Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30186.14ON57557526420.0
ACR012C6.14ON54148515170.0
SAKL0E01012g6.14ON54448814440.0
KLTH0C11396g6.14ON55048914250.0
Kwal_56.223876.14ON54347214140.0
KLLA0D00979g6.14ON56148113760.0
ZYRO0C07942g6.14ON54857913690.0
TDEL0G045506.14ON56448113470.0
Smik_5.276.14ON60847413211e-176
YEL060C (PRB1)6.14ON63547513111e-174
Skud_5.296.14ON60850413071e-174
CAGL0B03619g6.14ON46847512921e-174
TBLA0A073006.14ON57347412971e-173
Suva_5.76.14ON66447513031e-172
Kpol_1032.56.14ON68047012741e-168
NCAS0F002206.14ON69545612731e-168
Kpol_1045.756.14ON47743412441e-166
NDAI0K028806.14ON70447412511e-164
KNAG0E009206.14ON53146712111e-160
KAFR0L003606.14ON50242411951e-158
TPHA0M002306.14ON58547811091e-144
Smik_15.1726.14ON47841910471e-137
Suva_15.1786.14ON47642110341e-135
YOR003W (YSP3)6.14ON47842410251e-133
Skud_15.1646.14ON48242010241e-133
CAGL0E02651g6.14ON48542610071e-130
KAFR0B065506.14ON4563518981e-114
NCAS0D026306.14ON4514248401e-106
NDAI0I022806.14ON4824347816e-97
KNAG0F02970singletonON4203457426e-92
CAGL0L13266gsingletonON5794616754e-80
Kpol_1018.56.313ON4653264289e-46
NCAS0D043906.313ON4924314282e-45
TDEL0A072806.313ON4363664206e-45
NDAI0I005606.313ON4834504103e-43
Suva_3.846.313ON5274584081e-42
CAGL0L10802g6.313ON5174764072e-42
ZYRO0D08822g6.313ON4903124043e-42
Kpol_1028.616.313ON5183164045e-42
KNAG0I024706.313ON4753843972e-41
Skud_3.1246.313ON5404644003e-41
TBLA0F039706.313ON7343764053e-41
Smik_3.1496.313ON4913933947e-41
YCR045C (RRT12)6.313ON4913933902e-40
Kwal_23.61836.313ON4932643903e-40
KLTH0A06094g6.313ON4962603869e-40
KLLA0F06028g6.313ON5083293816e-39
SAKL0A02002g6.313ON4793613781e-38
Ecym_21056.313ON6103103741e-37
AAR069W6.313ON7683253754e-37
KAFR0J024506.313ON4783173612e-36
TPHA0D037606.313ON6073183563e-35
Kwal_33.133721.78ON3772973226e-32
TBLA0A067006.313ON4973173129e-30
KLTH0F02288g1.78ON3803112953e-28
Kpol_2000.691.78ON3863062548e-23
TDEL0C062301.78ON3643072244e-19
ZYRO0F16764g1.78ON3863142192e-18
TPHA0B045201.78ON3883142165e-18
TBLA0A054101.78ON3823131713e-12
NCAS0A008802.6ON833114724.3
SAKL0G00440g2.6ON83663715.1
TDEL0H013001.261ON71550715.1
Skud_14.1012.6ON81971698.5
KAFR0A080402.6ON766116698.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3018
         (575 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...  1022   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   588   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   560   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   553   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   549   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   534   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   531   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   523   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   513   e-176
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   509   e-174
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   508   e-174
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   502   e-174
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   504   e-173
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   506   e-172
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   495   e-168
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   494   e-168
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   483   e-166
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   486   e-164
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   471   e-160
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   464   e-158
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   431   e-144
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   407   e-137
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   402   e-135
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   399   e-133
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   399   e-133
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   392   e-130
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   350   e-114
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     328   e-106
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   305   6e-97
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              290   6e-92
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   264   4e-80
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   169   9e-46
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   169   2e-45
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   166   6e-45
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    162   3e-43
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   161   1e-42
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   161   2e-42
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   160   3e-42
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   160   5e-42
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   157   2e-41
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   158   3e-41
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   160   3e-41
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   156   7e-41
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   154   2e-40
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   154   3e-40
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   153   9e-40
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   151   6e-39
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   150   1e-38
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   148   1e-37
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   149   4e-37
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   143   2e-36
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   141   3e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   128   6e-32
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   124   9e-30
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   118   3e-28
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   102   8e-23
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    91   4e-19
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...    89   2e-18
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    88   5e-18
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    70   3e-12
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    32   4.3  
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    32   5.1  
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...    32   5.1  
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    31   8.5  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    31   8.6  

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score = 1022 bits (2642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/575 (88%), Positives = 508/575 (88%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MKVQSVVLPVAVFSTLGAALILPWMDPEIRLD                            
Sbjct: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60

Query: 61  XXXXXXSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG 120
                 SSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG
Sbjct: 61  KGHHRGSSVLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDG 120

Query: 121 VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS 180
           VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS
Sbjct: 121 VTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGS 180

Query: 181 LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF 240
           LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF
Sbjct: 181 LRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSF 240

Query: 241 NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA 300
           NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA
Sbjct: 241 NKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIA 300

Query: 301 SKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG 360
           SKTYG            LRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG
Sbjct: 301 SKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGG 360

Query: 361 GKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW 420
           GKS                     GNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW
Sbjct: 361 GKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNW 420

Query: 421 GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS 480
           GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS
Sbjct: 421 GSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS 480

Query: 481 ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG 540
           ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG
Sbjct: 481 ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG 540

Query: 541 KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI
Sbjct: 541 KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/485 (60%), Positives = 355/485 (73%), Gaps = 12/485 (2%)

Query: 99  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMH 158
           L  + D +RAIPH+YIV+F++GV+D +   H +LV  AH E++A+LD  H+FF +T G +
Sbjct: 61  LFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGEN 120

