSDTAVATLSGTSMASPHVAGL 1380
             + +    +  A FSN+G+CVD++  G +IL   ST  G++  + + +GTS +    AG+
Sbjct: 266  VIGSLDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGI 325

Query: 1381 LAYFLSLQPDSGSEYYTGSSISPEALKKK 1467
            + Y +S+   S     T  S S +    K
Sbjct: 326  VGYHMSMGLTSMQAIQTIRSSSKDIYSHK 354

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa] {ON}
            conserved hypothetical protein
          Length = 386

 Score = 90.5 bits (223), Expect = 8e-19
 Identities = 84/311 (27%), Positives = 131/311 (42%), Gaps = 14/311 (4%)
 Frame = +1

Query: 511  IEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVS 690
            I ++FE+ GS R + G F+  +L  +     V  I +D  +   +   Q  AP  L  +S
Sbjct: 45   ITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 691  HRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG---RAQWGKTIPSNDADYD 861
                L   S   ++Y  N G GV  Y++DTGI+I H              T        D
Sbjct: 104  SISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGTD 160

Query: 862  GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDP 1041
              GHGT  AG IAS+T+G              +NG   +S +L+ +  +   H + +  P
Sbjct: 161  PQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALT-LTQRHIEGTKRP 219

Query: 1042 NFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPAS----SKKCI 1209
            +       +  G   +                     GN  QDA N SPA+     K  I
Sbjct: 220  SVVVIPLEVEDG---NNPILTEAIASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNII 276

Query: 1210 TVAASTLSDDRAYFSNWGSCVDIFAPGLNI-------LSTYIGSDTAVATLSGTSMASPH 1368
             V +  ++++   F+N+GS VD+F  G  I       L +   S++    +SGTS +S  
Sbjct: 277  VVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAI 336

Query: 1369 VAGLLAYFLSL 1401
             AG++ Y++SL
Sbjct: 337  TAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] {ON}
            Anc_1.78
          Length = 388

 Score = 87.0 bits (214), Expect = 1e-17
 Identities = 80/313 (25%), Positives = 132/313 (42%), Gaps = 22/313 (7%)
 Frame = +1

Query: 526  EIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERL 705
            EI  S   + G  +   +  + E      I  +  +    +  QT AP  L R++ ++ +
Sbjct: 54   EIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDSI 112

Query: 706  NLGSF----NKYLYDDNAGKGVTAYVIDTGINIDH-VEFEGRAQ-----WGKTIPSNDAD 855
                +    N+Y++ D +G GV  Y++DTGI+I H +  +             IPS D  
Sbjct: 113  KSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSGDF- 171

Query: 856  YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGT-GTMSDVLRGVEYVVAEHRKAS 1032
               NGHGT  AG I S  +G            +  N    TMS VL  +  +    +K  
Sbjct: 172  ---NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSLIEKHEQK-- 226

Query: 1033 GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKK--- 1203
                 + S   +     K+                     GN++Q+AC  SP   KK   
Sbjct: 227  ---TMRPSIIVLPFQTEKN-TILESAIENISKKIPVIIPAGNKHQNACKLSPMGIKKLSN 282

Query: 1204 CITVAASTLSDDRAY-----FSNWGSCVDIFAPGLNI---LSTYIGSDTAVATLSGTSMA 1359
             + V +   S+++ Y     FSN+GSCVDI+  G++I    ++  G    +  ++GTS +
Sbjct: 283  VLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSYS 342

Query: 1360 SPHVAGLLAYFLS 1398
               VAG++ Y++S
Sbjct: 343  CGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 73.2 bits (178), Expect = 4e-13
 Identities = 85/342 (24%), Positives = 135/342 (39%), Gaps = 14/342 (4%)
 Frame = +1

Query: 517  EMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHR 696
            E++ +  + + +        L  +     +  I  D  +   +   Q  AP  L ++   
Sbjct: 51   ELYSVGKNFQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLET 110

Query: 697  ERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG-RAQWGKTIPSNDA-DYDGNG 870
            E       N+++YD  AG GV  Y+ DTGI  +       R      +P     D +   
Sbjct: 111  E----AGDNEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMPGMPGPPIRDQEILE 166

Query: 871  HGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFK 1050
            HGT  +G I S  +G               NG   MS VL+G+  +V +H K +  P   
Sbjct: 167  HGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLN-LVQQHVKHTNRP--- 222

Query: 1051 GSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPAS---SKKCITVAA 1221
             S  N S    K+                     GN  Q  C+ SP     +K  +   +
Sbjct: 223  -SVINFSYCTLKNAILNSAFDNFPRDVPIAVAA-GNYKQPGCSFSPVGCQRNKSLLAFGS 280

Query: 1222 STLSDDR---AYFSNWGSCVDIFAPGLNILSTYI------GSDTAVATLSGTSMASPHVA 1374
              ++DD    + FSN+GSCV  +APG  +L+  I       S   V  +SGTS +S   A
Sbjct: 281  LLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGA 340

Query: 1375 GLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLN 1500
            G++ Y+++ Q   G E      I    ++  + +YG  N +N
Sbjct: 341  GVIGYYMA-QGIPGEEVVDSLRI----VQPNLTSYGKNNGIN 377

>Kwal_56.22390 s56 complement(108145..108450) [306 bp, 101 aa] {OFF}
            [contig 185] FULL
          Length = 101

 Score = 50.4 bits (119), Expect = 4e-07
 Identities = 34/81 (41%), Positives = 38/81 (46%), Gaps = 5/81 (6%)
 Frame = -2

Query: 1202 FFEEAGEVLQASWFSLXXXXXXXXXXXXXXXXXXXXXADLPPPNDILAVEPLKLGSPEAF 1023
            F   AGE L ASWFSL                      DLPPP D+ AVEPLK   P  F
Sbjct: 3    FSAAAGEELHASWFSLPAATAKWIPALTAALTAMSKAGDLPPPKDMFAVEPLK---PFLF 59

Query: 1022 LCSATTY-----STPLKTSDI 975
              +A+ +     STPL TSDI
Sbjct: 60   FLTASWWDLAANSTPLTTSDI 80

>Kwal_56.22389 s56 complement(107750..107929) [180 bp, 59 aa] {OFF}
           [contig 185] FULL
          Length = 59

 Score = 37.7 bits (86), Expect = 0.004
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = -1

Query: 693 MRNTSQTPRSPSLSFKIRSMNYRVLLNQLNQATFTN*IQHAISKVSKVAPQRTCNLKHL 517
           MR+T Q PRS  L  K+  +++RVL ++ NQ    + + + + +V+ V  Q   ++K +
Sbjct: 1   MRDTRQPPRSAVLGVKLVGVHHRVLFDKCNQRVHADEVHNLLGEVADVPTQHPVDVKRV 59

>Kwal_23.6185 s23 (1485516..1485773) [258 bp, 85 aa] {OFF} [contig 15]
            FULL
          Length = 85

 Score = 32.3 bits (72), Expect = 0.60
 Identities = 25/63 (39%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = -2

Query: 1355 IEVPDRVATAVSDPM*VDKMFKPGAKMSTQEPQLEK*AL-SSDNVDAATVIHFFEEAGEV 1179
            +EVP+            D +  PGA  STQ PQLE  A+ S  +  A T I   EEAG +
Sbjct: 1    MEVPEYATDLKGGIFESDAILTPGANKSTQLPQLENRAMVSVRSSKAPTEIAESEEAGLL 60

Query: 1178 LQA 1170
             QA
Sbjct: 61   QQA 63

>Kwal_23.4220 s23 complement(623740..624666) [927 bp, 308 aa] {ON}
            YLR390W-A (CCW14) - Secretory Stress Response protein
            [contig 1] FULL
          Length = 308

 Score = 34.3 bits (77), Expect = 0.82
 Identities = 41/175 (23%), Positives = 61/175 (34%)
 Frame = +1

Query: 1156 NENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVA 1335
            NE    C    +  K C+  A      D AY +  GSC +  A   +  S+   S T+ +
Sbjct: 46   NEVSCLCEKESSGVKSCLDSACPDDQADAAYSAFKGSCSEQNASISSTSSSAKSSSTSKS 105

