Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30186.14ON57557530680.0
ACR012C6.14ON54158316810.0
SAKL0E01012g6.14ON54457916040.0
KLTH0C11396g6.14ON55048915810.0
KLLA0D00979g6.14ON56158415710.0
Kwal_56.223876.14ON54347215680.0
ZYRO0C07942g6.14ON54857915250.0
TDEL0G045506.14ON56448114970.0
Smik_5.276.14ON60847414830.0
Suva_5.76.14ON66454514840.0
Skud_5.296.14ON60850414690.0
YEL060C (PRB1)6.14ON63547514700.0
TBLA0A073006.14ON57347414560.0
CAGL0B03619g6.14ON46847514370.0
NCAS0F002206.14ON69545614330.0
Kpol_1032.56.14ON68047114290.0
NDAI0K028806.14ON70447414080.0
Kpol_1045.756.14ON47743413830.0
KNAG0E009206.14ON53157813820.0
KAFR0L003606.14ON50242413410.0
TPHA0M002306.14ON58557512531e-166
Smik_15.1726.14ON47842011991e-159
YOR003W (YSP3)6.14ON47841711751e-156
Suva_15.1786.14ON47642011741e-156
Skud_15.1646.14ON48242011661e-154
CAGL0E02651g6.14ON48542411251e-148
KAFR0B065506.14ON45635110361e-135
NCAS0D026306.14ON4514249701e-125
NDAI0I022806.14ON4824348991e-114
KNAG0F02970singletonON4203458631e-110
CAGL0L13266gsingletonON5794477773e-95
NCAS0D043906.313ON4924315314e-60
Kpol_1018.56.313ON4653265146e-58
TDEL0A072806.313ON4363665022e-56
Suva_3.846.313ON5274584993e-55
TBLA0F039706.313ON7343755084e-55
Skud_3.1246.313ON5404644952e-54
Smik_3.1496.313ON4913934894e-54
Kpol_1028.616.313ON5183164904e-54
CAGL0L10802g6.313ON5174764896e-54
ZYRO0D08822g6.313ON4903124851e-53
YCR045C (RRT12)6.313ON4913934842e-53
NDAI0I005606.313ON4834504762e-52
KLTH0A06094g6.313ON4962574772e-52
KNAG0I024706.313ON4753844752e-52
AAR069W6.313ON7683254883e-52
Ecym_21056.313ON6103094772e-51
SAKL0A02002g6.313ON4793614683e-51
Kwal_23.61836.313ON4932614456e-48
KAFR0J024506.313ON4783394438e-48
KLLA0F06028g6.313ON5083274396e-47
TPHA0D037606.313ON6073154438e-47
Kwal_33.133721.78ON3772973887e-41
TBLA0A067006.313ON4973173947e-41
KLTH0F02288g1.78ON3803123667e-38
Kpol_2000.691.78ON3863063253e-32
TPHA0B045201.78ON3883142954e-28
ZYRO0F16764g1.78ON3863142841e-26
TDEL0C062301.78ON3643072769e-26
TBLA0A054101.78ON3823422451e-21
NCAS0A008802.6ON8332981010.001
KLLA0D19811g2.6ON7562471000.002
SAKL0G00440g2.6ON836246940.010
NDAI0F038902.6ON833256920.019
KAFR0A080402.6ON766302880.054
Skud_14.1012.6ON81993870.067
Suva_14.1062.6ON809251860.097
KLTH0H00418g2.6ON81185840.14
YNL238W (KEX2)2.6ON814252830.18
KNAG0F007702.6ON826315830.19
ZYRO0F15598g2.6ON79085830.20
Ecym_64862.6ON781141820.27
TBLA0B001302.6ON842259820.28
Smik_14.972.6ON81490810.30
Kwal_56.248002.6ON80385800.49
TPHA0P017902.6ON799248790.55
CAGL0J07546g2.6ON78982751.6
ABL203W2.6ON768250742.1
TDEL0H013001.261ON715139723.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3018
         (575 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...  1186   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   652   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   622   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   613   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   609   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   608   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   592   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   581   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   575   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   576   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   570   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   570   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   565   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   558   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   556   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   555   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   546   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   537   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   536   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   521   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   487   e-166
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   466   e-159
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   457   e-156
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   456   e-156
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   453   e-154
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   437   e-148
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   403   e-135
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     378   e-125
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   350   e-114
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              337   e-110
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   303   3e-95
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   209   4e-60
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   202   6e-58
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   197   2e-56
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   196   3e-55
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   200   4e-55
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   195   2e-54
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   192   4e-54
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   193   4e-54
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   192   6e-54
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   191   1e-53
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   191   2e-53
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    187   2e-52
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   188   2e-52
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   187   2e-52
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   192   3e-52
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   188   2e-51
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   184   3e-51
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   176   6e-48
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   175   8e-48
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   173   6e-47
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   175   8e-47
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   154   7e-41
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   156   7e-41
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   145   7e-38
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   129   3e-32
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   118   4e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   114   1e-26
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   110   9e-26
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    99   1e-21
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    44   0.001
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    43   0.002
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    41   0.010
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    40   0.019
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    39   0.054
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    38   0.067
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    38   0.097
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    37   0.14 
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    37   0.18 
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    37   0.19 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    37   0.20 
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    36   0.27 
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    36   0.28 
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    36   0.30 
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    35   0.49 
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    35   0.55 
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    33   1.6  
ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homo...    33   2.1  
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...    32   3.4  

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score = 1186 bits (3068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/575 (100%), Positives = 575/575 (100%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60
           MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG
Sbjct: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60

Query: 61  KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG 120
           KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG
Sbjct: 61  KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG 120

Query: 121 VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS 180
           VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS
Sbjct: 121 VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS 180

Query: 181 LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF 240
           LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF
Sbjct: 181 LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF 240

Query: 241 NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA 300
           NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA
Sbjct: 241 NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA 300

Query: 301 SKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG 360
           SKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG
Sbjct: 301 SKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG 360

Query: 361 GKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW 420
           GKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW
Sbjct: 361 GKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW 420

Query: 421 GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS 480
           GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS
Sbjct: 421 GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS 480

Query: 481 ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG 540
           ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG
Sbjct: 481 ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG 540

Query: 541 KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI
Sbjct: 541 KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/583 (58%), Positives = 412/583 (70%), Gaps = 50/583 (8%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60
           MK+Q  V P    +T  A LILP  + E  L V    RG   +     + +    G    
Sbjct: 1   MKLQRAVWPAVALTTAQALLILPQAEDE--LVVAEAHRGQLVQWMARENQERKAQG---- 54

Query: 61  KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG 120
                           ++ SP+F                  + D +RAIPH+YIV+F++G
Sbjct: 55  ---------------AEQQSPLFR-----------------VDDVTRAIPHKYIVVFREG 82

Query: 121 VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARSVEGGIEEMFEIAG 179
           V+D +   H +LV  AH E++A+LD  H+FF +T G ++E GI+A   EGGIE  F +  
Sbjct: 83  VSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGE 142

Query: 180 SLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGS 239
            LRGY GYFT+ M+ L+R +  V  +E+DS+V ASDF TQ GAPWGLARVSHRE+LN GS
Sbjct: 143 QLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGS 202

Query: 240 FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTI 299
           FNKYLYDDN+G+GVT+YVIDTGINIDHV+FE RA WGKTIP+NDADYDGNGHGTHCAGTI
Sbjct: 203 FNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTI 262

Query: 300 ASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS--GDPNFKGSTANMS 357
           ASKTYGVAK A VVAVKVLR+NGTG+MSDVLRGVEY V  HRKA+   D  FKGSTANMS
Sbjct: 263 ASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMS 322

Query: 358 LGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYF 417
           LGGG+S AL+LAVDAAV AGIHFAVAAGNENQDACNTSPA+S+K ITV ASTL+DDRAYF
Sbjct: 323 LGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYF 382

Query: 418 SNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYT 477
           SNWG CVD+FAPG+NILSTYIGSDTAVATLSGTSMASPHVAGLL YFLSLQPD  SE+  
Sbjct: 383 SNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRN 442

Query: 478 GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSS 537
             +ISPE LKKK++ +G+K+ L+++PARTAN LI+NGGG  L  FW +K       K + 
Sbjct: 443 KQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFT- 501

Query: 538 SHGKADDFES-----ESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
               ADD E+     + L+  L S++ ++F   R  LDR+++I
Sbjct: 502 ---YADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/579 (55%), Positives = 409/579 (70%), Gaps = 39/579 (6%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGR-VPPPHHHKMGEHGRGR 59
           MKVQS +LP+A  +TL AAL++P +D   + DV +       + V      ++      +
Sbjct: 1   MKVQSTILPIAALTTLAAALVIPEVDKSSK-DVSVKEINSDSQEVLASFAKEITRAAAEK 59

Query: 60  GKGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKD 119
           G              EE K++P                 L S    +  IPHRYI++FK 
Sbjct: 60  G--------------EEVKLAP-----------------LVSSPQPANIIPHRYIIVFKK 88

Query: 120 GVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARSVEGGIEEMFEIA 178
             T  ++  H+++++ AH E++A+LD   SFF AT+G   E GI+A+S EGGI+E F+IA
Sbjct: 89  DATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIA 148

Query: 179 GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLG 238
             L GY GYFTD ++D IR +  V+ IE+DS+V AS+F+TQ GAPWGL+R+SHRERLNLG
Sbjct: 149 NMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLG 208

Query: 239 SFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGT 298
           SFNKYLYDD+AGKGVT+YVIDTGIN++H +F GRA WGKT+P ND D DGNGHGTHCAGT
Sbjct: 209 SFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGT 268

Query: 299 IASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS--GDPNFKGSTANM 356
           IAS+ YGVAKNA+VVA+KVLR+NG+GTMSDV++GVE+    H++AS      FKGSTANM
Sbjct: 269 IASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANM 328

Query: 357 SLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAY 416
           SLGGGKS AL+LAV+AAV AGIHFAVAAGNENQDACNTSPA+++  ITV ASTLSDDRAY
Sbjct: 329 SLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAY 388

Query: 417 FSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYY 476
           FSNWG CVDIFAPGLN+LSTYIGS+TA ATLSGTSMASPHVAGLL YFLSLQPDS SE++
Sbjct: 389 FSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFF 448

Query: 477 TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVS 536
             S I+P  LKKK++AY +K++L  +P  T N LI+NGGG  L  FW       EQ K  
Sbjct: 449 QASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGK---SEEQVKEE 505

Query: 537 SSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
            S     DF+   L++   + +  LF E+R+  D+L++I
Sbjct: 506 GSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNII 544

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/489 (61%), Positives = 368/489 (75%), Gaps = 19/489 (3%)

Query: 99  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGM- 157
           L S S    AIPHRYIV+FK  ++  +V  H+ +V+ AH++++A+L+  H FF +TE   
Sbjct: 69  LVSSSGKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFV 128

Query: 158 --------HHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDS 209
                   +    SA++ EGGI++ F+++G L GY GYFTD ++D IR + LV  +EQDS
Sbjct: 129 EDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDS 188

Query: 210 IVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEF 269
           +V A +F TQ GAPWGL+R+SHRE+LNLGSFNKYLYDD+AGKGVT+YVIDTG+N+DH +F
Sbjct: 189 VVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDF 248

Query: 270 EGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDV 329
           EGRA WGKTIP+ND D DGNGHGTHCAGTIASK YGVAKNA VVAVKVLR+NG+G+MSDV
Sbjct: 249 EGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDV 308

Query: 330 LRGVEYVVAEHRKA--SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNE 387
           ++GVE+    H+ A       FKGSTANMSLGGGKS AL++AV+AAV AGIHFAVAAGNE
Sbjct: 309 VKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNE 368

Query: 388 NQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATL 447
           NQDACN+SPAS++  +TV ASTL+DDRAYFSNWG CVDIFAPGLN+LSTYIGSDTA ATL
Sbjct: 369 NQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATL 428

Query: 448 SGTSMASPHVAGLLAYFLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPART 506
           SGTSMASPHVAGLL YFLSLQPDS SEY+     I+P  LKKK++AY +KN+L ++P  T
Sbjct: 429 SGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDT 488

Query: 507 ANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIR 566
            N LIFNGGG  LD FW  +    E E   SS       E ES +D L   +  L+ EIR
Sbjct: 489 VNYLIFNGGGEGLDDFWGKESVVDEVEDTISS-------EIESFIDALEEKTDVLYEEIR 541

Query: 567 NFLDRLDLI 575
              D +++I
Sbjct: 542 EVFDHMNII 550

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/584 (52%), Positives = 401/584 (68%), Gaps = 32/584 (5%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIR---LDVGLHGRGPHGRVPPPHHH--KMGEH 55
           MK ++ +L +   ST+  AL++P ++ E +     V +          P HH   K    
Sbjct: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60

Query: 56  GRGRGKGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIV 115
            RGR     +   +  VDD    ++P                 L++++D +  IP+RYI+
Sbjct: 61  SRGRCADSKKFDKLRPVDDASAILAP-----------------LSTVNDIANKIPNRYII 103

Query: 116 IFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARSVEGGIEEM 174
           +FK   +  +V  HQ+LV+  H + +  L     FF AT G H E G+ A S+EGGI++ 
Sbjct: 104 VFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDS 163

Query: 175 FEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRER 234
           F+IAGSL GY GYFT  ++D IR S LV+ +E+DS+V ++ F TQ  APWGLAR+SHRE+
Sbjct: 164 FDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREK 223

Query: 235 LNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTH 294
           LNLGSFNKYLYDD+AGKGVTAYV+DTG+N++H +F+GRA WGKTIP +D D DGNGHGTH
Sbjct: 224 LNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTH 283

Query: 295 CAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN--FKGS 352
           CAGTI S  YGVAKNA +VAVKVLR+NG+GTMSDV++GVEYV   H+KA  +    FKGS
Sbjct: 284 CAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGS 343

Query: 353 TANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSD 412
           TANMSLGGGKS AL+LAV+AAV AG+HFAVAAGNENQDACNTSPA+++  ITV ASTLSD
Sbjct: 344 TANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSD 403

Query: 413 DRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSG 472
           +RAYFSNWG CVDIF PGLNILSTYIGSDTA ATLSGTSMA+PHV GLL YFLSLQPD+ 
Sbjct: 404 ERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDAD 463

Query: 473 SEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCE 531
           SEY+     I+P  LKKK++ + +KN+L+++P  T N LI+NGGG  LD  W       +
Sbjct: 464 SEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWG------K 517

Query: 532 QEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
              +        +F  ESL++ L S + ++F ++R  LD+ ++I
Sbjct: 518 DYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/472 (63%), Positives = 365/472 (77%), Gaps = 11/472 (2%)

Query: 108 AIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARS 166
           AIPHRYIV+FKD V   +V  H ++V+ AH +++ +LD   +FF+AT  M  E GI A S
Sbjct: 79  AIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEAT--MDEEMGIMATS 136

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 226
            EGGI + F++ G LRGY GYFT  ++D IR + LV  +EQDS+V+A++F+TQ GAPWGL
Sbjct: 137 REGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGL 196