Query: 159 HE-GISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFE 217
           +E GI+A   EGGIE  F +   LRGY GYFT+ M+ L+R +  V  +E+DS+V ASDF 
Sbjct: 121 NEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFT 180

Query: 218 TQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGK 277
           TQ GAPWGLARVSHRE+LN GSFNKYLYDDN+G+GVT+YVIDTGINIDHV+FE RA WGK
Sbjct: 181 TQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGK 240

Query: 278 TIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVV 337
           TIP+NDADYDGNGHGTHCAGTIASKTYG            LR+NGTG+MSDVLRGVEY V
Sbjct: 241 TIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAV 300

Query: 338 AEHRKAS--GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTS 395
             HRKA+   D  FKGSTANMSLGGG+S                     GNENQDACNTS
Sbjct: 301 KAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTS 360

Query: 396 PASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASP 455
           PA+S+K ITV ASTL+DDRAYFSNWG CVD+FAPG+NILSTYIGSDTAVATLSGTSMASP
Sbjct: 361 PAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASP 420

Query: 456 HVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGG 515
           HVAGLL YFLSLQPD  SE+    +ISPE LKKK++ +G+K+ L+++PARTAN LI+NGG
Sbjct: 421 HVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGG 480

Query: 516 GGSLDSFWNSKCDGCEQEKVSSSHGKADDFES-----ESLMDCLHSTSHSLFGEIRNFLD 570
           G  L  FW +K       K +     ADD E+     + L+  L S++ ++F   R  LD
Sbjct: 481 GADLSDFWGNKPKKVSGPKFT----YADDEEAMGSDLDRLIHELESSTDAMFSGFRTILD 536

Query: 571 RLDLI 575
           R+++I
Sbjct: 537 RMNII 541

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/488 (56%), Positives = 348/488 (71%), Gaps = 13/488 (2%)

Query: 96  DMKLASLSDNSRA---IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFD 152
           ++KLA L  + +    IPHRYI++FK   T  ++  H+++++ AH E++A+LD   SFF 
Sbjct: 62  EVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFA 121

Query: 153 ATEGMHHE-GISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIV 211
           AT+G   E GI+A+S EGGI+E F+IA  L GY GYFTD ++D IR +  V+ IE+DS+V
Sbjct: 122 ATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLV 181

Query: 212 HASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG 271
            AS+F+TQ GAPWGL+R+SHRERLNLGSFNKYLYDD+AGKGVT+YVIDTGIN++H +F G
Sbjct: 182 FASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNG 241

Query: 272 RAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLR 331
           RA WGKT+P ND D DGNGHGTHCAGTIAS+ YG            LR+NG+GTMSDV++
Sbjct: 242 RAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVK 301

Query: 332 GVEYVVAEHRKAS--GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQ 389
           GVE+    H++AS      FKGSTANMSLGGGKS                     GNENQ
Sbjct: 302 GVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ 361

Query: 390 DACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSG 449
           DACNTSPA+++  ITV ASTLSDDRAYFSNWG CVDIFAPGLN+LSTYIGS+TA ATLSG
Sbjct: 362 DACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421

Query: 450 TSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANN 509
           TSMASPHVAGLL YFLSLQPDS SE++  S I+P  LKKK++AY +K++L  +P  T N 
Sbjct: 422 TSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNY 481

Query: 510 LIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKAD--DFESESLMDCLHSTSHSLFGEIRN 567
           LI+NGGG  L  FW     G  +E+V       D  DF+   L++   + +  LF E+R+
Sbjct: 482 LIYNGGGQDLSDFW-----GKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRS 536

Query: 568 FLDRLDLI 575
             D+L++I
Sbjct: 537 VFDKLNII 544

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/489 (55%), Positives = 338/489 (69%), Gaps = 19/489 (3%)

Query: 99  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGM- 157
           L S S    AIPHRYIV+FK  ++  +V  H+ +V+ AH++++A+L+  H FF +TE   
Sbjct: 69  LVSSSGKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFV 128

Query: 158 --------HHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDS 209
                   +    SA++ EGGI++ F+++G L GY GYFTD ++D IR + LV  +EQDS
Sbjct: 129 EDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDS 188

Query: 210 IVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEF 269
           +V A +F TQ GAPWGL+R+SHRE+LNLGSFNKYLYDD+AGKGVT+YVIDTG+N+DH +F
Sbjct: 189 VVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDF 248

Query: 270 EGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDV 329
           EGRA WGKTIP+ND D DGNGHGTHCAGTIASK YG            LR+NG+G+MSDV
Sbjct: 249 EGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDV 308

Query: 330 LRGVEYVVAEHRKA--SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNE 387
           ++GVE+    H+ A       FKGSTANMSLGGGKS                     GNE
Sbjct: 309 VKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNE 368

Query: 388 NQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATL 447
           NQDACN+SPAS++  +TV ASTL+DDRAYFSNWG CVDIFAPGLN+LSTYIGSDTA ATL
Sbjct: 369 NQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATL 428

Query: 448 SGTSMASPHVAGLLAYFLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPART 506
           SGTSMASPHVAGLL YFLSLQPDS SEY+     I+P  LKKK++AY +KN+L ++P  T
Sbjct: 429 SGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDT 488

Query: 507 ANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIR 566
            N LIFNGGG  LD FW  +    E E   SS       E ES +D L   +  L+ EIR
Sbjct: 489 VNYLIFNGGGEGLDDFWGKESVVDEVEDTISS-------EIESFIDALEEKTDVLYEEIR 541

Query: 567 NFLDRLDLI 575
              D +++I
Sbjct: 542 EVFDHMNII 550

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/472 (57%), Positives = 335/472 (70%), Gaps = 11/472 (2%)

Query: 108 AIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARS 166
           AIPHRYIV+FKD V   +V  H ++V+ AH +++ +LD   +FF+AT  M  E GI A S
Sbjct: 79  AIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEAT--MDEEMGIMATS 136