Query: 1336 TLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPAR 1515
            + S  S +S           S    S S   + S+ S  A      +  S    +   + 
Sbjct: 106  SSSTKSSSSTK---------SSSTASSSSASSSSASSSSASSSSASSSSSTKSSSTASSS 156

Query: 1516 TANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHS 1680
            +A++   +    S  S  +S          SSS GK     S S      STS S
Sbjct: 157  SASSSSASSSSASSSSASSSSASSSSASSSSSSSGKPSSTSSSSAKPSSTSTSSS 211

>TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.261
           YKR024C
          Length = 715

 Score = 33.9 bits (76), Expect = 1.4
 Identities = 35/146 (23%), Positives = 60/146 (41%), Gaps = 4/146 (2%)
 Frame = +1

Query: 220 DEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLV 399
           DEE  V  +F       SQ      L S + ++     +++++F   V    + +     
Sbjct: 461 DEEPGV--IFYKLHGSLSQPIRTSTLESFAKDTPTTKGKHLIMFCTDVASRGLDL----- 513

Query: 400 TTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGSLRGYFG----YFT 567
              H+ T+ ++DP    F   + +H  G +AR+ +GG   +F + G   GY G    Y  
Sbjct: 514 --PHVGTVLEVDPP---FSTEDHLHRVGRTARAGQGGEALLFLLPGEEEGYLGKIKSYHP 568

Query: 568 DGMLDLIRESGLVKLIEQDSIVHASD 645
            G   L  +  L+K   +   V  SD
Sbjct: 569 KGWKLLKYDDDLLKPAFEQVNVRRSD 594

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 33.1 bits (74), Expect = 2.5
 Identities = 29/112 (25%), Positives = 47/112 (41%), Gaps = 8/112 (7%)
 Frame = +1

Query: 592 ESGLVKLIEQDSIVHASD--FETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTA 765
           +S  + + E +  +H  D  FE Q    W L   + +   N  +     Y +  GKGV A
Sbjct: 109 DSSFIPIKEAEERLHIDDPLFEKQ----WHLINPAFKG--NDVNVQDVWYQNITGKGVVA 162

Query: 766 YVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGTIAS 903
            V+D G++ ++ +       EG   +             + HGT CAG IA+
Sbjct: 163 AVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGEIAA 214

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 6/63 (9%)
 Frame = +1

Query: 733 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 894
           Y++  G G+ A ++D G++ D+         EG   +    P        + HGT CAG 
Sbjct: 186 YENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRCAGE 245

Query: 895 IAS 903
           IA+
Sbjct: 246 IAA 248

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 6/67 (8%)
 Frame = +1

Query: 724 KYLYDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHC 885
           K  Y++  G GV A ++D G++ ++ +       EG   +             + HGT C
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRC 217

Query: 886 AGTIASK 906
           AG IA+K
Sbjct: 218 AGEIAAK 224

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 6/63 (9%)
 Frame = +1

Query: 733 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 894
           Y++  G GV A ++D G++ ++ +       EG   +    P        + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 895 IAS 903
           IA+
Sbjct: 245 IAA 247

>Suva_5.214 Chr5 (324640..325833) [1194 bp, 397 aa] {ON} YER095W
            (REAL)
          Length = 397

 Score = 32.3 bits (72), Expect = 3.7
 Identities = 16/70 (22%), Positives = 37/70 (52%)
 Frame = +1

Query: 1435 SSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSS 1614
            S +  + + +  + YG+ +L++ VPA   +  I NG G    +  ++  DG + ++   +
Sbjct: 2    SQVQEQHISESQLQYGNASLMSTVPA-DPSQPIGNGNGSDAIAATDASADGGDSQEQEQA 60

Query: 1615 HGKADDFESE 1644
             G+A++ E +
Sbjct: 61   QGEAEEEEDD 70

>Kwal_23.4740 s23 complement(841124..842962) [1839 bp, 612 aa] {ON}
           YNL068C (FKH2) - Fork Head homolog two [contig 5] FULL
          Length = 612

 Score = 32.3 bits (72), Expect = 4.2
 Identities = 21/71 (29%), Positives = 30/71 (42%)
 Frame = -3