Query: 227 ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 286
           +R+SHRE+LNLGSFNKYLYDD AGKGVT+YVIDTGINIDH +FEGRA WGKT+P+ND D 
Sbjct: 197 SRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ 256

Query: 287 DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKA--S 344
           DGNGHGTHCAGTIASK YGVAKNA VVAVKVLR+NG+G+MSDV++GVE+    H+ A   
Sbjct: 257 DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKK 316

Query: 345 GDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCIT 404
               FKGSTANMSLGGGKS AL++AV+AAV AGIHFAVAAGNENQDACN+SPA+++  IT
Sbjct: 317 NKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAIT 376

Query: 405 VAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYF 464
           V ASTL+DDRAYFSNWG CVDIFAPGLN+LSTYIGS+TA ATLSGTSMASPHVAGLL YF
Sbjct: 377 VGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYF 436

Query: 465 LSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
           LSLQPDS SEY+     I+P  LKKK++AY +KN L ++P  T N LI+NGGG  LD FW
Sbjct: 437 LSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496

Query: 524 NSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
                  E++   +    A +F  ES++D L   +  L+ EIR   + L++I
Sbjct: 497 ---VKDLEEKVADAKDNTASEF--ESIIDALEEKTDGLYEEIREIFEGLNII 543

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/579 (53%), Positives = 399/579 (68%), Gaps = 35/579 (6%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60
           MK Q  V+PVA  + LG+ALI+P           L G   + + P             R 
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPE----------LTGSNEYEKRPE------------RT 38

Query: 61  KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVD--MKLASLSDNSRAIPHRYIVIFK 118
              + G SV+    E+         F    +Q+  D    L    D    + +RYI++FK
Sbjct: 39  DDVNNGESVVATSFEKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFK 98

Query: 119 DGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIA 178
            GV   ++G H++L+   H++ ++QL   HSFF   EG+  +G+    + GGI+  F+I 
Sbjct: 99  KGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF---EGIRLDGVYDSPL-GGIDHTFDIN 154

Query: 179 GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLG 238
           G L GY GYF   +LD+IR S L++++EQDS+V+    +T+ GAPWGLAR+SHRERLNLG
Sbjct: 155 GMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLG 214

Query: 239 SFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGT 298
           S+NKYLYD+  G GVT+YVIDTG+N+ H +F GRA+WGKTIP+ D D DGNGHGTHCAGT
Sbjct: 215 SYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGT 274

Query: 299 IASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKA--SGDPNFKGSTANM 356
           I S TYGVAK A +VAVKVLR+NG+G+MSDVL+GVE+   +H+ A     P FKGSTANM
Sbjct: 275 IGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANM 334

Query: 357 SLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAY 416
           SLGGGKS +L+ AV+AAVAAG++FAVAAGNE+QDACNTSPAS+   ITV ASTLSDDRAY
Sbjct: 335 SLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAY 394

Query: 417 FSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYY 476
           FSN+G CVD+FAPGLNILSTYIGSD++ ATLSGTSMASPHVAGLLAYFLSLQP S SE+ 
Sbjct: 395 FSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFD 454

Query: 477 TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVS 536
            GSSISP+ LKKK++A+ +K++L+++P+ T N LI+NGGGG L  FW SK    E E   
Sbjct: 455 AGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSKEVAQELE--- 511

Query: 537 SSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
               +  D E   L+D L S + ++FG+IR  +DRLD+I
Sbjct: 512 --FNEKVDLELHDLVDELGSKTDAVFGQIRGLMDRLDII 548

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/481 (60%), Positives = 369/481 (76%), Gaps = 21/481 (4%)

Query: 99  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMH 158
           +A LS    A PHRYIV+ K    + ++ +H + +T + ++++ +L     FF A     
Sbjct: 101 VAPLSIPPNAFPHRYIVVLKHSSPE-EIALHMEAITQSQLQSVGELAQDDPFFSA----- 154

Query: 159 HEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFET 218
            +G+      GGI++ F++AG L GY GYFTD +++LIR+S +V  +E DS VHAS+F+T
Sbjct: 155 -QGVR---TTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT 210

Query: 219 QTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKT 278
           Q GAPWGL+R+SHRERLNLGSFNKYL+DD AGKGVT+YVIDTGIN+ H +FEGRA WGKT
Sbjct: 211 QNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKT 270

Query: 279 IPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVA 338
           IP+ND D DGNGHGTHCAGTIASK YGVAK A VVAVKVLR+NG+G+MSDV++GVE+   
Sbjct: 271 IPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQ 330

Query: 339 EHRKASGDPN--FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSP 396
            H+KA  D    FKGSTANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQDACNTSP
Sbjct: 331 SHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSP 390

Query: 397 ASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPH 456
           A++++ +TV ASTLSDDRAYFSN+G CVDIFAPGLNILSTYIGSD A ATLSGTSMASPH
Sbjct: 391 AAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPH 450

Query: 457 VAGLLAYFLSLQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 514
           VAGLL YFLSLQPDS S+++   S  ++PE LKKK++AY +K++L ++P  T N LI+NG
Sbjct: 451 VAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNG 510

Query: 515 GGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDL 574
           GG  L  FW    DG ++++ ++   +  D + + L D L + + +LF ++R+ LDRL++
Sbjct: 511 GGHGLKGFW----DGHDKQEANT---RFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNI 563

Query: 575 I 575
           I
Sbjct: 564 I 564

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/474 (60%), Positives = 356/474 (75%), Gaps = 18/474 (3%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           S+ IP+RYIV+FK GV + +V  H++ V  A ++++  L    +FF +T   +     + 
Sbjct: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYL----ST 204

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
           S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A++F+TQ  APWG
Sbjct: 205 SEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWG 264

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           LAR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+NI+H +FE RA WGKTIP ND D
Sbjct: 265 LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 324

Query: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASG 345
            DGNGHGTHCAGTIASK YGVAKNA VVAVKVLR+NG+GTMSDV++GVEY    H+K + 
Sbjct: 325 LDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQ 384

Query: 346 DPN--FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403
           +    FKGSTANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQDACNTSPAS+ K I
Sbjct: 385 EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 444

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 445 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTY 504

Query: 464 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 505 FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSA 564

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           FWN             SH      E  ++ + + S +  LF ++R+ LD+L++I
Sbjct: 565 FWND---------TKKSHPSGSKHEL-NMDEFIGSKTDLLFEQVRDVLDKLNII 608

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/545 (55%), Positives = 386/545 (70%), Gaps = 46/545 (8%)

Query: 37  GRGPHGRVPPPHHHKMGEHGRG-RGKGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFV 95
           G+  HG+    HH K  E G+   GK HHRG           K++P+    +F+   D +
Sbjct: 160 GKEHHGK---KHHGKELEKGKEPHGKDHHRG-----------KLAPLVSTEQFNP--DAI 203

Query: 96  DMKLASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATE 155
                     ++ IP+RYI++FK  V   +   H++ V  A ++++  L    +FF +T 
Sbjct: 204 ----------TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTR 253

Query: 156 GMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASD 215
               +   + S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A+D
Sbjct: 254 ----DAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATD 309

Query: 216 FETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQW 275
           F+TQ  APWGLARVSHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+N++H +FE RA W
Sbjct: 310 FDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIW 369

Query: 276 GKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEY 335
           GKTIP ND D DGNGHGTHCAGTIASK YGVAKNA VVAVKVLR+NG+GTMSDVL+GVEY
Sbjct: 370 GKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEY 429

Query: 336 VVAEHRKASGDPN--FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACN 393
               H+K + +    FKGSTANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQDACN
Sbjct: 430 AAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACN 489

Query: 394 TSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMA 453
           TSPAS+ K ITV ASTLSDDRAYFSN+G CVD+FAPGLNILSTYIGSD A ATLSGTSMA
Sbjct: 490 TSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMA 549

Query: 454 SPHVAGLLAYFLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLI 511
           SPHVAGLL YFLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI
Sbjct: 550 SPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALI 609

Query: 512 FNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESE-SLMDCLHSTSHSLFGEIRNFLD 570
           +NGGG  L +FWN      + +K  SS G    F+ E +L + + S +  +F ++R+ LD
Sbjct: 610 YNGGGQDLSAFWN------DTKKSHSSSG----FKQELNLDEFIGSKTDLIFEQVRDVLD 659

Query: 571 RLDLI 575
           +L++I
Sbjct: 660 KLNII 664

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/504 (57%), Positives = 365/504 (72%), Gaps = 32/504 (6%)

Query: 77  DKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTA 136
           +K++P+    +FD +               + IP+RYI++FK GV       H++ V  A
Sbjct: 132 EKLAPLVSTAQFDPAA------------MPKIIPNRYIIVFKKGVPQEATDFHKESVHQA 179

Query: 137 HMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLI 196
            ++++  L    +FF +T     +   + S  GGI++ F I     GY GYFT  ++DLI
Sbjct: 180 QLQSVENLSAEDAFFISTR----DSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLI 235

Query: 197 RESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAY 256
           R++ LV  +E+DS+V A+DF+TQ  APWGLAR+SHRERLNLGSFNKYLYDD+AG+GVT+Y
Sbjct: 236 RQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSY 295

Query: 257 VIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVK 316
           VIDTG+N++H +FE RA WGKTIP ND D DGNGHGTHCAGTIASK YGVAKNA VVAVK
Sbjct: 296 VIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVK 355

Query: 317 VLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN--FKGSTANMSLGGGKSAALELAVDAAV 374
           VLR+NG+GTMSDV++GVEY    H+K + +    FKGSTANMSLGGGKS AL+LAV+AAV
Sbjct: 356 VLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAV 415

Query: 375 AAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNIL 434
            AGIHFAVAAGNENQDACNTSPAS+ K ITV ASTLSDDRAYFSNWG CVDIFAPGLNIL
Sbjct: 416 EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL 475

Query: 435 STYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYT--GSSISPEALKKKIVA 492
           STYIGSD A ATLSGTSMASPHVAGLL YFLSLQP S SE++     S++P+ LK K++ 
Sbjct: 476 STYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIH 535

Query: 493 YGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMD 552
           Y +K++L +VP  T N LI+NGGG  L +FWN      + +K  SS      F+ E  MD
Sbjct: 536 YSTKDILFDVPEDTPNALIYNGGGQDLSAFWN------DTKKSHSSR-----FKQELNMD 584

Query: 553 -CLHSTSHSLFGEIRNFLDRLDLI 575
             + S +  +F ++R+ LD+L++I
Sbjct: 585 EFIGSKTDLIFEQVRDVLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/475 (60%), Positives = 357/475 (75%), Gaps = 20/475 (4%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           S+ IP+RYI++FK G    ++  H++ V  A ++++  L    +FF +T+    +   + 
Sbjct: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTK----DTSLST 231

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
           S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DSIV A++F+TQ  APWG
Sbjct: 232 SEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWG 291

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           LAR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+NI+H +FE RA WGKTIP ND D
Sbjct: 292 LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 351

Query: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASG 345
            DGNGHGTHCAGTIASK YGVAKNA VVAVKVLR+NG+GTMSDV++GVEY    H+K + 
Sbjct: 352 LDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQ 411

Query: 346 DPN--FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403
           +    FKGSTANMSLGGGKS AL+LAV+AAV  GIHFAVAAGNENQDACNTSPAS+ K I
Sbjct: 412 EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAI 471

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 472 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTY 531

Query: 464 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 532 FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSA 591

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMD-CLHSTSHSLFGEIRNFLDRLDLI 575
           FWN         K S S G    F+ E  MD  + S +  +F ++R+ LD+L++I
Sbjct: 592 FWNDT-------KKSHSSG----FKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/474 (59%), Positives = 343/474 (72%), Gaps = 32/474 (6%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IPHRYI+ FK  V   ++  HQ  +     ++IAQL   H +F++ EG+         ++
Sbjct: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGL--------DLQ 176

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
             I + F I   L+GY GYFTD ++D IR + LV+ +EQDS V+ ++F+TQ GAPWGLAR
Sbjct: 177 QPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLAR 236

Query: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
           +SHRERLNLGSFNKYL+DD AG+GVTAYVIDTG+N++H +FEGRA WGKTIP+ND D DG
Sbjct: 237 ISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDG 296

Query: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH-----RKA 343
           NGHGTHCAGTIASK YGVAKNA VVAVKVLR+NG+G+MSDVL+GVEY  A H      K 
Sbjct: 297 NGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKK 356

Query: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403
           SG   FKGSTANMSLGGGKS +L+LAV+AAV AGIHFAVAAGNENQDACNTSPAS+K  I
Sbjct: 357 SG---FKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAI 413

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL+Y
Sbjct: 414 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSY 473

Query: 464 FLSLQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           FLSLQP+  SE+ T     I+P  LKK++++YG+K++L ++P  T N L+FNG G  L  
Sbjct: 474 FLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSD 533

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           FWN                K  D ES  +   L      L+ +      +++L+
Sbjct: 534 FWNI--------------SKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/475 (59%), Positives = 355/475 (74%), Gaps = 16/475 (3%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           +PH+YIV+ K GV+   V    + V+ AH   I  L   H FF+    ++ EG+      
Sbjct: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNF---VNAEGLP----R 54

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
           GGI+++F I    +G  GYF + ++ L+ +S +V+ +E+DS+VHAS+F+TQ  APWGLAR
Sbjct: 55  GGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLAR 114

Query: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
           +SHR+RLNLG+FNKYLYD+  G+GVTAYVIDTGIN+ HVEF+GRAQWGKTIP ND D DG
Sbjct: 115 ISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDG 174

Query: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS-GDP 347
           NGHGTHCAGTIASK YG+AK A VVAVKVL+++G+GTMSDV++GVEY    H K S  + 
Sbjct: 175 NGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNK 234

Query: 348 NFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAA 407
            FKGSTANMSLGGGKS AL++AV+AAV+AGIHFAVAAGNENQDACNTSPAS++K ITV A
Sbjct: 235 KFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA 294

Query: 408 STLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGLLAYFLS 466
           STLSDDRAYFSNWG CVDIFAPGLNILSTYIG ++   A+LSGTSMASPHVAGLL YFLS
Sbjct: 295 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS 354

Query: 467 LQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVP-ARTANNLIFNGGGGSLDSFW 523
           LQPDS SE+Y  S   ++P  LKKK++AY +KN+L ++P   + N LI+NG GG L  FW
Sbjct: 355 LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

Query: 524 NSKCDGCEQEKVSSSHGKADDFESESLMDCL---HSTSHSLFGEIRNFLDRLDLI 575
           NS     EQ         A +   +SL   +   H+ + SLFG++RN LD++++I
Sbjct: 415 NS-TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/456 (61%), Positives = 341/456 (74%), Gaps = 23/456 (5%)

Query: 90  SSQDFVDMKLASL----------------SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLV 133
           S QD V++K+A L                + NS  IP+RYIV+FK  +   +V  H++L+
Sbjct: 64  SVQDSVNLKMAPLVTPTPYPVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELI 123