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 226
            EGGI + F++ G LRGY GYFT  ++D IR + LV  +EQDS+V+A++F+TQ GAPWGL
Sbjct: 137 REGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGL 196

Query: 227 ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 286
           +R+SHRE+LNLGSFNKYLYDD AGKGVT+YVIDTGINIDH +FEGRA WGKT+P+ND D 
Sbjct: 197 SRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQ 256

Query: 287 DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKA--S 344
           DGNGHGTHCAGTIASK YG            LR+NG+G+MSDV++GVE+    H+ A   
Sbjct: 257 DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKK 316

Query: 345 GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCIT 404
               FKGSTANMSLGGGKS                     GNENQDACN+SPA+++  IT
Sbjct: 317 NKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAIT 376

Query: 405 VAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYF 464
           V ASTL+DDRAYFSNWG CVDIFAPGLN+LSTYIGS+TA ATLSGTSMASPHVAGLL YF
Sbjct: 377 VGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYF 436

Query: 465 LSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
           LSLQPDS SEY+     I+P  LKKK++AY +KN L ++P  T N LI+NGGG  LD FW
Sbjct: 437 LSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFW 496

Query: 524 NSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
                  E++   +    A +F  ES++D L   +  L+ EIR   + L++I
Sbjct: 497 ---VKDLEEKVADAKDNTASEF--ESIIDALEEKTDGLYEEIREIFEGLNII 543

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/481 (54%), Positives = 335/481 (69%), Gaps = 10/481 (2%)

Query: 99  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMH 158
           L++++D +  IP+RYI++FK   +  +V  HQ+LV+  H + +  L     FF AT G H
Sbjct: 87  LSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEH 146

Query: 159 HE-GISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFE 217
            E G+ A S+EGGI++ F+IAGSL GY GYFT  ++D IR S LV+ +E+DS+V ++ F 
Sbjct: 147 SEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFN 206

Query: 218 TQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGK 277
           TQ  APWGLAR+SHRE+LNLGSFNKYLYDD+AGKGVTAYV+DTG+N++H +F+GRA WGK
Sbjct: 207 TQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGK 266

Query: 278 TIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVV 337
           TIP +D D DGNGHGTHCAGTI S  YG            LR+NG+GTMSDV++GVEYV 
Sbjct: 267 TIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVA 326

Query: 338 AEHRKASGDPN--FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTS 395
             H+KA  +    FKGSTANMSLGGGKS                     GNENQDACNTS
Sbjct: 327 EAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTS 386

Query: 396 PASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASP 455
           PA+++  ITV ASTLSD+RAYFSNWG CVDIF PGLNILSTYIGSDTA ATLSGTSMA+P
Sbjct: 387 PAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATP 446

Query: 456 HVAGLLAYFLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 514
           HV GLL YFLSLQPD+ SEY+     I+P  LKKK++ + +KN+L+++P  T N LI+NG
Sbjct: 447 HVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNG 506

Query: 515 GGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDL 574
           GG  LD  W       +   +        +F  ESL++ L S + ++F ++R  LD+ ++
Sbjct: 507 GGQDLDDLWG------KDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNI 560

Query: 575 I 575
           I
Sbjct: 561 I 561

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/579 (48%), Positives = 363/579 (62%), Gaps = 35/579 (6%)

Query: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MK Q  V+PVA  + LG+ALI+P +                                   
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPEL----------------------TGSNEYEKRPERT 38

Query: 61  XXXXXXSSVLLVDDEEDKVSPMFEYFEFDSSQDFVD--MKLASLSDNSRAIPHRYIVIFK 118
                  SV+    E+         F    +Q+  D    L    D    + +RYI++FK
Sbjct: 39  DDVNNGESVVATSFEKGPSKDELAVFASKLTQEVQDRFAPLVVPEDTLGVLENRYIILFK 98

Query: 119 DGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIA 178
            GV   ++G H++L+   H++ ++QL   HSFF   EG+  +G+    + GGI+  F+I 
Sbjct: 99  KGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF---EGIRLDGVYDSPL-GGIDHTFDIN 154

Query: 179 GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLG 238
           G L GY GYF   +LD+IR S L++++EQDS+V+    +T+ GAPWGLAR+SHRERLNLG
Sbjct: 155 GMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLG 214

Query: 239 SFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGT 298
           S+NKYLYD+  G GVT+YVIDTG+N+ H +F GRA+WGKTIP+ D D DGNGHGTHCAGT
Sbjct: 215 SYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGT 274

Query: 299 IASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKA--SGDPNFKGSTANM 356
           I S TYG            LR+NG+G+MSDVL+GVE+   +H+ A     P FKGSTANM
Sbjct: 275 IGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANM 334

Query: 357 SLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRAY 416
           SLGGGKS                     GNE+QDACNTSPAS+   ITV ASTLSDDRAY
Sbjct: 335 SLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAY 394

Query: 417 FSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYY 476
           FSN+G CVD+FAPGLNILSTYIGSD++ ATLSGTSMASPHVAGLLAYFLSLQP S SE+ 
Sbjct: 395 FSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFD 454

Query: 477 TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVS 536
            GSSISP+ LKKK++A+ +K++L+++P+ T N LI+NGGGG L  FW SK    E E   
Sbjct: 455 AGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSKEVAQELE--- 511

Query: 537 SSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
               +  D E   L+D L S + ++FG+IR  +DRLD+I
Sbjct: 512 --FNEKVDLELHDLVDELGSKTDAVFGQIRGLMDRLDII 548

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/481 (54%), Positives = 340/481 (70%), Gaps = 21/481 (4%)

Query: 99  LASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMH 158
           +A LS    A PHRYIV+ K    + ++ +H + +T + ++++ +L     FF A     
Sbjct: 101 VAPLSIPPNAFPHRYIVVLKHSSPE-EIALHMEAITQSQLQSVGELAQDDPFFSA----- 154