Query: 712 QGSIFHDEKHEPNPKEPQSEFQNPKHEL*SPAQST*PSHFHELDPTCHQ*SIQSSPSANL 533
           Q  I H++ H   P     +FQNP      P Q     H  E +P  H    Q++PS++ 
Sbjct: 293 QQQIPHNQLHHQQPHYQPPQFQNP------PQQPNVHRHQLEQEPRQHLHQPQTTPSSHF 346

Query: 532 QSQTSPQYPLP 500
            +   P   LP
Sbjct: 347 YNALHPNPTLP 357

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 6/63 (9%)
 Frame = +1

Query: 733 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 894
           Y++  G GV A ++D G++ +  +       EG   +           D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 895 IAS 903
           IA+
Sbjct: 214 IAA 216

>Smik_5.239 Chr5 (358510..359712) [1203 bp, 400 aa] {ON} YER095W
            (REAL)
          Length = 400

 Score = 32.0 bits (71), Expect = 4.9
 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 2/68 (2%)
 Frame = +1

Query: 1435 SSISPEALKKKIVAYGSKNLLNNVPARTANNLI-FNGGGGSLD-SFWNSKCDGCEQEKVS 1608
            S +  + + +  + YG+ +L++ VPA  + +++  N  GGS D +  N   DG   ++ +
Sbjct: 2    SQVQEQHISESQLQYGNGSLMSTVPADLSQSVVDGNSNGGSDDIAATNGSADGGGLQEQA 61

Query: 1609 SSHGKADD 1632
             + G+A+D
Sbjct: 62   QAQGEAED 69

>Skud_13.464 Chr13 (825408..825965) [558 bp, 185 aa] {ON}  (NOVEL)
          Length = 185

 Score = 31.2 bits (69), Expect = 5.3
 Identities = 26/96 (27%), Positives = 36/96 (37%)
 Frame = -1

Query: 699 FTMRNTSQTPRSPSLSFKIRSMNYRVLLNQLNQATFTN*IQHAISKVSKVAPQRTCNLKH 520
           FT     Q  R P     +  +NY  L   L+++       H  S ++     R C  + 
Sbjct: 41  FTAHTNKQQRRVPEQVVTLLRINYTYLFAALHRSCHC---LHPSSSLAFSRRSRRCRYRR 97

Query: 519 LLNTPFHTPSRNPFVMHTLSGIKERMPRVKLRNSLH 412
           LL T   + S   F    L    E+  RVKL   LH
Sbjct: 98  LLRTRHFSNSGFDFFWFFLLRAPEKPSRVKLFRDLH 133

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 6/64 (9%)
 Frame = +1

Query: 733 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 894
           Y++  G GV A ++D G++ ++ +       EG   +             + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 895 IASK 906
           IA+K
Sbjct: 221 IAAK 224

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 6/64 (9%)
 Frame = +1

Query: 733 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 894
           Y++  G GV A ++D G++ ++ +       EG   +             + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 895 IASK 906
           IA+K
Sbjct: 221 IAAK 224

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 6/58 (10%)
 Frame = +1

Query: 748 GKGVTAYVIDTGINIDHVE------FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIAS 903
           GK VT  ++D G++ ++ +      FEG   +             + HGT CAG IA+
Sbjct: 167 GKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAA 224

>KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.463
           YDR239C
          Length = 856

 Score = 32.0 bits (71), Expect = 5.9
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = +1

Query: 736 DDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIAS 903
           D+N+     + ++ +G+N+DH + E    + K +P    D + N H T+  G + S
Sbjct: 690 DENSNPDFNSKLLQSGVNVDHTK-EFHRFFNKDLPLGSDDDEFNEHDTNADGDLRS 744

>Smik_6.25 Chr6 complement(43238..46918) [3681 bp, 1226 aa] {ON}
            YHR211W (REAL)
          Length = 1226

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 21/94 (22%), Positives = 49/94 (52%)
 Frame = -1

Query: 1149 SYSKVDTSSHSSVNSQFQGSRLATTQRHIGGRTLEVRISRSLSVLCNNILHTPQNIRHRT 970
            S S  +  S S+++S+ Q   L+++      R+++   S   SV+     +T +N + +T
Sbjct: 842  SSSHTNIRSFSTISSKGQEQTLSSSHTLTSSRSIKFSESYMSSVITFTGSNT-ENFKSQT 900