Query: 134 TTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGML 193
               +E+ A+L     FF A+  +  E I+    +GGI   F I+  L GY GYFTD +L
Sbjct: 124 NQIQLESAAKLPKDDKFFSAS-AIEDESIN----QGGILTTFNISNLLNGYVGYFTDEVL 178

Query: 194 DLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGV 253
           +LIR + LV+ +E+DS+V A++F+ Q  APWGLAR+SHRERLNLGSFNKYLYDD+AGKGV
Sbjct: 179 ELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGV 238

Query: 254 TAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVV 313
           T YVIDTGIN +H +F  RA WGKTIP ND D DGNGHGTHCAGTIAS  YGVAKNA+VV
Sbjct: 239 TCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVV 298

Query: 314 AVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN--FKGSTANMSLGGGKSAALELAVD 371
           AVKVLR+NG+G+MSDV++GVE+    H KA+ +    FKGSTANMSLGGGKS  L+LAV+
Sbjct: 299 AVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVN 358

Query: 372 AAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGL 431
           AAV AGIHFAVAAGNENQDACNTSPAS+++ ITV ASTLSDDRAYFSNWG CVDIFAPGL
Sbjct: 359 AAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGL 418

Query: 432 NILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIV 491
           NILSTYIG D A ATLSGTSMASPHVAGLL YFLSLQP S SE++  + ++P  +KKK++
Sbjct: 419 NILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKLI 478

Query: 492 AYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKC 527
            Y SK++L ++P  T N LIFNG GG+LD  WN K 
Sbjct: 479 NYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKS 514

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/471 (58%), Positives = 346/471 (73%), Gaps = 26/471 (5%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IP++YI++FK  V+  D+ +H+DL+  A  +  +  D                 ++ S+ 
Sbjct: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDE----------------TSSSIL 275

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
           GGIEE F +A    GY G+F + ++  IR S +V  +EQDSIVHA++ +TQ  APWGLAR
Sbjct: 276 GGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLAR 335

Query: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
           +SHR+ LNLGS+NKYLYDD AG+GVTAYVIDTGINI H EF GRA WGKTIP ND D DG
Sbjct: 336 ISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDG 395

Query: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN 348
           NGHGTHCAGTIASK YGVAKNA+VVAVKVLR++G+GTMSDVL+GVEY    H+KA  +  
Sbjct: 396 NGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKK 455

Query: 349 --FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVA 406
             FKGSTANMSLGGGKS +L+LAVDAAV +GIHFAVAAGNENQDACN+SPA+S+  ITV 
Sbjct: 456 KGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVG 515

Query: 407 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 466
           ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL+YFLS
Sbjct: 516 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLS 575

Query: 467 LQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWN 524
           +QPD+ SE+++   +SISP  LKKK++AY +KNL  ++P +T N L++N  G ++  FW 
Sbjct: 576 MQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634

Query: 525 SKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
            K      E  +  + +A +FE E L+D     + +    I+   +R+DL 
Sbjct: 635 PKS-----ESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDLF 680

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/474 (57%), Positives = 344/474 (72%), Gaps = 11/474 (2%)

Query: 107 RAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARS 166
           R +P++YI++FKD +   ++  H++L++    ++ ++L P H FF +T     E      
Sbjct: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFR--- 293

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 226
             GGI   F I   L GY GYFT  ++DLIR + LVK +E+DSIV  ++F TQ  APWGL
Sbjct: 294 -NGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGL 352

Query: 227 ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 286
           +R+SHRERLNLGSFNKYLYDD+AGKGVT +VIDTGIN++HV+F  RA WGKTIPSND D 
Sbjct: 353 SRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412

Query: 287 DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH-RKASG 345
           DGNGHGTHCAGTIAS  YGVAKNA+VVAVKVLR+NG+G+MSDV++GVE+    H      
Sbjct: 413 DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKN 472

Query: 346 DPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITV 405
             ++KGSTANMSLGGGKS  L+LAV+AAV AGIHF+VAAGNENQDACN+SPAS++  ITV
Sbjct: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532

Query: 406 AASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGLLAYF 464
            ASTLSDDRAYFSNWG CVD+FAPGLNILSTY+G  +   ATLSGTSMASPHVAGLL YF
Sbjct: 533 GASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYF 592

Query: 465 LSLQPDSGSEYYTGSS---ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           LSLQPDS S ++   S   I+PE LKKK++AY + ++L ++P  T N LI+NG GG +  
Sbjct: 593 LSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISD 652

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
            WN K    EQ     +H    +FE+    D +   +   F +IRN  +++++I
Sbjct: 653 LWNGKVQ--EQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/434 (60%), Positives = 332/434 (76%), Gaps = 7/434 (1%)

Query: 96  DMKLASL-SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDAT 154
           +++ ASL + NS  IP+ YIV+F +GVT  ++ +H + ++   ++++  L   H FF  +
Sbjct: 21  EVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTIS 80

Query: 155 EGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHAS 214
                  +++  + GG+ +MF+I   L GY G FTD +++ +R S LVK IE+DS+VH +
Sbjct: 81  TS---SDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTT 137

Query: 215 DFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQ 274
           +  TQ  APWGLAR+SHR RLNL +FNKYLYDD  GKGV AYVIDTGINI +V+F GRA 
Sbjct: 138 EATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAY 197

Query: 275 WGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVE 334
           WGKTIP+ +A+ DGNGHGTH AGTIAS  YGVAK  KV AVKVLR+NG G+MSDVL+GVE
Sbjct: 198 WGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVE 257

Query: 335 YVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNT 394
           YVV  H++  G   FKGS ANMSLGGGKS +L+LAV+AAV AG+HFAVAAGNENQDACNT
Sbjct: 258 YVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNT 317

Query: 395 SPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMAS 454
           SPA++++ ITV ASTLSD RAYFSNWG CV IFAPGLNILSTYIGS  A ATLSGTSMAS
Sbjct: 318 SPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMAS 377

Query: 455 PHVAGLLAYFLSLQPDSGSEYYT---GSSISPEALKKKIVAYGSKNLLNNVPARTANNLI 511
           PH+AGL+AYFLSLQP   S++Y+    ++I+P+ LKKKIVA+G+KN L ++PA T N + 
Sbjct: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437

Query: 512 FNGGGGSLDSFWNS 525
           +NG G SL+ FWN+
Sbjct: 438 YNGAGKSLEDFWNA 451

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/578 (50%), Positives = 377/578 (65%), Gaps = 50/578 (8%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60
           MK+   VL     + +  AL+LP    EIR + G+  +G HG       H + EHGR RG
Sbjct: 1   MKITQPVLWAVALNRVAEALVLP----EIRDERGV-SQGEHGG----RRHDVEEHGR-RG 50

Query: 61  KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKL-ASLSDNSRAIPHRYIVIFKD 119
           + HH          E+D+  P     E    ++   +    S    S +  ++YI++FK+
Sbjct: 51  RPHHGPKH------EKDEHRPCKHGKEAHDEEELAPLYTPGSALSASSSRSNKYIILFKE 104

Query: 120 GVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAG 179
           GVT   +  H+ L+    +ET                     +SA+ +   + + F++ G
Sbjct: 105 GVTAEQISAHKQLLQQVLLET-------------------SDVSAQGIVADVLDSFDLEG 145

Query: 180 SLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGS 239
            L GY    +  +L+L+R S  V+L+EQDS VH ++F+TQ  APWGLAR+SHR+ L+LGS
Sbjct: 146 VLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGS 205

Query: 240 FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTI 299
           FNKYLYDD AG+GV +Y+IDTGIN+ H EFEGRAQWGKTIP ND D DGNGHGTHCAGTI
Sbjct: 206 FNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTI 265

Query: 300 ASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH--RKASGDPNFKGSTANMS 357
           ASK YGVAK A V+AVKVLR+NG+G+MSDV+ GVE+   +H  +  S D  FKGSTANMS
Sbjct: 266 ASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMS 325

Query: 358 LGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYF 417
           LGGGKS +L+  VDAAV  G+HF+VAAGNENQDACNTSPA+S++ ITV ASTLSDDRAYF
Sbjct: 326 LGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYF 385

Query: 418 SNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYT 477
           SNWGSCVDIFAPGLNILSTY GSD A ATLSGTSMASPHVAGLL YFLSLQP+  S++ T
Sbjct: 386 SNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGT 445

Query: 478 GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSS 537
            + I+PE LKKK++ Y +K +L ++P  T N LI+NGGG  L  FW  K  G +  K   
Sbjct: 446 SAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDK--GKKSHKPLF 503

Query: 538 SHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           +H            D + ++S ++F ++R    +L++ 
Sbjct: 504 AHE----------YDNVWASSDAMFEQVRAMFGKLNIF 531

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/424 (59%), Positives = 319/424 (75%), Gaps = 5/424 (1%)

Query: 103 SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGI 162
           +D    IPHRYI++FKDGV+   +  H++L+TT H++  +      + +  T+    E  
Sbjct: 52  ADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPE-- 109

Query: 163 SARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGA 222
           S R   GGI   F+I+  L GY  Y +D +L  IR + L+  IE D++VH +DF TQ  A
Sbjct: 110 SMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNA 169

Query: 223 PWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSN 282
           PWGLAR+SHRE LNL +FNKYLYDD+AGK V AYVIDTG++++HVEF  RA WGKTIP N
Sbjct: 170 PWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLN 229

Query: 283 DADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH-R 341
           D D DGNGHGTH AGTI S+ YGVAK+  ++AVKVLR+NG+G+MSDV++GVE+ V+ H  
Sbjct: 230 DQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLE 289

Query: 342 KASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKK 401
           +   + N KGS ANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQ+ACN+SPAS+++
Sbjct: 290 RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349

Query: 402 CITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGL 460
            +TV AST+SD+RAYFSNWG CVDIFAPGLNILSTYIG+ D   ATLSGTSMASPHVAGL
Sbjct: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409

Query: 461 LAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLD 520
           LAY+LSLQP+  SE+ T  +IS   LKKK++ Y +K++L ++P  T N LI+NGGG  L 
Sbjct: 410 LAYYLSLQPEKSSEFST-RAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLS 468

Query: 521 SFWN 524
            FWN
Sbjct: 469 DFWN 472

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  487 bits (1253), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 282/575 (49%), Positives = 369/575 (64%), Gaps = 45/575 (7%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGL-HGRGPHGRVPPPHHHKMGEHGRGR 59
           MK+Q+ ++   + +++  AL++P +D        L HG   +  VP              
Sbjct: 35  MKLQNTLVSAVIAASVAEALVIPALDQGRGRGHALDHGPNNNNNVP----------AFMM 84

Query: 60  GKGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNS--RAIPHRYIVIF 117
                  S++ +V D  D++   +++    +S     ++LA+L DN    A   RYI++F
Sbjct: 85  RAAAAPASAMEMVKDVTDQILAYYQH----ASPASRGLELAALHDNGVGTADHDRYIIVF 140

Query: 118 KDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISA-RSVEGGIEEMFE 176
           K GV    V  H  +++        +  P  +           G SA R     + + FE
Sbjct: 141 KKGVFKEQVDQHLKMMSALFRRLSEEQRPAAA----------PGASALRDGFDRVMDTFE 190

Query: 177 IAGSLRGYFGYF-TDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERL 235
           +AG+  GY     +  ++D IR + LV  +E+DS+VH+ D ETQ  APWGLAR+SHRE L
Sbjct: 191 VAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGL 249

Query: 236 NLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTH 294
           NLG+FNKYLY  N AGKGVTAYV+DTGI++ H+EF  RA+WGKTIP ND D DGNGHGTH
Sbjct: 250 NLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTH 309

Query: 295 CAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRK------ASGDPN 348
           CAGTI S+ YGVAK A +VAVKVLR++G+GTMSDVL+GVE+V  EH K         + N
Sbjct: 310 CAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSN 369

Query: 349 FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAAS 408
           +KG+TANMSLGGGKS AL+ AV+AAV AG+HFAVAAGNENQDACN+SPA+++  ITV AS
Sbjct: 370 YKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGAS 429

Query: 409 TLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQ 468
           TLSDDRAYFSN+G CVDIFAPGLNILSTYIG++ A ATLSGTSMASPHVAGLL Y LSLQ
Sbjct: 430 TLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQ 489

Query: 469 PDSGSEYYT-GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKC 527
           PD GSE+Y   S ++P  +KKKI+ Y +KN L ++PA T N LI+NGG  S D FW S  
Sbjct: 490 PDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNSTD-FWASAA 548

Query: 528 DGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLF 562
              +  KV     K + +   S +D +  +++  F
Sbjct: 549 -APQSHKV-----KTNRYSLGSFLDSIQDSNNHWF 577

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  466 bits (1199), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 227/420 (54%), Positives = 302/420 (71%), Gaps = 7/420 (1%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           +  IP+RYIV+F + ++   +  H+ +V  AH  ++++L     F +         I+  
Sbjct: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS----SIAPD 119

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
              GGI+  F+I G  RGY GYFTD +L+L+ +  L+K IEQ+S V  S+   Q  APWG
Sbjct: 120 LQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWG 179

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           L R+SHRE+   G   +YLY+D AG+GVT+YV+DTGI+ +H +FEGRA WG  IP ND  
Sbjct: 180 LHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEA 239

Query: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS- 344
            D NGHGTHCAG I SK YGVAKN K+VAVKVLR+NG GT+SDV++G+EYV  EH ++S 
Sbjct: 240 SDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSR 299

Query: 345 -GDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403
                FKGSTAN+SLG  KS A+E+AVDAAV +G+HFA+AAGNEN+DAC +SPA ++K I
Sbjct: 300 KKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSI 359

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 360 TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSY 419

Query: 464 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
           FLSLQP   SEY+  +++SP+ LK+K++ + +  +L ++   T N LI+NGGG  LD  W
Sbjct: 420 FLSLQPAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  457 bits (1175), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/417 (52%), Positives = 299/417 (71%), Gaps = 7/417 (1%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           +P+RY+++F + ++   +  H  +V   H  ++ +L    +F+                 
Sbjct: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQF---- 122

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
           GGI+  F+I G  RGY GYFTD ++ +I +  ++K +EQ++ V  S+   Q  APWGL R
Sbjct: 123 GGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHR 182

Query: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
           VSHRE+   G   +YLY+D AGKGVT+YV+DTGI+ +H +FEGRA+WG  IP+ND   D 
Sbjct: 183 VSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDL 242

Query: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN 348
           NGHGTHCAG I SK +GVAKN K+VAVKVLR+NG GT+SDV++G+EYV  EH ++S   N
Sbjct: 243 NGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKN 302

Query: 349 --FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVA 406
             FKGSTAN+SLG  KS A+E+AV+AAV +G+HFA+AAGNE++DAC +SPA ++K ITV 
Sbjct: 303 KEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVG 362

Query: 407 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 466
           AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMASPHVAG+L+YFLS
Sbjct: 363 ASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLS 422

Query: 467 LQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
           LQP   SE++  +  SP+ LK+K++ + ++ +L ++   T N LI+NGGG  LD FW
Sbjct: 423 LQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  456 bits (1174), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/420 (52%), Positives = 304/420 (72%), Gaps = 9/420 (2%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           + ++P+RYI+ F +  +   +  H+ ++     E++++L    +FF +T           
Sbjct: 64  AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQF--- 120