Query: 159 HEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFET 218
            +G+      GGI++ F++AG L GY GYFTD +++LIR+S +V  +E DS VHAS+F+T
Sbjct: 155 -QGVR---TTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT 210

Query: 219 QTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKT 278
           Q GAPWGL+R+SHRERLNLGSFNKYL+DD AGKGVT+YVIDTGIN+ H +FEGRA WGKT
Sbjct: 211 QNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKT 270

Query: 279 IPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVA 338
           IP+ND D DGNGHGTHCAGTIASK YG            LR+NG+G+MSDV++GVE+   
Sbjct: 271 IPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQ 330

Query: 339 EHRKASGDPN--FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSP 396
            H+KA  D    FKGSTANMSLGGGKS                     GNENQDACNTSP
Sbjct: 331 SHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSP 390

Query: 397 ASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPH 456
           A++++ +TV ASTLSDDRAYFSN+G CVDIFAPGLNILSTYIGSD A ATLSGTSMASPH
Sbjct: 391 AAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPH 450

Query: 457 VAGLLAYFLSLQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 514
           VAGLL YFLSLQPDS S+++   S  ++PE LKKK++AY +K++L ++P  T N LI+NG
Sbjct: 451 VAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNG 510

Query: 515 GGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDL 574
           GG  L  FW    DG ++++ ++   +  D + + L D L + + +LF ++R+ LDRL++
Sbjct: 511 GGHGLKGFW----DGHDKQEANT---RFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNI 563

Query: 575 I 575
           I
Sbjct: 564 I 564

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  513 bits (1321), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 258/474 (54%), Positives = 326/474 (68%), Gaps = 18/474 (3%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           S+ IP+RYIV+FK GV + +V  H++ V  A ++++  L    +FF +T   +     + 
Sbjct: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTY----LST 204

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
           S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A++F+TQ  APWG
Sbjct: 205 SEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWG 264

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           LAR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+NI+H +FE RA WGKTIP ND D
Sbjct: 265 LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 324

Query: 286 YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASG 345
            DGNGHGTHCAGTIASK YG            LR+NG+GTMSDV++GVEY    H+K + 
Sbjct: 325 LDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQAQ 384

Query: 346 DPN--FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 403
           +    FKGSTANMSLGGGKS                     GNENQDACNTSPAS+ K I
Sbjct: 385 EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 444

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 445 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTY 504

Query: 464 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 505 FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSA 564

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           FWN             SH      E  ++ + + S +  LF ++R+ LD+L++I
Sbjct: 565 FWND---------TKKSHPSGSKHEL-NMDEFIGSKTDLLFEQVRDVLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  509 bits (1311), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 260/475 (54%), Positives = 328/475 (69%), Gaps = 20/475 (4%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           S+ IP+RYI++FK G    ++  H++ V  A ++++  L    +FF +T+    +   + 
Sbjct: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTK----DTSLST 231

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
           S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DSIV A++F+TQ  APWG
Sbjct: 232 SEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWG 291

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           LAR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+NI+H +FE RA WGKTIP ND D
Sbjct: 292 LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 351

Query: 286 YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASG 345
            DGNGHGTHCAGTIASK YG            LR+NG+GTMSDV++GVEY    H+K + 
Sbjct: 352 LDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQ 411

Query: 346 DPN--FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 403
           +    FKGSTANMSLGGGKS                     GNENQDACNTSPAS+ K I
Sbjct: 412 EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAI 471

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 472 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTY 531

Query: 464 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 532 FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSA 591

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMD-CLHSTSHSLFGEIRNFLDRLDLI 575
           FWN         K S S G    F+ E  MD  + S +  +F ++R+ LD+L++I
Sbjct: 592 FWNDT-------KKSHSSG----FKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  508 bits (1307), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 263/504 (52%), Positives = 335/504 (66%), Gaps = 32/504 (6%)

Query: 77  DKVSPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTA 136
           +K++P+    +FD +               + IP+RYI++FK GV       H++ V  A
Sbjct: 132 EKLAPLVSTAQFDPAA------------MPKIIPNRYIIVFKKGVPQEATDFHKESVHQA 179

Query: 137 HMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLI 196
            ++++  L    +FF +T     +   + S  GGI++ F I     GY GYFT  ++DLI
Sbjct: 180 QLQSVENLSAEDAFFISTR----DSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLI 235

Query: 197 RESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAY 256
           R++ LV  +E+DS+V A+DF+TQ  APWGLAR+SHRERLNLGSFNKYLYDD+AG+GVT+Y
Sbjct: 236 RQNPLVDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSY 295

Query: 257 VIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXX 316
           VIDTG+N++H +FE RA WGKTIP ND D DGNGHGTHCAGTIASK YG           
Sbjct: 296 VIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVK 355

Query: 317 XLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN--FKGSTANMSLGGGKSXXXXXXXXXXX 374
            LR+NG+GTMSDV++GVEY    H+K + +    FKGSTANMSLGGGKS           
Sbjct: 356 VLRSNGSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAV 415

Query: 375 XXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNIL 434
                     GNENQDACNTSPAS+ K ITV ASTLSDDRAYFSNWG CVDIFAPGLNIL
Sbjct: 416 EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL 475

Query: 435 STYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYT--GSSISPEALKKKIVA 492
           STYIGSD A ATLSGTSMASPHVAGLL YFLSLQP S SE++     S++P+ LK K++ 
Sbjct: 476 STYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIH 535

Query: 493 YGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMD 552
           Y +K++L +VP  T N LI+NGGG  L +FWN      + +K  SS      F+ E  MD
Sbjct: 536 YSTKDILFDVPEDTPNALIYNGGGQDLSAFWN------DTKKSHSSR-----FKQELNMD 584