Query: 969  STVGSQNFNSDNFGILSNTVRLGRNGTRTMRAVP 868
            S++ S   +S+N+ + + ++  G   + +  +VP
Sbjct: 901  SSISSSASHSENYRVSTTSISFGSLKSSSSLSVP 934

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 32.0 bits (71), Expect = 6.2
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = -3

Query: 706 SIFHDEKHEPNPKEPQSEFQNPKHEL*SPAQST*PSHFHELDPTCHQ*SIQSSPSANLQS 527
           ++F   +  P P    S  Q PK    SP  +   ++F   DP      +Q+SP AN ++
Sbjct: 819 ALFSSPRRAPKPPSYPSPVQPPK----SPLINNKKANFSRFDPQ----EVQTSPLANSKT 870

Query: 526 QTSPQ 512
            T+PQ
Sbjct: 871 PTTPQ 875

>YCR045W-A Chr3 (208751..209101) [351 bp, 116 aa] {OFF} Dubious ORF
           unlikely to encode a protein, based on available
           experimental and comparative sequence data; completely
           overlaps with YCR045C; identified by gene-trapping,
           microarray expression analysis, and genome-wide homology
           searching
          Length = 116

 Score = 30.0 bits (66), Expect = 6.7
 Identities = 21/47 (44%), Positives = 25/47 (53%)
 Frame = -2

Query: 911 YVLDAMVPAQCVPCPLPS*SASLDGIVLPHWARPSNST*SILIPVSI 771
           YVL+   PA CVP P  S + SL   + P     SNS  S  IPVS+
Sbjct: 70  YVLEPTSPATCVPWPFWSPNPSLVKSI-PWMTLSSNSGWSAKIPVSM 115

>Kwal_56.22756 s56 (268179..269501) [1323 bp, 440 aa] {ON} YNL283C
            (WSC2) - Putative integral membrane protein containing
            novel cysteine motif. Similarity to SLG1 (WSC1), WSC3 and
            WSC4 [contig 184] FULL
          Length = 440

 Score = 31.6 bits (70), Expect = 6.7
 Identities = 31/125 (24%), Positives = 51/125 (40%), Gaps = 1/125 (0%)
 Frame = -1

Query: 1215 NSDTLLRGSWGSITSILVFVTRSYSKVDTSSHSSVNSQFQGSRLATTQRHIGGRTLEVRI 1036
            +S +    S  +ITS    +  S S   TSS SS +S    S  ++T      R L   +
Sbjct: 211  SSSSSSSSSSSTITSSSSSIPSSSSASSTSSTSSSSSSSSSSSSSSTSTMASSRPLTTIV 270

Query: 1035 SRSLSVLCNNILHTPQNIRHRTSTVGSQN-FNSDNFGILSNTVRLGRNGTRTMRAVPVAI 859
            + S+SV+      T  N  H T  V +       +    SN +  G +G ++  ++    
Sbjct: 271  TASVSVV------TLSNSDHSTVVVTATTVVEGPSASAQSNNISKGSDGNKSNNSLSKGA 324

Query: 858  IVSII 844
            I  I+
Sbjct: 325  IAGIV 329

>Suva_16.517 Chr16 (889644..891827) [2184 bp, 727 aa] {ON} YPR185W
            (REAL)
          Length = 727

 Score = 31.6 bits (70), Expect = 7.5
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 17/105 (16%)
 Frame = +1

Query: 1393 LSLQPDSGSEYYTGSSISPEALKK--KIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSF 1566
            +SL  D    Y+ G S S   L      + YGS N   +  A TA++LI  GGG S  S 
Sbjct: 518  VSLSMDPNHTYHRGRSDSHSPLPSISPSMHYGSLNSRMSQGA-TASHLIARGGGNSSTSA 576

Query: 1567 WNSKCDGCEQE---------------KVSSSHGKADDFESESLMD 1656
            +NS+ +  ++                + +S H + DD E + L++
Sbjct: 577  FNSRRNSLDKNANKQGMSGLPPIFGGESTSYHHEEDDDEDDHLLN 621

>TPHA0F02390 Chr6 complement(527739..528623) [885 bp, 294 aa] {ON}
            Anc_2.61 YDL218W
          Length = 294