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
              GGI+  F+I G  RGY GYFT+ ++  + +  ++K IEQ+S V  ++   Q  APWG
Sbjct: 121 ---GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWG 177

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           L R+SHRE+   G   +YLY+D AG+GVT+YV+DTGI+I+H +FEGRA WG  IP ND  
Sbjct: 178 LHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEA 237

Query: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS- 344
            D NGHGTHCAG I S+ +GV KN  +VAVKVLR+NG GT+SDV++G+EYVV +H  +S 
Sbjct: 238 SDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSK 297

Query: 345 -GDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403
            G P FKGSTAN+SLG  KS A+E+AV+AAV +G+HFA+AAGNE++DAC +SPA ++K I
Sbjct: 298 KGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSI 357

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV AST SDDRA+FS+WG+CVD+FAPG+NILSTYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 358 TVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSY 417

Query: 464 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
           FLSLQP S SE++  S++SP+ LK+KI+ + ++ +L +V   T N LI+NGGG  LD+FW
Sbjct: 418 FLSLQPSSDSEFFD-STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  453 bits (1166), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 217/420 (51%), Positives = 297/420 (70%), Gaps = 7/420 (1%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           S+++P+RYI++F + +T+  +  H  ++  A   +++++    SF            S  
Sbjct: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSA----SASPN 121

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
              GGI+  F+I G  RGY GYFTD +++++ +  LVK IE +S V  S+   Q  APWG
Sbjct: 122 PQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWG 181

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           L R+SHRER   G   +YLY+D AG GVT+YV+DTGI+ +H +FEGRA+WG  IP ND  
Sbjct: 182 LHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA 241

Query: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASG 345
            D NGHGTHCAG I S+ +GVAKN  ++AVKVLR+NG GT+SDV++G+EYV   H  +S 
Sbjct: 242 SDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSK 301

Query: 346 D--PNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403
                FKGSTAN+SLG  KS A+E+AV+AAV  G+HFA+AAGNE++DAC +SPA ++K I
Sbjct: 302 KRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSI 361

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 362 TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSY 421

Query: 464 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
            LSLQP   SE++   ++SP+ LK+KI+ + ++ +L +V   T N L++NGGG  LD FW
Sbjct: 422 LLSLQPAQDSEFFY-DTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  437 bits (1125), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 230/424 (54%), Positives = 292/424 (68%), Gaps = 15/424 (3%)

Query: 105 NSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFF---DATEGMHHEG 161
           N   IP+RYIV+FKD VTD ++         +H+  I +++    F    D  +   +  
Sbjct: 70  NDMIIPNRYIVLFKDFVTDKEI--------QSHLSAIEEINSSSIFLQDSDFGKATQYND 121

Query: 162 ISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTG 221
           IS R +  G++  F I  S+ GY GYFT+     I  S LV+L+E DSIV  ++++ Q  
Sbjct: 122 ISTRGI--GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEH 179

Query: 222 APWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPS 281
            PWGL R+S RE+L +     Y YDD  GK    +VIDTGI +DH +FEGRA WGKTI  
Sbjct: 180 VPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVE 239

Query: 282 NDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVV-AEH 340
           ND DYD NGHGTHCAGTIASK YG+AK A+V+AVKVLR++G+G+MSDV+RGVEY V A +
Sbjct: 240 NDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYN 299

Query: 341 RKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSK 400
                  N KG+  NMSLG  KS AL  A+DAA AAGI FAVAAGNE+ DACN+SPAS+ 
Sbjct: 300 DLKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAW 359

Query: 401 KCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGL 460
             ITV  STLSDD A+FSN+G CVDIFAPG+NI+STYIGS  A  +LSGTSM+SPHVAG+
Sbjct: 360 SPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGV 419

Query: 461 LAYFLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSL 519
           LAY+LSLQPD  S++Y   S+ISP+ LKKK++ Y +   L+ +PA T N L++NGGG +L
Sbjct: 420 LAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNL 479

Query: 520 DSFW 523
             FW
Sbjct: 480 SKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  403 bits (1036), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 199/351 (56%), Positives = 253/351 (72%), Gaps = 5/351 (1%)

Query: 174 MFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRE 233
           +F+I  +L GY        L L+R+  +V+LIE DS VHA   + Q   PWGL+R+S R 
Sbjct: 107 IFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRP 166

Query: 234 RLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGT 293
           R+ +G    Y YDD     VTAYV+DTGI I H +F GRA+WGKTI  ND D D +GHGT
Sbjct: 167 RVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGT 226

Query: 294 HCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNF-KGS 352
           H AG IAS  +GVAK  +VVAVKVLR+NG G MSDVL+G+E+VV +H K   + N+ KGS
Sbjct: 227 HVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK---NKNYSKGS 283

Query: 353 TANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSD 412
             N+SLG  KS AL LA+DAA++  IHFAVAAGNEN DAC TSPA +++ ITV AS  SD
Sbjct: 284 VVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSD 343

Query: 413 DRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSG 472
           +RA+FSNWG CVD+FAPG+N++STYIGSD A  +LSGTS A+P+ AGL+AY+LSLQPD  
Sbjct: 344 ERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKD 403

Query: 473 SEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
           S Y+TG  ++P  LK+KIVA+GSK++L  +P  T N +I+NG G +L  FW
Sbjct: 404 SGYFTG-EMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  378 bits (970), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 264/424 (62%), Gaps = 32/424 (7%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IP++YIV+FK   TD     H   + +  + T    DP ++   +               
Sbjct: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNT----DPQYTILHS--------------- 93

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
                 F++A  L+GY     + ++  +    +++ IEQDS VHA   + Q  +PWGLAR
Sbjct: 94  ------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLAR 147

Query: 229 VSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTI-PSNDADY 286
           +S RERL L     Y YDD+ A      Y++DTGIN +H EF+GRA+WG    P      
Sbjct: 148 ISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQE 207

Query: 287 DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHR---KA 343
           D NGHGTHCAG I S  YGVAKN  ++AVKVL   G G MS V+RG+EYV  +H    K 
Sbjct: 208 DENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKK 267

Query: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403
                FKGS  N+SLG GKS AL   ++AAV  G+HFAVAAGNE+ DAC+TSPA S   +
Sbjct: 268 QDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHAL 327

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGLLA 462
           TV AS+ SDDR +FSNWG CVD+FAPG+NI+STYIG  +    +LSGTSM++P V GL+A
Sbjct: 328 TVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIA 387

Query: 463 YFLSLQPDSGSEYYTG-SSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           YFLSLQPD+ S++YTG +S +P  LK KI+++ ++ +L+ +P  T N +++NGGG SL  
Sbjct: 388 YFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKD 447

Query: 522 FWNS 525
           FWN+
Sbjct: 448 FWNN 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  350 bits (899), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/434 (43%), Positives = 267/434 (61%), Gaps = 36/434 (8%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IP +YIV+F++  TD  +   +  +++   E   + +   ++                  
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY------------------ 104

Query: 169 GGIEEMFEIAGSLRGYF------GYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGA 222
             +   F+I+   +G         +  D   ++     ++K+IE+DS VH + F TQ  +
Sbjct: 105 SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDS 164

Query: 223 PWGLARVSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPS 281
            WGL+R+S R  L L     Y YDDN +GKGV  Y++DTGIN +H+EFEGRA WG ++P 
Sbjct: 165 SWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPV 224

Query: 282 NDADY-DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH 340
            +    D NGHGTHCAG I SKTYGVAK   ++AVKVL   G G+MSDV+ G+E+V   H
Sbjct: 225 TEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSH 284

Query: 341 RKASGD--------PNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDAC 392
              + +          FKGS  N+SLG  KS +L++A+++A   GIH  VAAGNE++DAC
Sbjct: 285 TNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDAC 344

Query: 393 NTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTS 451
            TSPA S   ITV AS+ SDDRA+FSNWG CVD+FAPG+NI STYIG ++    +LSG+S
Sbjct: 345 MTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSS 404

Query: 452 MASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLI 511
           M+SP V+GL AY+LSLQPD  S+++  S ++P+ LK+KI+ + +  +L  +P  TAN L+
Sbjct: 405 MSSPFVSGLTAYYLSLQPDVSSQFH-DSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLV 463

Query: 512 FNGGGGSLDSFWNS 525
           +NGGG  L  FWN+
Sbjct: 464 YNGGGKDLSGFWNA 477

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  337 bits (863), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 171/345 (49%), Positives = 232/345 (67%), Gaps = 5/345 (1%)

Query: 173 EMFEIAGSLRGY-FGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSH 231
           E F IA  L G+    F    +  + +   V+++E +S V+A +   Q   PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 232 RERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNG 290
           R+R+ +G    Y YD   + K V  Y++DTGI +DH EFEGRA+WGKTI  ND D D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 291 HGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFK 350
           HGTHCAG +   TYGVAK A ++AVKVL   G G MSDV+RG+E+ V EH   + D   +
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQD-EVR 253

Query: 351 GSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTL 410
           GS  N+SLG G+S AL+  V AA+  G+HFAVAAGNE+ +AC +SPA+    +TV  ST 
Sbjct: 254 GSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTF 313

Query: 411 SDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGLLAYFLSLQP 469
           SDDRA+FSNWG C+D+FAPG+N+ S+Y+G +     +LSGTS ++PHVAGL+AY LSL+P
Sbjct: 314 SDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEP 373

Query: 470 DSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 514
           D+ S+++T  S +P  LK+K+V+  ++  L  VP  TAN +IFNG
Sbjct: 374 DTKSQFHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  303 bits (777), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 168/447 (37%), Positives = 253/447 (56%), Gaps = 17/447 (3%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           +P+RYIV+FK+     ++ +H   V    +     L P   FF      HH      S E
Sbjct: 69  VPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFF------HHTRDKEFSTE 122

Query: 169 --GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 226
             GG+   F+I     GY GYFTD +++ IR+  +V  +E DSI+   D ET + + W L
Sbjct: 123 ELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHL 182

Query: 227 ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 286
           AR+SHR +L L +FN+Y +D N G+ + AY++DTG+   H  +  R   G  I  N+ + 
Sbjct: 183 ARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDER 242

Query: 287 DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGD 346
           D NGHGT  AG +  +  GVA+ A ++ VKVL   G GT+S++++G+ +V   H +    
Sbjct: 243 DMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRIEK 302

Query: 347 PNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVA 406
               G+    S+ G KS +L  A D  V++GIH  V AG +  +ACN+SPASS K ITVA
Sbjct: 303 NGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPITVA 362

Query: 407 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSD----TAVATLSGTSMASPHVAGLLA 462
             +++D+     NWGSCVDI+ PG  + +TY   +    T   +++G+S A+  VAGLLA
Sbjct: 363 GMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGLLA 422

Query: 463 YFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSF 522
           YF SLQP  G+       ++PE LK++++ +G+K  L N+   + N + FNG GG+LDSF
Sbjct: 423 YFASLQPGLGTPDVI--PLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLDSF 480

Query: 523 WNSKCDGCEQEKVSSSHGKADDFESES 549
           +N   DG E    ++ +    D  +E+
Sbjct: 481 FN---DGSEIVPTATKNVDPSDVPTET 504

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  209 bits (531), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 160/431 (37%), Positives = 223/431 (51%), Gaps = 69/431 (16%)

Query: 128 MHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARS-VEGGIEEMFEIAGSLRGYFG 186
           + + +    ++ ++ Q D   SF D+T      G S +  +   I + F I GS +G+  
Sbjct: 17  LQEPIYGREYLVSLKQNDSIQSFMDST---ITRGRSVKEYLRDKIGKTFSI-GSFKGFTV 72

Query: 187 YFTDGMLDLIRESGLVKLIEQDSIVHASD------------------------FETQTGA 222
             TD +L+ I+++ LV  +  +  VHA +                         + Q GA
Sbjct: 73  DLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSVKVQYGA 132

Query: 223 PWGLARVSHRERLN---------LGSFNKYLYDDNA-GKGVTAYVIDTGINIDHVEFEGR 272
           P  LAR+S R++L          L S  KY YD  + G  V AY+ID+GI ++H EF GR
Sbjct: 133 PRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYLEHEEFNGR 191

Query: 273 AQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRG 332
           A  G  + + +   D NGHGTH AG + SK+YGVAK  K++ +KVL   G G+++ VL G
Sbjct: 192 AIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLAMVLGG 250

Query: 333 VEYVVAEHRKASGDPNFKG-STANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDA 391
           +E+ V   ++ S     KG   AN+SLG  ++A L  A+ AA+ AG+   VAAGN N +A
Sbjct: 251 IEFAVKHCQETSK----KGRCVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAGNNNLNA 306

Query: 392 CNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATL 447
           C  SPAS+ + ITV A    DDR    A FSNWG C+DIFAPG+ I S  I  D    T 
Sbjct: 307 CWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKDKEDVTY 363

Query: 448 SGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----VP 503
           SGTSMASP VAGL A  L    D G        +S E +K  I+  G+ N+ +       
Sbjct: 364 SGTSMASPTVAGLAALTL----DQG--------VSAEEVKDYILEMGTDNVFHRRSLLFK 411

Query: 504 ARTANNLIFNG 514
             T N + FNG
Sbjct: 412 PGTPNKICFNG 422

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  202 bits (514), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 184/326 (56%), Gaps = 47/326 (14%)

Query: 219 QTGAPWGLARVSHRERL--NLGSFNKYLYDDNA----------GKGVTAYVIDTGINIDH 266
           Q  AP  L+R+S R +L  ++ + ++Y   DNA          G  V AY+IDTGI  +H
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRY---DNAFDYYFDAKYQGSSVNAYIIDTGIYKEH 171

Query: 267 VEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTM 326
            EFEGR ++   + + +   D NGHGTH AG + SKT+GVAK   ++ VK L   G G +
Sbjct: 172 PEFEGRVKFAIDL-TQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQL 230

Query: 327 SDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGN 386
           S +L+ +E+ +  H K S D   K   AN+S G  ++A ++ A+  A  AGI   VAAGN
Sbjct: 231 STILKALEFTI-RHCKESVD---KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGN 286

Query: 387 ENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYIGS 440
            N DAC  SPASSK  ITV A    DDR    A FSNWGSCVD+FAPG+ +  LS   GS
Sbjct: 287 SNIDACWNSPASSKDVITVGAF---DDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGS 343

Query: 441 DTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLN 500
           D  V  LSGTSMASP V+G+ A  L    D G        ++P+ +K KI+   +KN+ +
Sbjct: 344 D--VLLLSGTSMASPSVSGIAAILL----DKG--------LNPKFVKSKIIESSTKNIFH 389

Query: 501 N----VPARTANNLIFNGGGGSLDSF 522
                +   T N ++FNG     DSF
Sbjct: 390 QGTIMIKPNTPNLIVFNGIEKMDDSF 415

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  197 bits (502), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 184/366 (50%), Gaps = 53/366 (14%)