Query: 553 -CLHSTSHSLFGEIRNFLDRLDLI 575
             + S +  +F ++R+ LD+L++I
Sbjct: 585 EFIGSKTDLIFEQVRDVLDKLNII 608

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  502 bits (1292), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 258/475 (54%), Positives = 323/475 (68%), Gaps = 16/475 (3%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           +PH+YIV+ K GV+   V    + V+ AH   I  L   H FF+       EG+      
Sbjct: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNA---EGLP----R 54

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
           GGI+++F I    +G  GYF + ++ L+ +S +V+ +E+DS+VHAS+F+TQ  APWGLAR
Sbjct: 55  GGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLAR 114

Query: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
           +SHR+RLNLG+FNKYLYD+  G+GVTAYVIDTGIN+ HVEF+GRAQWGKTIP ND D DG
Sbjct: 115 ISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDG 174

Query: 289 NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKAS-GDP 347
           NGHGTHCAGTIASK YG            L+++G+GTMSDV++GVEY    H K S  + 
Sbjct: 175 NGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNK 234

Query: 348 NFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA 407
            FKGSTANMSLGGGKS                     GNENQDACNTSPAS++K ITV A
Sbjct: 235 KFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGA 294

Query: 408 STLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGLLAYFLS 466
           STLSDDRAYFSNWG CVDIFAPGLNILSTYIG ++   A+LSGTSMASPHVAGLL YFLS
Sbjct: 295 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLS 354

Query: 467 LQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVP-ARTANNLIFNGGGGSLDSFW 523
           LQPDS SE+Y  S   ++P  LKKK++AY +KN+L ++P   + N LI+NG GG L  FW
Sbjct: 355 LQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFW 414

Query: 524 NSKCDGCEQEKVSSSHGKADDFESESLMDCL---HSTSHSLFGEIRNFLDRLDLI 575
           NS     EQ         A +   +SL   +   H+ + SLFG++RN LD++++I
Sbjct: 415 NS-TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  504 bits (1297), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 255/474 (53%), Positives = 313/474 (66%), Gaps = 32/474 (6%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IPHRYI+ FK  V   ++  HQ  +     ++IAQL   H +F++ EG+         ++
Sbjct: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGL--------DLQ 176

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
             I + F I   L+GY GYFTD ++D IR + LV+ +EQDS V+ ++F+TQ GAPWGLAR
Sbjct: 177 QPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLAR 236

Query: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
           +SHRERLNLGSFNKYL+DD AG+GVTAYVIDTG+N++H +FEGRA WGKTIP+ND D DG
Sbjct: 237 ISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDG 296

Query: 289 NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH-----RKA 343
           NGHGTHCAGTIASK YG            LR+NG+G+MSDVL+GVEY  A H      K 
Sbjct: 297 NGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKK 356

Query: 344 SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 403
           SG   FKGSTANMSLGGGKS                     GNENQDACNTSPAS+K  I
Sbjct: 357 SG---FKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAI 413

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL+Y
Sbjct: 414 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSY 473

Query: 464 FLSLQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           FLSLQP+  SE+ T     I+P  LKK++++YG+K++L ++P  T N L+FNG G  L  
Sbjct: 474 FLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSD 533

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           FWN                K  D ES  +   L      L+ +      +++L+
Sbjct: 534 FWNI--------------SKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  506 bits (1303), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 258/475 (54%), Positives = 329/475 (69%), Gaps = 19/475 (4%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           ++ IP+RYI++FK  V   +   H++ V  A ++++  L    +FF +T     +   + 
Sbjct: 204 TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTR----DAALSS 259

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
           S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A+DF+TQ  APWG
Sbjct: 260 SEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWG 319

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           LARVSHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+N++H +FE RA WGKTIP ND D
Sbjct: 320 LARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED 379

Query: 286 YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASG 345
            DGNGHGTHCAGTIASK YG            LR+NG+GTMSDVL+GVEY    H+K + 
Sbjct: 380 LDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAE 439

Query: 346 DPN--FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 403
           +    FKGSTANMSLGGGKS                     GNENQDACNTSPAS+ K I
Sbjct: 440 EKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 499

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV ASTLSDDRAYFSN+G CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 500 TVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTY 559

Query: 464 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 560 FLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSA 619

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESE-SLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           FWN      + +K  SS G    F+ E +L + + S +  +F ++R+ LD+L++I
Sbjct: 620 FWN------DTKKSHSSSG----FKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  495 bits (1274), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 250/470 (53%), Positives = 315/470 (67%), Gaps = 26/470 (5%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IP++YI++FK  V+  D+ +H+DL+  A  +  +  D                 ++ S+ 
Sbjct: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDE----------------TSSSIL 275

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
           GGIEE F +A    GY G+F + ++  IR S +V  +EQDSIVHA++ +TQ  APWGLAR
Sbjct: 276 GGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLAR 335

Query: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
           +SHR+ LNLGS+NKYLYDD AG+GVTAYVIDTGINI H EF GRA WGKTIP ND D DG
Sbjct: 336 ISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDG 395

Query: 289 NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN 348
           NGHGTHCAGTIASK YG            LR++G+GTMSDVL+GVEY    H+KA  +  
Sbjct: 396 NGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKK 455

Query: 349 --FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVA 406
             FKGSTANMSLGGGKS                     GNENQDACN+SPA+S+  ITV 
Sbjct: 456 KGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVG 515

Query: 407 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 466
           ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL+YFLS
Sbjct: 516 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLS 575

Query: 467 LQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWN 524
           +QPD+ SE+++   +SISP  LKKK++AY +KNL  ++P +T N L++N  G ++  FW 
Sbjct: 576 MQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634

Query: 525 SKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDL 574
            K      E  +  + +A +FE E L+D     + +    I+   +R+DL
Sbjct: 635 PKS-----ESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDL 679

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  494 bits (1273), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 254/456 (55%), Positives = 310/456 (67%), Gaps = 25/456 (5%)