 Score = 31.2 bits (69), Expect = 7.6
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 2/86 (2%)
 Frame = +1

Query: 1342 SGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYG--SKNLLNNVPAR 1515
            +G+SM S  V    A  LS   +    Y TG+ +     ++++   G  +  + NNVP  
Sbjct: 190  TGSSMNSK-VHRSSALTLSEPIEKTYAYETGAGVPQAGTEQRVAEDGVATNQVGNNVPVT 248

Query: 1516 TANNLIFNGGGGSLDSFWNSKCDGCE 1593
            TA+   F+ G  S D+F   K  G +
Sbjct: 249  TADQHTFSTGASSNDAFIQEKNTGID 274

>TDEL0E00410 Chr5 (94980..97322) [2343 bp, 780 aa] {ON} Anc_2.6
           YNL238W
          Length = 780

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 6/63 (9%)
 Frame = +1

Query: 733 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 894
           YD+  G GV   ++D G++ D+ +       EG   +             + HGT CAG 
Sbjct: 153 YDNITGHGVVTAIVDDGLDYDNDDLKDNFCAEGSWDFNDNTALPKPRLSDDYHGTRCAGE 212

Query: 895 IAS 903
           +A+
Sbjct: 213 VAA 215

>Kpol_526.13 s526 (35940..37136) [1197 bp, 398 aa] {ON}
           (35940..37136) [1197 nt, 399 aa]
          Length = 398

 Score = 31.2 bits (69), Expect = 8.6
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = -1

Query: 705 QSFTMRNTSQT----PRSPSLSFKIRSMNYRVLLNQLN-QATFTN*IQHAISKVSKVAPQ 541
           QSFT    S T    P   +L++KI+ ++YR     LN     +N  +H I K+SK   +
Sbjct: 308 QSFTSHIESNTSILDPNDDNLNYKIKLLSYRNSQGNLNLPIALSNSQKHKIDKISKKRKR 367

Query: 540 RTCNLK 523
           +   LK
Sbjct: 368 KNNYLK 373

>SAKL0F05170g Chr6 (409898..411628) [1731 bp, 576 aa] {ON} similar
           to uniprot|P06208 Saccharomyces cerevisiae YNL104C LEU4
           Alpha-isopropylmalate synthase (2- isopropylmalate
           synthase) the main isozyme responsible for the first
           step in the leucine biosynthesis pathway
          Length = 576

 Score = 31.2 bits (69), Expect = 9.5
 Identities = 16/57 (28%), Positives = 27/57 (47%)
 Frame = +1

Query: 256 FEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIA 426
           F FDS  D  D    SL  +S +    YI + +     + VG+H+D+   + +  I+
Sbjct: 509 FAFDSDIDVQDYHEHSLGKDSNSKAATYISVSRGNFLQWGVGIHEDVTEASFLSLIS 565

>Suva_14.236 Chr14 (424595..426628) [2034 bp, 677 aa] {ON} YNL103W
           (REAL)
          Length = 677

 Score = 31.2 bits (69), Expect = 9.8
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 3/105 (2%)
 Frame = -1

Query: 618 LNQLNQATFTN*IQHAISKVSKVAPQRTCNLKHLLNTPFHTPSRNPFVMHTLSG---IKE 448
           ++ ++   FTN +    S+ +  +     +L HLL    HTPSR+  + + LS     K+
Sbjct: 267 ISSIDHGAFTN-VDITSSENNAASGNGADSLSHLLRRTTHTPSRSSPLSNVLSAQNTSKQ 325

Query: 447 RMPRVKLRNSLHMRRRNQILMHPDIIVRHTILENNNIPVRYSPRV 313
           R P  K  N+      N     P+I V    +   ++ V   PRV
Sbjct: 326 RQPDGKTNNN------NSSSTAPNITVPDYSIIPTSVLVTLLPRV 364

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 144,528,625
Number of extensions: 3075661
Number of successful extensions: 10470
Number of sequences better than 10.0: 88
Number of HSP's gapped: 10181
Number of HSP's successfully gapped: 94
Length of query: 576
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 461
Effective length of database: 40,294,809
Effective search space: 18575906949
Effective search space used: 18575906949
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)