Query: 192 MLDLIRESGLVKLIE---QDSIVHASDFE----------TQTGAPWGLARVSHRERLNL- 237
           ++D IR S LV  +    Q       DFE           Q GAP  L+R+S R +L   
Sbjct: 74  LVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYD 133

Query: 238 ---------GSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
                    GSFN Y  + + G G+ AY+IDTGI  +H EF GRA +G+ + + +   DG
Sbjct: 134 FEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDG 192

Query: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN 348
           NGHGTH AG + S  YGVAK+  +V VK L   G G ++ V+  +E+ V   R + G   
Sbjct: 193 NGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHCRSSEG--- 249

Query: 349 FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAA- 407
            KG   N+SLG  +++ +  AV AA  AGI   VAAGN N +AC  SPAS+ + ITV A 
Sbjct: 250 -KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGAF 308

Query: 408 STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSL 467
              +D  A FSNWGSCVDIFAPG+ + S            SGTSMASP + GL A  L  
Sbjct: 309 DDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL-- 366

Query: 468 QPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPAR--------TANNLIFNGGGGSL 519
             D G  Y             KI  Y  K   N+V  R        T N + FNG   + 
Sbjct: 367 --DEGVPY------------DKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKND 412

Query: 520 DSFWNS 525
           D F N+
Sbjct: 413 DKFSNA 418

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  196 bits (499), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 153/458 (33%), Positives = 218/458 (47%), Gaps = 67/458 (14%)

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLV------------------------ 202
           ++  IE+ F I GS RG     +  +++ +++S L+                        
Sbjct: 85  IDHRIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNT 143

Query: 203 --KLIEQDSIVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDNAGK 251
             K   QD I  A +   Q  AP  LAR+S   +L             FN Y  D+  G+
Sbjct: 144 TAKYAYQD-IDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQ 202

Query: 252 GVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAK 311
           GV AY++DTGI+ +H EFE R   G  + + +   D NGHGTH AG + S+T+G AK   
Sbjct: 203 GVNAYIMDTGIHAEHPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVS 261

Query: 312 VVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVD 371
           +V VKVL  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S  + +AV+
Sbjct: 262 LVEVKVLGKDGSGEASNVLSGLEFIV-EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVE 320

Query: 372 AAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPG 430
            A+  GI F  AAGN N DA   SPAS++  ITV A     D  A FSNWG CV+IFAPG
Sbjct: 321 GAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPG 380

Query: 431 LNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKI 490
           + I S    +D     LSGTSM++P V G+ A  LS              I PE + ++I
Sbjct: 381 VEIESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS------------KGIEPELIAQEI 428

Query: 491 VAYGSKNLLNN----VPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFE 546
               ++N+ +         T N +++NG     D + +        E ++    + +   
Sbjct: 429 EYLSTRNVFHRRTLFFKPSTPNQILYNGVDKLDDPYDDETFPRLNVEAIAKELEEYNATL 488

Query: 547 SESLMDCLHSTSHSL---------FGEIRNFLDRLDLI 575
             ++ D LHS S             GEIR  L R D I
Sbjct: 489 QGAMTDDLHSGSKLWGWNNDVTLPLGEIR--LKRRDFI 524

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  200 bits (508), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 141/375 (37%), Positives = 194/375 (51%), Gaps = 40/375 (10%)

Query: 214 SDFETQTGAPWGLARVSHRERL-----NLGSFNK---YLYDDN-AGKGVTAYVIDTGINI 264
           S F+ Q GAP  LAR+S R++L     N   F +   Y YDDN  G+GV AYVIDTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 265 DHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTG 324
           +H +FE R ++G  +    A  D NGHGTH AG I SKTYGV K  K++ VK +   G+ 
Sbjct: 342 EHKDFEDRVEFGTDLTGEGAG-DLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 325 TMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAA 384
            +S ++  +EY V +    +   + K    NMSLG      +  AV++A+A G+ F VAA
Sbjct: 401 QLSHIIEAIEYTVND---CNSRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAA 457

Query: 385 GNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGS 440
           GN N DAC +SP SSK  ITV A    DDR    A FSNWG CVDIFA G+ + S     
Sbjct: 458 GNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQV 514

Query: 441 DTAVATLSGTSMASPHVAGLLAYFLS--LQPDSGSEYYTGSSISPEALKKKIVAYGSKNL 498
                  SGTSMASP V G ++  LS  ++P+   E     S   +  ++ ++       
Sbjct: 515 PYKYIKYSGTSMASPIVCGFVSILLSQGVKPNDVQEEMVKLSTKGDFTRRSLI------- 567

Query: 499 LNNVPARTANNLIFNGGGGSLDSFWNSKCDG-C----EQEKVSSSHGKADDFESESLMDC 553
                  T+N ++FNG     DS+ N + +  C    E+E +  +  K      +S    
Sbjct: 568 ---FKPFTSNRILFNGMDPR-DSYENDEMENDCGEDYEEEIIDRNSNKL--LMEKSSKLV 621

Query: 554 LHSTSHSLFGEIRNF 568
           L      ++ +IRNF
Sbjct: 622 LDLDLDLIYEDIRNF 636

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  195 bits (495), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 158/464 (34%), Positives = 219/464 (47%), Gaps = 75/464 (16%)

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLV------------------------ 202
           ++  IE+ F I GS RG     +  +++ +++S LV                        
Sbjct: 94  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDGTNDAELNY 152

Query: 203 ------KLIEQDSIVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDD 247
                 K + +D I  A +   Q+ AP  LAR+S   +L             FN Y  DD
Sbjct: 153 TFNATAKYLYED-IDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDD 211

Query: 248 NAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVA 307
             G+ V AY++DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG A
Sbjct: 212 YLGQDVNAYIMDTGIFSDHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAA 270

Query: 308 KNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALE 367
           K   +V VKVL  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S  + 
Sbjct: 271 KKVNLVEVKVLGKDGSGEASNVLSGLEFIV-EHCTRVSRPQGKKCVANLSLGSFRSPIIN 329

Query: 368 LAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDI 426
           +AV+ A+  GI F  AAGN N DA   SPAS++  ITV A     D  A FSNWG CV+I
Sbjct: 330 MAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNI 389

Query: 427 FAPGLNI--LSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPE 484
           FAPG+ I  LS     DT +  LSGTSM++P V G+ A  LS              I P 
Sbjct: 390 FAPGVEIESLSHLNYEDTLI--LSGTSMSTPIVTGVAAVLLS------------KGIEPA 435

Query: 485 ALKKKIVAYGSKNLLNN----VPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG 540
            + ++I    ++N+ +         TAN +++NG     D + +        E ++    
Sbjct: 436 LIAQEIEYLSTRNVFHRRTLFFKPSTANQILYNGVDKLDDPYNDETFPRLNIEAIAKELE 495

Query: 541 KADDFESESLMDCLHSTSHSL---------FGEIRNFLDRLDLI 575
           + +      + D LHS S             GEIR  L R D I
Sbjct: 496 EYNATLQNPMADGLHSGSKLWGWNNDVTLPLGEIR--LKRRDFI 537

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  192 bits (489), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 143/393 (36%), Positives = 197/393 (50%), Gaps = 62/393 (15%)

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLI---------EQDS-------- 209
           ++  IE+ F I GS RG     +  +++ +++S LV  I         E DS        
Sbjct: 45  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDSARDVEYNY 103

Query: 210 ------------IVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDN 248
                       +    +   Q+ AP  LAR+S   +L             FN Y  DD 
Sbjct: 104 TFNATAKYSYENLDEEQNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDY 163

Query: 249 AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAK 308
            G+ V AY++DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG AK
Sbjct: 164 QGQDVNAYIMDTGIFADHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAK 222

Query: 309 NAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALEL 368
              +V VKVL  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S  + +
Sbjct: 223 KVNLVEVKVLGKDGSGEASNVLSGLEFIV-EHCTRVSRPQGKKCVANLSLGSFRSPIINM 281

Query: 369 AVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIF 427
           AV+ A+  GI F  AAGN N DA   SPAS++  ITV A     D  A FSNWG CV+IF
Sbjct: 282 AVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIF 341

Query: 428 APGLNI--LSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEA 485
           APG+ I  LS    +DT V  LSGTSM++P V G+ A  LS              I PE 
Sbjct: 342 APGVEIESLSHLNFNDTLV--LSGTSMSTPIVTGVAAVLLS------------KGIEPEM 387

Query: 486 LKKKIVAYGSKNLLNN----VPARTANNLIFNG 514
           + +++    ++N+ +         T N +++NG
Sbjct: 388 IAQELEYLSTRNVFHRRTLFFKPSTPNQILYNG 420

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  193 bits (490), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 132/316 (41%), Positives = 172/316 (54%), Gaps = 36/316 (11%)

Query: 218 TQTGAPWGLARVSHRERL--------NLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVE 268
            Q GAP  L R+S R +L            F  Y Y+D   G  + AY++DTGI  +H +
Sbjct: 153 VQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPD 212

Query: 269 FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSD 328
           FE R   G  + + +   D NGHGTH AG + SKT+GVAKN  +V VKVL   G+G ++ 
Sbjct: 213 FENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTT 271

Query: 329 VLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNEN 388
           VL G+++ V +H +   +   K   ANMSLG  ++  +  A+  A  AG+   VAAGN N
Sbjct: 272 VLSGIQFAV-DHCRLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNSN 330

Query: 389 QDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYIGSDT 442
             AC TSPAS+K  ITV A    DDR    AYFSNWG+CVDIFAPG+ I  LS    S  
Sbjct: 331 VSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESHH 387

Query: 443 AVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNV 502
              T SGTSMASP VAGL A  L    D G E        P  +K K++   +K++ N +
Sbjct: 388 KHVTHSGTSMASPVVAGLAAILL----DKGVE--------PFDVKDKLLHLSTKDVFNKL 435

Query: 503 PAR----TANNLIFNG 514
                  T N + +NG
Sbjct: 436 TLFFKYGTPNKIAYNG 451

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  192 bits (489), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 162/476 (34%), Positives = 222/476 (46%), Gaps = 81/476 (17%)

Query: 92  QDFVDMKLASLSDNSRAIPHRYIVIFKDG-VTDYDVGMHQD-LVTTAHMETIAQLDPGHS 149
           Q F+D +L      S+ I  R I  +  G    + + +  + L+       ++Q+ P  S
Sbjct: 30  QRFMDSQLVQEILESKPIRKRIIKTYSFGNFRGFVIDLPNEWLIKIRRSPFVSQVVPNFS 89

Query: 150 F--FDA----TEGMHHEGISARSVEGGIEEM--FEIAGSLRG---YFGYFTDGMLDLIRE 198
           F  FD     +E      I AR   GG  E+  F+     RG   YF  F     D+ + 
Sbjct: 90  FKAFDEETALSEVYRGRTIVARGENGGSPELQGFK-KEECRGDSVYFDKFEASGKDMPQV 148

Query: 199 SGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDNA 249
           +G  KL+ +         +TQ+ AP  LAR+S R +L             FN Y Y  + 
Sbjct: 149 NG--KLLSRY-------IKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQ 199

Query: 250 GKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKN 309
           G+ V AYV+D+G+ IDH +FEGRA +G     +    D NGHGTH AG I SKTYGV+K 
Sbjct: 200 GRSVNAYVLDSGVMIDHCDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKK 259

Query: 310 AKVVAVKVLRTNGTGTMSDVLRGVEYVV--------------------AEHRKASGDPNF 349
             ++ VKVL + G+GT+  V+ G+E+V                             D   
Sbjct: 260 VNIIDVKVLDSVGSGTLDTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVES 319

Query: 350 KGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAAST 409
           K    N+SLG  +S  +  A++  +  GI   VAAGN N +AC TSPAS    ITV A  
Sbjct: 320 KRCVINLSLGTFRSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA-- 377

Query: 410 LSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFL 465
             DDR    A FSNWG+CVDIFAPG+ + S            +GTSMA+P V GL+A  L
Sbjct: 378 -FDDRIDSIAKFSNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL 436

Query: 466 SLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPAR-------TANNLIFNG 514
               DSG        I P  +KK++    + N+    P R       T N + FNG
Sbjct: 437 ----DSG--------IKPTQIKKRLNELATDNIF---PRRTLLFKPGTPNRIAFNG 477

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  191 bits (485), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 166/312 (53%), Gaps = 31/312 (9%)

Query: 217 ETQTGAPWGLARVSHRERLNLG---------SFNKYLYDDNAGKGVTAYVIDTGINIDHV 267
           + Q  AP  LAR+S R  L            SFN Y Y  + G+ + AY+IDTGI  +H 
Sbjct: 124 KVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHK 183

Query: 268 EFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMS 327
           +F GRA +G+   + +   D NGHGTH AG + S  +GVAK   ++ VK L   G G ++
Sbjct: 184 DFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLT 242

Query: 328 DVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNE 387
            V+  VE+ V  H K+SG    KG  AN+SLG  +++ +  A+ AA  AG+   VAAGN 
Sbjct: 243 TVISAVEFAV-NHCKSSGK---KGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNS 298

Query: 388 NQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVAT 446
           N +AC  SPAS+ + ITV A    +D  A FSNWG CVDIFA G+ + S           
Sbjct: 299 NINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIA 358

Query: 447 LSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----V 502
            SGTSMASP V GL+A  L    D G E        PE +K K+V   + +LL       
Sbjct: 359 FSGTSMASPSVTGLVAILL----DKGVE--------PENIKAKLVELATHDLLQRRTLFF 406

Query: 503 PARTANNLIFNG 514
              T N + FNG
Sbjct: 407 KPGTPNRIAFNG 418

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  191 bits (484), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 143/393 (36%), Positives = 196/393 (49%), Gaps = 62/393 (15%)

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLI---------EQDSIVHA---- 213
           ++  IE+ F I GS RG     +  +++ +++S LV  I         E DS+  A    
Sbjct: 45  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSY 103

Query: 214 ----------------SDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDN 248
                            +   Q  AP  LAR+S   +L             FN Y   D 
Sbjct: 104 TFNATAKYSYEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDY 163

Query: 249 AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAK 308
            G+ V AY++DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG AK
Sbjct: 164 QGQDVNAYIMDTGIFADHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAK 222

Query: 309 NAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALEL 368
              +V VKVL  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S  + +
Sbjct: 223 RVNLVEVKVLGKDGSGEASNVLSGLEFIV-EHCTKVSRPQGKKCVANLSLGSFRSPIINM 281

Query: 369 AVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIF 427
           AV+ A+  GI F  AAGN N DA   SPAS++  ITV A     D  A FSNWG CV+IF
Sbjct: 282 AVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIF 341

Query: 428 APGLNI--LSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEA 485
           APG+ I  LS    +DT +  LSGTSM++P V G+ A  LS              I PE 
Sbjct: 342 APGVEIESLSHLNYNDTLI--LSGTSMSTPIVTGVAAILLS------------KGIEPEM 387

Query: 486 LKKKIVAYGSKNLLNN----VPARTANNLIFNG 514
           + ++I    ++N+ +         T N +++NG
Sbjct: 388 IAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNG 420