Query: 90  SSQDFVDMKLASL----------------SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLV 133
           S QD V++K+A L                + NS  IP+RYIV+FK  +   +V  H++L+
Sbjct: 64  SVQDSVNLKMAPLVTPTPYPVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELI 123

Query: 134 TTAHMETIAQLDPGHSFFDATEGMHHEGISARSV-EGGIEEMFEIAGSLRGYFGYFTDGM 192
               +E+ A+L     FF A+       I   S+ +GGI   F I+  L GY GYFTD +
Sbjct: 124 NQIQLESAAKLPKDDKFFSAS------AIEDESINQGGILTTFNISNLLNGYVGYFTDEV 177

Query: 193 LDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKG 252
           L+LIR + LV+ +E+DS+V A++F+ Q  APWGLAR+SHRERLNLGSFNKYLYDD+AGKG
Sbjct: 178 LELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKG 237

Query: 253 VTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXX 312
           VT YVIDTGIN +H +F  RA WGKTIP ND D DGNGHGTHCAGTIAS  YG       
Sbjct: 238 VTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEV 297

Query: 313 XXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN--FKGSTANMSLGGGKSXXXXXXX 370
                LR+NG+G+MSDV++GVE+    H KA+ +    FKGSTANMSLGGGKS       
Sbjct: 298 VAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAV 357

Query: 371 XXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPG 430
                         GNENQDACNTSPAS+++ ITV ASTLSDDRAYFSNWG CVDIFAPG
Sbjct: 358 NAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPG 417

Query: 431 LNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKI 490
           LNILSTYIG D A ATLSGTSMASPHVAGLL YFLSLQP S SE++  + ++P  +KKK+
Sbjct: 418 LNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTPAQMKKKL 477

Query: 491 VAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSK 526
           + Y SK++L ++P  T N LIFNG GG+LD  WN K
Sbjct: 478 INYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKK 513

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  483 bits (1244), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 238/434 (54%), Positives = 304/434 (70%), Gaps = 7/434 (1%)

Query: 96  DMKLASL-SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDAT 154
           +++ ASL + NS  IP+ YIV+F +GVT  ++ +H + ++   ++++  L   H FF  +
Sbjct: 21  EVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTIS 80

Query: 155 EGMHHEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHAS 214
                  +++  + GG+ +MF+I   L GY G FTD +++ +R S LVK IE+DS+VH +
Sbjct: 81  TS---SDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTT 137

Query: 215 DFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQ 274
           +  TQ  APWGLAR+SHR RLNL +FNKYLYDD  GKGV AYVIDTGINI +V+F GRA 
Sbjct: 138 EATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAY 197

Query: 275 WGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVE 334
           WGKTIP+ +A+ DGNGHGTH AGTIAS  YG            LR+NG G+MSDVL+GVE
Sbjct: 198 WGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVE 257

Query: 335 YVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNT 394
           YVV  H++  G   FKGS ANMSLGGGKS                     GNENQDACNT
Sbjct: 258 YVVGAHQRDVGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNT 317

Query: 395 SPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMAS 454
           SPA++++ ITV ASTLSD RAYFSNWG CV IFAPGLNILSTYIGS  A ATLSGTSMAS
Sbjct: 318 SPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMAS 377

Query: 455 PHVAGLLAYFLSLQPDSGSEYYT---GSSISPEALKKKIVAYGSKNLLNNVPARTANNLI 511
           PH+AGL+AYFLSLQP   S++Y+    ++I+P+ LKKKIVA+G+KN L ++PA T N + 
Sbjct: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437

Query: 512 FNGGGGSLDSFWNS 525
           +NG G SL+ FWN+
Sbjct: 438 YNGAGKSLEDFWNA 451

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  486 bits (1251), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 246/474 (51%), Positives = 314/474 (66%), Gaps = 11/474 (2%)

Query: 107 RAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARS 166
           R +P++YI++FKD +   ++  H++L++    ++ ++L P H FF +T     E      
Sbjct: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFR--- 293

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 226
             GGI   F I   L GY GYFT  ++DLIR + LVK +E+DSIV  ++F TQ  APWGL
Sbjct: 294 -NGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGL 352

Query: 227 ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 286
           +R+SHRERLNLGSFNKYLYDD+AGKGVT +VIDTGIN++HV+F  RA WGKTIPSND D 
Sbjct: 353 SRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412

Query: 287 DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH-RKASG 345
           DGNGHGTHCAGTIAS  YG            LR+NG+G+MSDV++GVE+    H      
Sbjct: 413 DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKN 472

Query: 346 DPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITV 405
             ++KGSTANMSLGGGKS                     GNENQDACN+SPAS++  ITV
Sbjct: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532

Query: 406 AASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGLLAYF 464
            ASTLSDDRAYFSNWG CVD+FAPGLNILSTY+G  +   ATLSGTSMASPHVAGLL YF
Sbjct: 533 GASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYF 592

Query: 465 LSLQPDSGSEYYTGSS---ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           LSLQPDS S ++   S   I+PE LKKK++AY + ++L ++P  T N LI+NG GG +  
Sbjct: 593 LSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISD 652

Query: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
            WN K    EQ     +H    +FE+    D +   +   F +IRN  +++++I
Sbjct: 653 LWNGKVQ--EQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  471 bits (1211), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 240/467 (51%), Positives = 306/467 (65%), Gaps = 33/467 (7%)

Query: 111 HRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVEGG 170
           ++YI++FK+GVT   +  H+ L+    +ET                     +SA+ +   
Sbjct: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLET-------------------SDVSAQGIVAD 136

Query: 171 IEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVS 230
           + + F++ G L GY    +  +L+L+R S  V+L+EQDS VH ++F+TQ  APWGLAR+S
Sbjct: 137 VLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARIS 196

Query: 231 HRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNG 290
           HR+ L+LGSFNKYLYDD AG+GV +Y+IDTGIN+ H EFEGRAQWGKTIP ND D DGNG
Sbjct: 197 HRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNG 256