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  187 bits (476), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 159/450 (35%), Positives = 218/450 (48%), Gaps = 77/450 (17%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           I H  I +F+  + ++    H+ LV+  + ++I       SF D+T    H  +    + 
Sbjct: 5   ILHSVIFVFQ--LIEF-TAAHEYLVSLKNSDSI------QSFMDSTYA--HGQLMKDYLH 53

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFE----------- 217
           G I + F   GS RG     T  ++  I+E+ LV  +  +  +HA D++           
Sbjct: 54  GKISKTFSF-GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 218 ---------------TQTGAPWGLARVSHRERLNLGSFNKYLYDDN---------AGKGV 253
                           Q GAP  LAR+S R  L     +K  Y+D+          G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 254 TAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVV 313
            AY+ID+GI+I+  EFEGRA  G  + + +   D NGHGTH AG + SKTYGVAKN  +V
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLV 231

Query: 314 AVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAA 373
            VK L   G+G++  V+  +E+VV    K+      K   AN+SLG      L  A+ A 
Sbjct: 232 EVKALDRQGSGSLITVISALEFVVNHCGKSKS----KKCVANLSLGAFMMPLLNEAIKAT 287

Query: 374 VAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAP 429
           V +G+   VAAGN N DAC  SPAS K  ITV A    DDR    A FSNWGSCVDIFAP
Sbjct: 288 VDSGVVVVVAAGNGNIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIFAP 344

Query: 430 GLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEY-----YTGSSISPE 484
           G+ I S  I  +      SGTSMASP VAG+++  L    D G E      Y     + +
Sbjct: 345 GVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILL----DQGVENEDIRDYLFELATDD 400

Query: 485 ALKKKIVAYGSKNLLNNVPARTANNLIFNG 514
             +K+ + +           RT N + FNG
Sbjct: 401 VFQKRTLLF---------KPRTPNRITFNG 421

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  188 bits (477), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 152/257 (59%), Gaps = 16/257 (6%)

Query: 219 QTGAPWGLARVSHR-------ERLNLGSFN-KYLYDDN-AGKGVTAYVIDTGINIDHVEF 269
           Q  AP  LAR+S R       E +++ + N  Y YDD  +G  V AYVIDTGI  +H + 
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 270 EGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDV 329
           EGRA++G  +   +   D NGHGTH AG I S+ +GVAK+  ++ VK L   G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 330 LRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQ 389
           +  +E+ V   RK+      +G  AN+SLG  ++  L  AV+AA+ AG+   VAAGN N 
Sbjct: 254 ISAIEFTVNHCRKSR-----RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSNA 308

Query: 390 DACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLS 448
           +AC +SPASS   ITV A    +D  A FSNWG+CVDIFAPG+ I S            S
Sbjct: 309 NACWSSPASSLSAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKPVAFS 368

Query: 449 GTSMASPHVAGLLAYFL 465
           GTSMASP V+G++A  L
Sbjct: 369 GTSMASPIVSGMVANLL 385

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  187 bits (475), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 137/384 (35%), Positives = 192/384 (50%), Gaps = 52/384 (13%)

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASD------------F 216
           G I + F+I G L+G     +  +LD I+    VK +  + +V A +             
Sbjct: 50  GKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 217 ETQTGAPWGLARVSHRERLNLGSFNKYLYDDN---------AGKGVTAYVIDTGINIDHV 267
           + Q GAP  LAR+S R +L     NK  Y D+          G    AY++DTG+  DH 
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 268 EFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMS 327
           EFE R ++G T  + + + D NGHGTH AG + SKT+GVAK+ ++V VK L   G GT+ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 328 DVLRGVEYVV---AEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAA 384
            +L  +E+ V    EH  +           NMSLG  KS  L  A++     GI   VAA
Sbjct: 228 SILSALEFAVQDCQEHEDSQ-------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAA 280

Query: 385 GNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGS 440
           GN N +AC TSP+S+   ITV A    DDR    A FSNWG CVDIFAPG+N+ S     
Sbjct: 281 GNFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRD 337

Query: 441 DTAVATLSGTSMASPHVAGLLAYFLS--LQPDSGSEYYTGSSISPEALKKKIVAYGSKNL 498
             +    SGTSMASP V G++A  L   + P+   +Y    + +    KK+ + +     
Sbjct: 338 WPSFVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELA-TDGVFKKRTLVFKPG-- 394

Query: 499 LNNVPARTANNLIFNGGGGSLDSF 522
                  T N++++NG     D +
Sbjct: 395 -------TPNSVLYNGNKKHDDEY 411

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  192 bits (488), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 128/325 (39%), Positives = 178/325 (54%), Gaps = 33/325 (10%)

Query: 216 FETQTGAPWGLARVSHRERLNLG-------SFNKYLYDDNAGKGVTAYVIDTGINIDHVE 268
           +  Q  AP  LAR   R  L          +FN Y  +++ G+GV  YV+D+GI   H E
Sbjct: 425 YAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPE 484

Query: 269 FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSD 328
           F+GRA +G    + +   D NGHGTH AG + S+T+G+AK A +  +KV+  +G G+ S+
Sbjct: 485 FDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSN 543

Query: 329 VLRGVEYVVAEHRKASGDPNFKGSTANMSLGG---GKSAALELAVDAAVAAGIHFAVAAG 385
           ++ GVE+ V +H + SG    K   ANMSLGG   G S AL+ AV+AA+  G+ F VAAG
Sbjct: 544 IIAGVEFAV-KHCQQSG----KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAG 597

Query: 386 NENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAV 444
           N  + AC  SPA  K  ITV A    SD  A FSN+G CVDIFAPG+ + S        +
Sbjct: 598 NSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTM 657

Query: 445 ATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN--- 501
             L+GTSM++P  AG++A  L    D G        I P  +K  +++  +K L +    
Sbjct: 658 RVLNGTSMSAPITAGVVAVLL----DQG--------IEPHEVKDHLLSISTKGLFHKRRL 705

Query: 502 VPARTANNLIFNGGGGSLDSFWNSK 526
           V +RT +  +F G     DSF   K
Sbjct: 706 VSSRTPDRALFTGVKREDDSFSTEK 730

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  188 bits (477), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 126/309 (40%), Positives = 176/309 (56%), Gaps = 31/309 (10%)

Query: 219 QTGAPWGLARVSHRERLNLGS-------FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG 271
           Q+GAP  LAR   R  L   +       FN Y   ++ G+ V  Y++D+GI+  H EFEG
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 272 RAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLR 331
           RA +G    +N+   D NGHGTH AG + SKTYG AK A +  VKV+  +G G+ S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 332 GVEYVVAEHRKASGDPNFKGSTANMSLGGGK--SAALELAVDAAVAAGIHFAVAAGNENQ 389
           GVE+ V +H + SG    K   ANMSLGG     +AL+ AV+AA+  G+ F VAAGN  +
Sbjct: 389 GVEFAV-KHCQQSG----KKCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGNSKE 443

Query: 390 DACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLS 448
            AC  SPA  K  ITV A    SD  A FSN+G CVDIFAPG+ + S        V  L+
Sbjct: 444 RACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVRVLN 503

Query: 449 GTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN---VPAR 505
           GTSM++P  AG++A  L    D G ++        E +K++++   +K + +    V +R
Sbjct: 504 GTSMSAPITAGVVAVLL----DQGVKH--------EDVKERLIDLSTKGVFHRRRLVSSR 551

Query: 506 TANNLIFNG 514
           T +  +FNG
Sbjct: 552 TPDRTLFNG 560

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  184 bits (468), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 132/361 (36%), Positives = 180/361 (49%), Gaps = 44/361 (12%)

Query: 179 GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASD------------FETQTGAPWGL 226
           G   G+   F    ++ ++++ LV  +  +S+ +  D            ++ Q  AP  L
Sbjct: 59  GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 227 ARVSHRERLNLGS-------FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGK-T 278
           AR+S R  L           FN Y    + G  V AY+IDTGI   H +  GRA +G   
Sbjct: 119 ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 279 IPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVA 338
           +     DY  NGHGTH AG + S+T+GVAK   +V VK L   G G ++ V+  +E+ V 
Sbjct: 179 VGEGPGDY--NGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV- 235

Query: 339 EHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPAS 398
            H K SG        AN+SLG  ++  L  AV+AAV +G+   VAAGN N +AC  SPAS
Sbjct: 236 NHCKKSG----MLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPAS 291

Query: 399 SKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHV 457
           +   ITV A    +D  A FSNWG CVD+FA G+ ++S            SGTSMASP V
Sbjct: 292 AISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSV 351

Query: 458 AGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----VPARTANNLIFN 513
           AGL A  L    DSG        I P  +K+KI+   ++N+           T N + FN
Sbjct: 352 AGLAAVLL----DSG--------IDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFN 399

Query: 514 G 514
           G
Sbjct: 400 G 400

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  176 bits (445), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 151/261 (57%), Gaps = 16/261 (6%)

Query: 215 DFETQTGAPWGLARVSHRERLNLGSFN--------KYLYDDN-AGKGVTAYVIDTGINID 265
           DF  Q  AP  LAR+S R  L     N         Y YDD+  G  V AYVIDTGI  +
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 266 HVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGT 325
           H +F+GRA++G  +   +   D NGHGTH AG I S+ YGVAK+  ++ VK L   G G 
Sbjct: 189 HRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 326 MSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAG 385
           ++ V+  +E+ V   RK+      +G  AN+SLG  +++ L  AV+AA+ AG+   VAAG
Sbjct: 248 LTSVISAIEFTVNHCRKSK-----RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAG 302

Query: 386 NENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAV 444
           N N +AC +SPASS   I+V A    +D  A FSNWG+CVD+FAPG+ I S         
Sbjct: 303 NSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFKS 362

Query: 445 ATLSGTSMASPHVAGLLAYFL 465
              SGTSMASP V G++A  L
Sbjct: 363 VAYSGTSMASPLVTGMVAVLL 383

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  175 bits (443), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 177/339 (52%), Gaps = 48/339 (14%)

Query: 201 LVKLIEQDSIVHASDFE-----TQTGAPWGLARVSHRERL-----NLGS----FNKYLYD 246
           L K  E D + +    E      Q+ AP  LAR+S R++L     N+ S    FN Y   
Sbjct: 96  LFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGK 155

Query: 247 DNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGV 306
           ++ G  V AY++D+G++ +  +FEGR ++G    + D + D NGHGTH AG + SKTYGV
Sbjct: 156 EHKGADVRAYILDSGVSRNLTDFEGRVEFGFDF-TGDGEGDSNGHGTHVAGLVGSKTYGV 214

Query: 307 AKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVA---EHRKASGDPNFKGSTANMSLGGGKS 363
           AK   +V VK L   G GT+  VL  +E+ V    EH +       K   AN+SLG  K+
Sbjct: 215 AKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE-------KRCVANLSLGSFKN 267

Query: 364 AALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDR----AYFSN 419
           A +  A+ AA   G+   VAAGN N +AC TSPAS+++ ITV A    DDR    A FSN
Sbjct: 268 AIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITVGA---FDDRIDTIAKFSN 324

Query: 420 WGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGS 479
           WG CVDI+APG+ + S          + SGTSMASP V G +A  L    D G       
Sbjct: 325 WGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQVAILL----DKG------- 373

Query: 480 SISPEALKKKIVAYGSKNLLNN----VPARTANNLIFNG 514
            I  + +K  ++   + ++           T N ++FNG
Sbjct: 374 -IPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  173 bits (439), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 182/327 (55%), Gaps = 40/327 (12%)

Query: 213 ASDFETQTGAPWGLARVSHRERL------NLGSFNKYLY-DDNAGKGVTAYVIDTGINID 265
           + DF +Q+ AP  LAR+S R +L      +  S  KY Y +++ G+GV  YV+D+G+N D
Sbjct: 148 SDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHD 207

Query: 266 HVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGT 325
           H +FEGRA  G    + +   D  GHGTH AG I SKTYGVAK   +V VKVL + G GT
Sbjct: 208 HPDFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGT 266

Query: 326 MSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG-GKSAALELAVDAAVAAGIHFAVAA 384
           +++++ G+EYVV +          +    NMSLG  G  + L+ AV A +  G+   VA 
Sbjct: 267 VTNIIEGLEYVVNQCIGKK-----RKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAG 321

Query: 385 GNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILS-TYIG 439
           GN   +AC  SPA  +K ITVAA    DDR    A FSNWG+C+DI+APG+N+ S +  G
Sbjct: 322 GNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLSNKG 378

Query: 440 SDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLL 499
             T V  LSGTSMASP VAG  A +L    D G++        P  ++K +    ++ + 
Sbjct: 379 RGTFV--LSGTSMASPIVAGAAAIYL----DQGAD--------PAEVRKILSKTATRGVF 424

Query: 500 NN----VPARTANNLIFNGGGGSLDSF 522
                 V  RT N +++ G     D F
Sbjct: 425 KKRAIAVRPRTPNKVLYTGNNQEDDEF 451

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  175 bits (443), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 162/315 (51%), Gaps = 34/315 (10%)

Query: 217 ETQTGAPWGLARVSHRERL--------NLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHV 267
           + Q GAP  L ++S R +L            F  Y YD    G     Y+IDTG+  +H 
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 268 EFEGRAQWG-KTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTM 326
           EF  R  +G   I     DY  NGHGTH AG I SKT+GVAKN  +  VKVL   G G +
Sbjct: 208 EFGNRVHFGGDFIGEGKGDY--NGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNL 265

Query: 327 SDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGN 386
           + VL G+E+ V  + K    P  K    NMSLG  ++  +  A+  A  +GI   VAAGN
Sbjct: 266 TSVLEGIEFAV-NNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGN 324

Query: 387 ENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNI--LSTYIGSDTA 443
            N  AC TSPASS   ITV A    +D  A FSNWG CVDIFAPG+ I  LS  +  +  
Sbjct: 325 NNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENGV 384

Query: 444 VATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVP 503
           +   SGTSMASP VAGL+A  +                  + +K+K++   SK++ + + 
Sbjct: 385 IH--SGTSMASPIVAGLVAILME------------KGYKCDEIKQKLIDDSSKSIFSKLT 430

Query: 504 AR----TANNLIFNG 514
                 T N +I+NG
Sbjct: 431 LFFKYGTPNRVIYNG 445

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  154 bits (388), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 100/297 (33%), Positives = 154/297 (51%), Gaps = 10/297 (3%)

Query: 175 FEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRER 234
             +  S R  +G F   +L+ +   G +  +  D I+  +++  Q  AP  LAR+S +  
Sbjct: 49  ISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKST 108

Query: 235 LNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY-DGNGHGT 293
           L  GS   Y+Y  N G GV  Y++DTGI+  H E EGR Q    + SN   + D +GHGT
Sbjct: 109 LR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGT 167

Query: 294 HCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGST 353
             AG I S T+G AK   +  V+V  + G  T+  V+R +E     H         + S 
Sbjct: 168 AVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALE-----HASKLASVTQRPSV 222

Query: 354 ANMSLGGGKSAALELAVDAAVA-AGIHFAVAAGNENQDACNTSPASSKKCITVAA--STL 410
             +     K+  L  A++A +    +   VA GN NQ+AC++SPAS+   +T+ +   T 
Sbjct: 223 VVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTK 282

Query: 411 SDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSL 467
            D  A F+N+G C+D FA G+NI S   G   +    SGTS+++   +G++AY++SL
Sbjct: 283 GDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  156 bits (394), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 114/317 (35%), Positives = 154/317 (48%), Gaps = 28/317 (8%)

Query: 216 FETQTGAPWGLARVSHRERLNLGS---FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGR 272
           + TQ  AP  L+R S   +L   S   +N Y   D  G  VT YV+D+GI +DH EFEGR
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 273 AQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRG 332
                    +    D  GHGT  AG I SKTYGVAKN  ++ +KVL   G G +  +L+G
Sbjct: 202 ILEAYDFTDSGVG-DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQG 260

Query: 333 VEYVVAEHRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDAC 392
           +++ + +H + + + N      N SLG      L  A +    AGI    AAGN   +AC
Sbjct: 261 LQF-ITKHCEENTNGN---CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVNAC 316

Query: 393 NTSPASSKKCITVAASTLSDDR-AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTS 451
             +PA SK   TV +    DD  A FSNWG CVD+ APG+ + +    +       SGTS
Sbjct: 317 WITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSGTS 376

Query: 452 MASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN-----VPART 506
           +++P V GL A  LS              +  E L  +I   GS++LL N     +P   
Sbjct: 377 VSTPIVTGLAAILLS------------KGVPKENLYDEIRKMGSRDLLRNKEFSRLPG-- 422

Query: 507 ANNLIFNGGGGSLDSFW 523
             NLI N G    D  +
Sbjct: 423 TPNLIVNIGPQKEDDVY 439

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  145 bits (366), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 104/312 (33%), Positives = 163/312 (52%), Gaps = 15/312 (4%)

Query: 164 ARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAP 223
           A +V GG      +  S R  +G F   +L+    SG +  +  D  +  +++  Q  AP
Sbjct: 38  AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAP 97

Query: 224 WGLARVSHRERLNLGSFN---KYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIP 280
             LAR+S +  L  G+ +    Y+Y  NAG GV  Y++DTGI+  H  FEGR Q      
Sbjct: 98  NHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFS 157

Query: 281 SND-ADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAE 339
           S+  A  D +GHGT  AG I S  +GVAK   +  V+V  + G  ++  VLR +     E
Sbjct: 158 SDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRAL-----E 212

Query: 340 HRKASGDPNFKGSTANMSLGGGKSAALELAVDAAVA-AGIHFAVAAGNENQDACNTSPAS 398
           H         + S   + L   ++  L  AV+A V    I   VAAGNEN+ AC+ SPA 
Sbjct: 213 HASKLAAVTKRPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAG 272

Query: 399 SKKCITVAASTLS--DDRAYFSNWGSCVDIFAPGLNILSTYIGSD-TAVATLSGTSMASP 455
           +   +T+ +  ++  D  A F+N+  CVD+F  G+++ +  +G D ++   LSGTS+++ 
Sbjct: 273 AYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAG 330

Query: 456 HVAGLLAYFLSL 467
             +GL+AY++S+
Sbjct: 331 VASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  129 bits (325), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/306 (31%), Positives = 156/306 (50%), Gaps = 22/306 (7%)

Query: 177 IAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSH---RE 233
           I     G+ G F D ++  +     V  I  D +++  ++  Q  AP  LAR+S+     
Sbjct: 57  IGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNS 116

Query: 234 RLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY---DGNG 290
           R++  + N +++  +AG GV  Y++D+GI+  H  F  R    K I   D      D +G
Sbjct: 117 RVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHG 175

Query: 291 HGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGT-MSDVLRGVEYVVAEHRKASGDPNF 349
           HGT  AG + S T+GV K A +  V+V+     G  +S +L+ +E+ +  H +A+  P  
Sbjct: 176 HGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRATMRP-- 232

Query: 350 KGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAAST 409
             S A +     K+A L  A++ ++   I   V AGN++  ACN SPAS++   ++ +  
Sbjct: 233 --SVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVG 289

Query: 410 LSDDR-----AYFSNWGSCVDIFAPGLNI--LSTYIGSD-TAVATLSGTSMASPHVAGLL 461
             D R     A FSN+G CVD+F  G+ +  L     SD   ++ +SGTSM+    AG +
Sbjct: 290 SLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTV 349

Query: 462 AYFLSL 467
            Y++SL
Sbjct: 350 GYYMSL 355

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  118 bits (295), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 154/314 (49%), Gaps = 33/314 (10%)

Query: 175 FEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRER 234
            EI  S   + G  +   +  + E      I  +  +    +  QT AP  L R++ ++ 
Sbjct: 53  IEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDS 111

Query: 235 LNLGSF----NKYLYDDNAGKGVTAYVIDTGINIDH-VEFEGRAQ-----WGKTIPSNDA 284
           +    +    N+Y++ D +G GV  Y++DTGI+I H +  +             IPS D 
Sbjct: 112 IKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSGDF 171

Query: 285 DYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGT-GTMSDVLRGVEYVVAEHRKA 343
               NGHGT  AG I S  +GV K+A +V V+V+  N    TMS VL  +  ++ +H + 
Sbjct: 172 ----NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALS-LIEKHEQK 226

Query: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKK-- 401
           +  P    S   +     K+  LE A++  ++  I   + AGN++Q+AC  SP   KK  
Sbjct: 227 TMRP----SIIVLPFQTEKNTILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLS 281

Query: 402 -CITVAASTLSDDRAY-----FSNWGSCVDIFAPGLNILSTYIGSD---TAVATLSGTSM 452
             + V +   S+++ Y     FSN+GSCVDI+  G++I +    S+     +  ++GTS 
Sbjct: 282 NVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSY 341

Query: 453 ASPHVAGLLAYFLS 466
           +   VAG++ Y++S
Sbjct: 342 SCGIVAGVVGYYMS 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  114 bits (284), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 94/314 (29%), Positives = 151/314 (48%), Gaps = 28/314 (8%)

Query: 171 IEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVS 230
           I ++FE+ GS R + G F+  +L  +     V  I +D  +   +   Q  AP  L  +S
Sbjct: 45  ITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 231 HRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG-----RAQWGKT-IPSNDA 284
               L   S   ++Y  N G GV  Y++DTGI+I H           A   ++ +P    
Sbjct: 104 SISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGT- 159

Query: 285 DYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS 344
             D  GHGT  AG IAS+T+GV K   +V V+V  +NG   +S +L+ +  +   H + +
Sbjct: 160 --DPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALT-LTQRHIEGT 216

Query: 345 GDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPAS----SK 400
             P+       + +  G +  L  A+ A+    +   + AGN  QDA N SPA+     K
Sbjct: 217 KRPSV--VVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPK 273

Query: 401 KCITVAASTLSDDRAYFSNWGSCVDIFAPGLNI-------LSTYIGSDTAVATLSGTSMA 453
             I V +  ++++   F+N+GS VD+F  G  I       L +   S++    +SGTS +
Sbjct: 274 NIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSAS 333

Query: 454 SPHVAGLLAYFLSL 467
           S   AG++ Y++SL
Sbjct: 334 SAITAGVIGYYMSL 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  110 bits (276), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 147/307 (47%), Gaps = 31/307 (10%)

Query: 173 EMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHR 232
           EM  +    +   G F+   L+ +     V  I +D  +   +++ Q G+P  L+++S  
Sbjct: 45  EMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSG 104

Query: 233 ERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY------ 286
                GSF    +D  +G  V  YV DTGI+  H   +         P   AD+      
Sbjct: 105 -----GSFT---FDPVSGNLVDVYVFDTGIDFKHPGLQ------NVNPHKLADFTSSPVP 150

Query: 287 ---DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKA 343
              D +GHGT  AG IAS+T+GV K+  +V V+V   +G   +S +++G+   VA H + 
Sbjct: 151 RGADPHGHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASVA-HARF 209

Query: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403
           +  P    S   + +  GK   +      A+   I   + AGN+  DAC+ SP +    +
Sbjct: 210 TKRP----SVFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNIL 265

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNIL---STYIGSDTAVATLSGTSMASPHVAGL 460
            + +    +  A FSN+G+CVD++  G +IL   ST  G++  + + +GTS +    AG+
Sbjct: 266 VIGSLDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGI 325

Query: 461 LAYFLSL 467
           + Y +S+
Sbjct: 326 VGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 98/342 (28%), Positives = 150/342 (43%), Gaps = 29/342 (8%)

Query: 173 EMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHR 232
           E++ +  + + +        L  +     +  I  D  +   +   Q  AP  L ++   
Sbjct: 51  ELYSVGKNFQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLET 110

Query: 233 ERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG-RAQWGKTIPSNDA-DYDGNG 290
           E       N+++YD  AG GV  Y+ DTGI  +       R      +P     D +   
Sbjct: 111 E----AGDNEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMPGMPGPPIRDQEILE 166

Query: 291 HGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFK 350
           HGT  +G I S  +GV K   ++ V V   NG   MS VL+G+  +V +H K +  P   
Sbjct: 167 HGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLN-LVQQHVKHTNRP--- 222

Query: 351 GSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAA--S 408
            S  N S    K+A L  A D      +  AVAAGN  Q  C+ SP   ++  ++ A  S
Sbjct: 223 -SVINFSYCTLKNAILNSAFD-NFPRDVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGS 280

Query: 409 TLSDDRAY----FSNWGSCVDIFAPGLNILSTYI------GSDTAVATLSGTSMASPHVA 458
            L +D       FSN+GSCV  +APG  +L+  I       S   V  +SGTS +S   A
Sbjct: 281 LLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGA 340

Query: 459 GLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLN 500
           G++ Y+++ Q   G E      I    ++  + +YG  N +N
Sbjct: 341 GVIGYYMA-QGIPGEEVVDSLRI----VQPNLTSYGKNNGIN 377

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 115/298 (38%), Gaps = 32/298 (10%)

Query: 196 IRESGLVKLIEQDSIVHASD--FETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGV 253
           I +S +  +++    +H SD  F  Q    W L   +     N  +  +  Y++  G G+
Sbjct: 141 IIDSSMEPIVQAQKQLHISDPSFPKQ----WHLINAAFPG--NDVNVKQLWYENVTGTGI 194

Query: 254 TAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKT---- 303
            A ++D G++ D+         EG   +    P        + HGT CAG IA+      
Sbjct: 195 VAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRCAGEIAASKNNGI 254

Query: 304 --YGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYV--VAEHRKASGDPNFKGSTANMSLG 359
              GVA +AKV  +++L  +G  T  D    + +   V +    S  P   G+       
Sbjct: 255 CGVGVAYDAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSCSWGPRDDGTHLQGPTD 312

Query: 360 GGKSAALELAVDAAVAAGIHFAVAAGNENQ--DACNTS-PASSKKCITVAASTLSDDRAY 416
             K A +    +     G  +  A+GN     D CN     +S   ITV A         
Sbjct: 313 LVKKAMIRGVTEGRDQKGALYVFASGNGGAYGDNCNYDGYTNSIYSITVGAIDHKGLHPP 372

Query: 417 FSNWGSCVDIFA----PGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPD 470
           +S   S V +       G  I +T IG D    T  GTS A+P  AG+    L   P+
Sbjct: 373 YSESCSAVMVVTCSSGSGEFIHTTDIG-DKCSNTHGGTSAAAPLAAGVYTLVLQANPE 429

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 103/247 (41%), Gaps = 22/247 (8%)

Query: 244 LYDDN-AGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCA 296
           L+ +N  G GV A ++D G++ ++ +       EG   +    P        + HGT CA
Sbjct: 148 LWKENITGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCA 207

Query: 297 GTIASKT-----YGVAKNAKVVAVKVL--RTNGTGTMSDVLRGVEYVVAEHRKASGDPNF 349
           G IA+        GVA N+KV  +++L  +       + ++ G++  V +    S  P+ 
Sbjct: 208 GEIAAFRNDICGVGVAYNSKVSGIRILSGQITAEDEAASLIYGLD--VNDIYSCSWGPSD 265

Query: 350 KGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQ--DACN-TSPASSKKCITVA 406
            G T        K A ++   +   A G  +  A+GN     D+CN     +S   ITV 
Sbjct: 266 DGKTMQAPDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSITVG 325

Query: 407 ASTLSDDRAYFSNWGSCVDI--FAPGL-NILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           A         +S   S V +  ++ G  N + T    +    T  GTS A+P  AG+   
Sbjct: 326 AIDWKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGIYTL 385

Query: 464 FLSLQPD 470
            L   P+
Sbjct: 386 VLEANPN 392

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 99/246 (40%), Gaps = 23/246 (9%)

Query: 245 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 298
           Y++  G GV A ++D G++ ++ +       EG   +    P        + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 299 IASKT-----YGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYV--VAEHRKASGDPNFKG 351
           IA+        GVA NAKV  +++L  +G  T  D    + Y   V +    S  P   G
Sbjct: 245 IAAVKNDACGVGVAYNAKVAGIRIL--SGEITSEDEAASLVYGLGVNDIYSCSWGPADDG 302

Query: 352 STANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNEN--QDACNTS-PASSKKCITVAAS 408
                     K A ++  ++     G  +  A+GN     D CN     +S   ITV A 
Sbjct: 303 RQMQAPDELVKKAIVKGVLEGRDEKGALYVFASGNGGLYDDNCNYDGYTNSIYSITVGAI 362

Query: 409 TLSDDRAYFSNWGSCVDIFA----PGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYF 464
                   ++   S V +       G +I ST + +  +     GTS A+P  AG+ +  
Sbjct: 363 DHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTDVNNQCS-HRHGGTSAAAPLAAGIYSLV 421

Query: 465 LSLQPD 470
           L   PD
Sbjct: 422 LEANPD 427

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 102/256 (39%), Gaps = 36/256 (14%)

Query: 242 KYLYDDNAGKGVTAYVIDTGINIDHVE----FEGRAQW----GKTIPSNDA--DYDGNGH 291
           K  Y++  G+G+   ++D G++ ++ +    F     W       +P      DY    H
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADDY----H 227

Query: 292 GTHCAGTIASKT------YGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYV--VAEHRKA 343
           GT CAG IA+         GVA NAKV  +++L  +G  T  D    + +   V +    
Sbjct: 228 GTRCAGEIAATKDNGFCGIGVAYNAKVAGIRIL--SGELTAEDEAASLVHALDVNDIYSC 285

Query: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQ--DACNTSP-ASSK 400
           S  P   G+         K A +    D     G  +  A+GN     D CN     +S 
Sbjct: 286 SWGPKDDGTHLQGPTDLVKKAMIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYDGYTNSI 345

Query: 401 KCITVAASTLSDDRAYFSNWGSCVDIFA------PGLNILSTYIGSDTAVATLSGTSMAS 454
             IT+ A         +S   SC  + A       G  I ST IG+  +     GTS A+
Sbjct: 346 YSITIGALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIGNKCS-DHHGGTSAAA 402