Query: 291 HGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH--RKASGDPN 348
           HGTHCAGTIASK YG            LR+NG+G+MSDV+ GVE+   +H  +  S D  
Sbjct: 257 HGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKK 316

Query: 349 FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAAS 408
           FKGSTANMSLGGGKS                     GNENQDACNTSPA+S++ ITV AS
Sbjct: 317 FKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGAS 376

Query: 409 TLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQ 468
           TLSDDRAYFSNWGSCVDIFAPGLNILSTY GSD A ATLSGTSMASPHVAGLL YFLSLQ
Sbjct: 377 TLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQ 436

Query: 469 PDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCD 528
           P+  S++ T + I+PE LKKK++ Y +K +L ++P  T N LI+NGGG  L  FW  K  
Sbjct: 437 PEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDK-- 494

Query: 529 GCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575
           G +  K   +H            D + ++S ++F ++R    +L++ 
Sbjct: 495 GKKSHKPLFAHE----------YDNVWASSDAMFEQVRAMFGKLNIF 531

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  464 bits (1195), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 229/424 (54%), Positives = 290/424 (68%), Gaps = 5/424 (1%)

Query: 103 SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGI 162
           +D    IPHRYI++FKDGV+   +  H++L+TT H++  +      + +  T+    E  
Sbjct: 52  ADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPE-- 109

Query: 163 SARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGA 222
           S R   GGI   F+I+  L GY  Y +D +L  IR + L+  IE D++VH +DF TQ  A
Sbjct: 110 SMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNA 169

Query: 223 PWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSN 282
           PWGLAR+SHRE LNL +FNKYLYDD+AGK V AYVIDTG++++HVEF  RA WGKTIP N
Sbjct: 170 PWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLN 229

Query: 283 DADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH-R 341
           D D DGNGHGTH AGTI S+ YG            LR+NG+G+MSDV++GVE+ V+ H  
Sbjct: 230 DQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLE 289

Query: 342 KASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKK 401
           +   + N KGS ANMSLGGGKS                     GNENQ+ACN+SPAS+++
Sbjct: 290 RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349

Query: 402 CITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGL 460
            +TV AST+SD+RAYFSNWG CVDIFAPGLNILSTYIG+ D   ATLSGTSMASPHVAGL
Sbjct: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409

Query: 461 LAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLD 520
           LAY+LSLQP+  SE+ T  +IS   LKKK++ Y +K++L ++P  T N LI+NGGG  L 
Sbjct: 410 LAYYLSLQPEKSSEFST-RAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLS 468

Query: 521 SFWN 524
            FWN
Sbjct: 469 DFWN 472

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  431 bits (1109), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 241/478 (50%), Positives = 303/478 (63%), Gaps = 30/478 (6%)

Query: 97  MKLASLSDNS--RAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDAT 154
           ++LA+L DN    A   RYI++FK GV    V  H  +++        +  P  +     
Sbjct: 118 LELAALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAA----- 172

Query: 155 EGMHHEGISA-RSVEGGIEEMFEIAGSLRGYFGYF-TDGMLDLIRESGLVKLIEQDSIVH 212
                 G SA R     + + FE+AG+  GY     +  ++D IR + LV  +E+DS+VH
Sbjct: 173 -----PGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVH 227

Query: 213 ASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEG 271
           + D ETQ  APWGLAR+SHRE LNLG+FNKYLY  N AGKGVTAYV+DTGI++ H+EF  
Sbjct: 228 SLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGE 286

Query: 272 RAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLR 331
           RA+WGKTIP ND D DGNGHGTHCAGTI S+ YG            LR++G+GTMSDVL+
Sbjct: 287 RAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLK 346

Query: 332 GVEYVVAEHRK------ASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXG 385
           GVE+V  EH K         + N+KG+TANMSLGGGKS                     G
Sbjct: 347 GVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAG 406

Query: 386 NENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVA 445
           NENQDACN+SPA+++  ITV ASTLSDDRAYFSN+G CVDIFAPGLNILSTYIG++ A A
Sbjct: 407 NENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATA 466

Query: 446 TLSGTSMASPHVAGLLAYFLSLQPDSGSEYYT-GSSISPEALKKKIVAYGSKNLLNNVPA 504
           TLSGTSMASPHVAGLL Y LSLQPD GSE+Y   S ++P  +KKKI+ Y +KN L ++PA
Sbjct: 467 TLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPA 526

Query: 505 RTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLF 562
            T N LI+NGG  S D FW S     +  KV     K + +   S +D +  +++  F
Sbjct: 527 DTPNKLIYNGGFNSTD-FWASAA-APQSHKV-----KTNRYSLGSFLDSIQDSNNHWF 577

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  407 bits (1047), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 205/419 (48%), Positives = 272/419 (64%), Gaps = 11/419 (2%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IP+RYIV+F + ++   +  H+ +V  AH  ++++L     F +         I+     
Sbjct: 67  IPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVS----SSIAPDLQL 122

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
           GGI+  F+I G  RGY GYFTD +L+L+ +  L+K IEQ+S V  S+   Q  APWGL R
Sbjct: 123 GGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHR 182

Query: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
           +SHRE+   G   +YLY+D AG+GVT+YV+DTGI+ +H +FEGRA WG  IP ND   D 
Sbjct: 183 ISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDL 242

Query: 289 NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH----RKAS 344
           NGHGTHCAG I SK YG            LR+NG GT+SDV++G+EYV  EH    RK S
Sbjct: 243 NGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKS 302

Query: 345 GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCIT 404
            +  FKGSTAN+SLG  KS                     GNEN+DAC +SPA ++K IT
Sbjct: 303 KE--FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSIT 360

Query: 405 VAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYF 464
           V AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+YF
Sbjct: 361 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYF 420