Query: 455 PHVAGLLAYFLSLQPD 470
           P  AG+ +  L + P+
Sbjct: 403 PLAAGIFSLVLQVNPN 418

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 119/302 (39%), Gaps = 44/302 (14%)

Query: 198 ESGLVKLIEQDSIVHASD--FETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTA 255
           +S  + + E +  +H  D  FE Q    W L   + +   N  +     Y +  GKGV A
Sbjct: 109 DSSFIPIKEAEERLHIDDPLFEKQ----WHLINPAFKG--NDVNVQDVWYQNITGKGVVA 162

Query: 256 YVIDTGINIDHVE----FEGRAQWGKTI------PSNDADYDGNGHGTHCAGTIASKT-- 303
            V+D G++ ++ +    F     W          P+   DY    HGT CAG IA+    
Sbjct: 163 AVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDY----HGTRCAGEIAAVKNN 218

Query: 304 ----YGVAKNAKVVAVKVLRTNGTGTMSD----VLRGVEYVVAEHRKASGDPNFKGSTAN 355
                GVA +AKV  +++L  +G  T  D    ++  ++  + +    S  P   G+   
Sbjct: 219 GICGIGVAYDAKVAGIRIL--SGEITAEDEAAALINALD--INDIYSCSWGPQDDGTHLQ 274

Query: 356 MSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQ--DACNTS-PASSKKCITVAASTLSD 412
                 K A ++   D     G  +  A+GN     D CN     +S   ITV A    D
Sbjct: 275 GPSDLVKKALIKGVNDGRKNKGAIYVFASGNGGSFGDNCNYDGYTNSIYSITVGAIDHKD 334

Query: 413 DRAYFSNWGSCVDIFA----PGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQ 468
               +S   S V +       G  I +T I ++       GTS A+P  AG+    L   
Sbjct: 335 LHPPYSESCSAVMVVTYSSGSGEYIHTTDI-NNKCNDRHGGTSAAAPLAAGIYTLLLQAN 393

Query: 469 PD 470
           P+
Sbjct: 394 PN 395

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 20/93 (21%)

Query: 242 KYLYDDNAGKGVTAYVIDTGINIDHVE----FEGRAQW------GKTIPSNDADYDGNGH 291
           K  Y++  G GV A ++D G++ ++ +    F     W          P    DY    H
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----H 213

Query: 292 GTHCAGTIASKT------YGVAKNAKVVAVKVL 318
           GT CAG IA+K        GV  NAK+  +++L
Sbjct: 214 GTRCAGEIAAKKGNNFCGVGVGYNAKISGIRIL 246

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 97/251 (38%), Gaps = 34/251 (13%)

Query: 245 YDDNAGKGVTAYVIDTGINIDHVE----FEGRAQW------GKTIPSNDADYDGNGHGTH 294
           Y++  G GV A ++D G++ ++ +    F     W          P    DY    HGT 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----HGTR 216

Query: 295 CAGTIASKT------YGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH--RKASGD 346
           CAG IA+K        GV  NAK+  +++L  +G  T  D    + Y +  +     S  
Sbjct: 217 CAGEIAAKKGNDFCGVGVGYNAKISGIRIL--SGEITTEDEAASLIYGLDTNDIYSCSWG 274

Query: 347 PNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGN--ENQDACNTSP-ASSKKCI 403
           P   G          K A ++   +   + G  +  A+GN     D CN     +S   I
Sbjct: 275 PADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGARGDNCNYDGYTNSIYSI 334

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILS-TYIGSDTAVATLS----GTSMASPHVA 458
           T+ A    D    +S   SC  + A   +  S  YI S       S    GTS A+P  A
Sbjct: 335 TIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGKCSDSHGGTSAAAPLAA 392

Query: 459 GLLAYFLSLQP 469
           G+    L   P
Sbjct: 393 GVYTLLLEANP 403

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 245 YDDNAGKGVTAYVIDTGINI------DHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGT 298
           Y++  G  V   V+D G++       D+   EG   +    P        + HGT CAG 
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHGTRCAGE 214

Query: 299 IASKT-----YGVAKNAKVVAVKVL 318
           IA+        GVA NAKV  +++L
Sbjct: 215 IAAVKNKACGIGVAYNAKVAGIRIL 239

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 97/252 (38%), Gaps = 34/252 (13%)

Query: 245 YDDNAGKGVTAYVIDTGINIDHVE----FEGRAQW------GKTIPSNDADYDGNGHGTH 294
           Y++  G GV A ++D G++ ++ +    F     W          P    DY    HGT 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----HGTR 216

Query: 295 CAGTIASKT------YGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEY--VVAEHRKASGD 346
           CAG IA+K        GV  NAK+  +++L  +G  T  D    + Y   V +    S  
Sbjct: 217 CAGEIAAKKGNNFCGVGVGYNAKISGIRIL--SGDITTEDEAASLIYGLDVNDIYSCSWG 274

Query: 347 PNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGN--ENQDACNTS-PASSKKCI 403
           P   G          K A ++   +   + G  +  A+GN     D CN     +S   I
Sbjct: 275 PADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYSI 334

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILS-TYIGSDTAVATLS----GTSMASPHVA 458
           T+ A    D    +S    C  + A   +  S  YI S       S    GTS A+P  A
Sbjct: 335 TIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSNSHGGTSAAAPLAA 392

Query: 459 GLLAYFLSLQPD 470
           G+    L   P+
Sbjct: 393 GVYTLLLEANPN 404

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 113/315 (35%), Gaps = 70/315 (22%)

Query: 198 ESGLVKLIEQDSIVHASD--FETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTA 255
           +S ++ L E +  +  +D  FE Q    W L   ++    N  +     Y +  G GV  
Sbjct: 122 DSSMIPLKEAEEKLEINDPNFEKQ----WHLINANYPG--NDVNVKDVWYGNVTGSGVVV 175

Query: 256 YVIDTGINIDHVE----FEGRAQW----GKTIPSNDA--DYDGNGHGTHCAGTIASKT-- 303
            ++D G++ ++ +    F     W      T+P      DY    HGT CAG IA+    
Sbjct: 176 AIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY----HGTRCAGEIAASKNN 231

Query: 304 ----YGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYV--VAEHRKASGDPNFKGSTANMS 357
                GVA N+KV  +++L  +G  T  D    + Y   V +    S  P   G      
Sbjct: 232 GFCGIGVAYNSKVSGLRIL--SGPLTPEDEAASLMYALDVNDIFSCSWGPQDDGRHLQGP 289

Query: 358 LGGGKSAALELAVDAAVAAGIHFAVAAGNENQ--DACNTS-------------------- 395
               + A ++   +     G  +  A+GN     D CN                      
Sbjct: 290 SELVRKALIKGVTEGRQKKGSVYVFASGNGGHFGDNCNYDGYTNSIYSITIGAIDHKGLH 349

Query: 396 PASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASP 455
           P  S+ C  V A T S     F               I ST I +D       GTS A+P
Sbjct: 350 PPYSESCSAVMAVTYSSGSGEF---------------IHSTDI-NDQCSDRHGGTSAAAP 393

Query: 456 HVAGLLAYFLSLQPD 470
             AG+ A  L   P+
Sbjct: 394 LAAGIYALLLEANPE 408

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 245 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 298
           Y++  G GV A ++D G++ +  +       EG   +           D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 299 IASK-----TYGVAKNAKVVAVKVL 318
           IA+        GVA NAK+  +++L
Sbjct: 214 IAAVPNDFCAVGVAFNAKLSGIRIL 238

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 60/141 (42%), Gaps = 24/141 (17%)

Query: 195 LIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHR-ERLNLGSFNKYLYDDNAGKGV 253
           LIRE    +L  +D I     F+ Q    W L   +     LN+    +  Y++  G GV
Sbjct: 115 LIREEVKERLKIEDPI-----FDDQ----WHLVNTNFPGNDLNI---TELWYNNITGHGV 162

Query: 254 TAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKT---- 303
            A ++D G++ +  +       EG   +             + HGT CAG IA+      
Sbjct: 163 VAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDDNHGTRCAGEIAAAKNKVC 222

Query: 304 -YGVAKNAKVVAVKVLRTNGT 323
             GVA NAKV  +++L  + T
Sbjct: 223 GVGVAYNAKVSGIRILSADIT 243

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 96/259 (37%), Gaps = 57/259 (22%)

Query: 249 AGKGVTAYVIDTGINIDHVE------FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASK 302
            GK VT  ++D G++ ++ +      FEG   +             + HGT CAG IA+ 
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 303 T-----YGVAKNAKVVAVKVLRTNGTGTMSD----VLRGVEYVVAEHRKASGDPNFKGST 353
                  GVA +A +  +++L  +G  T+ D    ++ G++Y   +    S  P   G  
Sbjct: 226 RNDYCGVGVAFDAHISGLRIL--SGELTVEDEAAALIYGLKY--NDIFSCSWGPPDDGQH 281

Query: 354 ANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNE--NQDACNTS---------------- 395
                   K A ++   D     G  +  A+GN   + D CN                  
Sbjct: 282 LQGPYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSITIGAIDH 341

Query: 396 ----PASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTS 451
               PA S+ C  V A T S     F       DI        ST+ G         GTS
Sbjct: 342 RGLHPAYSESCSAVMAVTYSSGSGKFI---ETTDINGK----CSTHHG---------GTS 385

Query: 452 MASPHVAGLLAYFLSLQPD 470
            A+P  AG+ A  L   P+
Sbjct: 386 AAAPLAAGVYALLLEANPE 404

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 20/90 (22%)

Query: 245 YDDNAGKGVTAYVIDTGINIDHVE----FEGRAQW----GKTIPSNDA--DYDGNGHGTH 294
           Y++  G GV A ++D G++ ++ +    F     W       +P      DY    HGT 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDY----HGTR 216

Query: 295 CAGTIASKT------YGVAKNAKVVAVKVL 318
           CAG IA+K        GV  NAK+  +++L
Sbjct: 217 CAGEIAAKKGNNFCGIGVGYNAKISGIRIL 246

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 245 YDDNAGKGVTAYVIDTGINI------DHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGT 298
           Y++  G  V   V+D G++       D+   EG   +   +         + HGT CAG 
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDYHGTRCAGE 215

Query: 299 IASKT-----YGVAKNAKVVAVKVL 318
           IA+        GVA NAKV  +++L
Sbjct: 216 IAAGKNQFCGVGVAYNAKVAGLRIL 240

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 97/248 (39%), Gaps = 35/248 (14%)

Query: 249 AGKGVTAYVIDTGINIDHVE----FEGRAQW----GKTIPSNDA--DYDGNGHGTHCAGT 298
            GKGV A ++D G++ +  +    F     W     K +P+     DY    HGT CAG 
Sbjct: 162 TGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDY----HGTRCAGE 217

Query: 299 IASKT-----YGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEY--VVAEHRKASGDPNFKG 351
           IA+        GVA  AKV  +++L  +G  T  D    + Y   + +    S  P   G
Sbjct: 218 IAAVKNEYCGLGVAYGAKVAGIRIL--SGQITAEDEAASLMYGLDINDIFSCSWGPPDDG 275

Query: 352 STANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQ--DACNTS-PASSKKCITVAAS 408
                     K A ++   +     G  +  A+GN     D CN     +S   IT+ A 
Sbjct: 276 KHLQGPSDLVKKAMIKGTQEGRNEKGSIYVFASGNGGHYGDNCNYDGYTNSIYSITIGAI 335

Query: 409 TLSDDRAYFSNWGSCVDIFA------PGLNILSTYIGSDTAVATLSGTSMASPHVAGLLA 462
                   +S   SC  + A       G  I ST I S  +     GTS A+P  AG+ A
Sbjct: 336 DHKGLHPPYSE--SCSAVLAVTYSSGSGEYIHSTDIKSQCS-DRHGGTSAAAPLAAGIYA 392

Query: 463 YFLSLQPD 470
             L   P+
Sbjct: 393 LVLEANPE 400

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 12/82 (14%)

Query: 249 AGKGVTAYVIDTGINI------DHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIAS- 301
            GKGV A +ID G++       D+   EG   + +           + HGT CAG IA+ 
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMPLLSDDNHGTRCAGEIAAI 228

Query: 302 --KTY---GVAKNAKVVAVKVL 318
               Y   GVA +AKV  +++L
Sbjct: 229 RNNNYCGVGVAYDAKVSGIRIL 250

>ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL238W (KEX2)
          Length = 768

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 95/250 (38%), Gaps = 28/250 (11%)

Query: 244 LYDDN-AGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCA 296
           L+  N  G G+   V+D G++ +  +       EG   +             + HGT CA
Sbjct: 149 LWQKNITGHGIVVAVVDDGLDYESEDLKDNFCAEGSWDFNSNTALPKPMLSDDTHGTRCA 208

Query: 297 GTIASKT-----YGVAKNAKVVAVKVLRTNGT--GTMSDVLRGVEYVVAEHRKASGDPNF 349
           G IA+        GVA N+KV  +++L  + T     + ++ G++  + +    S  P  
Sbjct: 209 GEIAAAKNQFCGLGVAFNSKVSGIRILSEDITPEDEAASLVYGLD--INDIYSCSWGPTD 266

Query: 350 KGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQ--DACNTS-PASSKKCITVA 406
            G          K A +    +     G  +  A+GN     D CN     +S   ITV+
Sbjct: 267 NGEELQAPSDLVKKAIIRGVTEGRDRKGALYVFASGNGGALGDNCNYDGYTNSIYSITVS 326

Query: 407 ASTLSDDRAYFSNWG-SCVDIFAPGL-----NILSTYIGSDTAVATLSGTSMASPHVAGL 460
           A    D R     +  SC  +          N + T   +        GTS A+P  AG+
Sbjct: 327 AL---DHRGLHPTYAESCSAVLVVAHSSGSGNFIRTTDVNGQCFDHHGGTSAAAPLAAGV 383

Query: 461 LAYFLSLQPD 470
            A  L + P+
Sbjct: 384 YALLLQVNPN 393

>TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.261
           YKR024C
          Length = 715

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 60/139 (43%), Gaps = 14/139 (10%)

Query: 48  HHHKMGEHGRGRGKGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSR 107
           H + +GE  R   KG++   S     DEE  V  +F       SQ      L S + ++ 
Sbjct: 437 HRNLVGESVRLLDKGNNILPS--FKSDEEPGV--IFYKLHGSLSQPIRTSTLESFAKDTP 492

Query: 108 AIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSV 167
               +++++F   V    + +        H+ T+ ++DP    F   + +H  G +AR+ 
Sbjct: 493 TTKGKHLIMFCTDVASRGLDL-------PHVGTVLEVDPP---FSTEDHLHRVGRTARAG 542

Query: 168 EGGIEEMFEIAGSLRGYFG 186
           +GG   +F + G   GY G
Sbjct: 543 QGGEALLFLLPGEEEGYLG 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,079,197
Number of extensions: 2804686
Number of successful extensions: 7743
Number of sequences better than 10.0: 102
Number of HSP's gapped: 7718
Number of HSP's successfully gapped: 107
Length of query: 575
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 460
Effective length of database: 40,294,809
Effective search space: 18535612140
Effective search space used: 18535612140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)