Query: 465 LSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
           LSLQP   SEY+  +++SP+ LK+K++ + +  +L ++   T N LI+NGGG  LD  W
Sbjct: 421 LSLQPAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  402 bits (1034), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 199/421 (47%), Positives = 276/421 (65%), Gaps = 9/421 (2%)

Query: 105 NSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISA 164
            + ++P+RYI+ F +  +   +  H+ ++     E++++L    +FF +T          
Sbjct: 63  KAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQF-- 120

Query: 165 RSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPW 224
               GGI+  F+I G  RGY GYFT+ ++  + +  ++K IEQ+S V  ++   Q  APW
Sbjct: 121 ----GGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPW 176

Query: 225 GLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDA 284
           GL R+SHRE+   G   +YLY+D AG+GVT+YV+DTGI+I+H +FEGRA WG  IP ND 
Sbjct: 177 GLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDE 236

Query: 285 DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKAS 344
             D NGHGTHCAG I S+ +G            LR+NG GT+SDV++G+EYVV +H  +S
Sbjct: 237 ASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSS 296

Query: 345 --GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKC 402
             G P FKGSTAN+SLG  KS                     GNE++DAC +SPA ++K 
Sbjct: 297 KKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356

Query: 403 ITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLA 462
           ITV AST SDDRA+FS+WG+CVD+FAPG+NILSTYIGS  A  +LSGTSMA+PHVAG+L+
Sbjct: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILS 416

Query: 463 YFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSF 522
           YFLSLQP S SE++  S++SP+ LK+KI+ + ++ +L +V   T N LI+NGGG  LD+F
Sbjct: 417 YFLSLQPSSDSEFFD-STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475

Query: 523 W 523
           W
Sbjct: 476 W 476

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  399 bits (1025), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 196/424 (46%), Positives = 272/424 (64%), Gaps = 7/424 (1%)

Query: 102 LSDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEG 161
           ++  +  +P+RY+++F + ++   +  H  +V   H  ++ +L    +F+          
Sbjct: 60  VAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSK 119

Query: 162 ISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTG 221
                  GGI+  F+I G  RGY GYFTD ++ +I +  ++K +EQ++ V  S+   Q  
Sbjct: 120 SQF----GGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEE 175

Query: 222 APWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPS 281
           APWGL RVSHRE+   G   +YLY+D AGKGVT+YV+DTGI+ +H +FEGRA+WG  IP+
Sbjct: 176 APWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPA 235

Query: 282 NDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHR 341
           ND   D NGHGTHCAG I SK +G            LR+NG GT+SDV++G+EYV  EH 
Sbjct: 236 NDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHI 295

Query: 342 KASGDPN--FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASS 399
           ++S   N  FKGSTAN+SLG  KS                     GNE++DAC +SPA +
Sbjct: 296 ESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGA 355

Query: 400 KKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAG 459
           +K ITV AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMASPHVAG
Sbjct: 356 EKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAG 415

Query: 460 LLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSL 519
           +L+YFLSLQP   SE++  +  SP+ LK+K++ + ++ +L ++   T N LI+NGGG  L
Sbjct: 416 ILSYFLSLQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKL 474

Query: 520 DSFW 523
           D FW
Sbjct: 475 DGFW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  399 bits (1024), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 196/420 (46%), Positives = 269/420 (64%), Gaps = 7/420 (1%)

Query: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165
           S+++P+RYI++F + +T+  +  H  ++  A   +++++    SF            S  
Sbjct: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSA----SASPN 121

Query: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225
              GGI+  F+I G  RGY GYFTD +++++ +  LVK IE +S V  S+   Q  APWG
Sbjct: 122 PQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWG 181

Query: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285
           L R+SHRER   G   +YLY+D AG GVT+YV+DTGI+ +H +FEGRA+WG  IP ND  
Sbjct: 182 LHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA 241

Query: 286 YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASG 345
            D NGHGTHCAG I S+ +G            LR+NG GT+SDV++G+EYV   H  +S 
Sbjct: 242 SDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSK 301

Query: 346 D--PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 403
                FKGSTAN+SLG  KS                     GNE++DAC +SPA ++K I
Sbjct: 302 KRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSI 361

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463
           TV AST SDDRA+FSNWG+CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+Y
Sbjct: 362 TVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSY 421

Query: 464 FLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
            LSLQP   SE++   ++SP+ LK+KI+ + ++ +L +V   T N L++NGGG  LD FW
Sbjct: 422 LLSLQPAQDSEFFY-DTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  392 bits (1007), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 206/426 (48%), Positives = 265/426 (62%), Gaps = 15/426 (3%)

Query: 103 SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFF---DATEGMHH 159
           + N   IP+RYIV+FKD VTD ++         +H+  I +++    F    D  +   +
Sbjct: 68  AKNDMIIPNRYIVLFKDFVTDKEI--------QSHLSAIEEINSSSIFLQDSDFGKATQY 119

Query: 160 EGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQ 219
             IS R +  G++  F I  S+ GY GYFT+     I  S LV+L+E DSIV  ++++ Q
Sbjct: 120 NDISTRGI--GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQ 177

Query: 220 TGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTI 279
              PWGL R+S RE+L +     Y YDD  GK    +VIDTGI +DH +FEGRA WGKTI
Sbjct: 178 EHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTI 237

Query: 280 PSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAE 339
             ND DYD NGHGTHCAGTIASK YG            LR++G+G+MSDV+RGVEY V  
Sbjct: 238 VENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEA 297

Query: 340 HRK-ASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPAS 398
           +        N KG+  NMSLG  KS                     GNE+ DACN+SPAS
Sbjct: 298 YNDLKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPAS 357

Query: 399 SKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVA 458
           +   ITV  STLSDD A+FSN+G CVDIFAPG+NI+STYIGS  A  +LSGTSM+SPHVA
Sbjct: 358 AWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVA 417

Query: 459 GLLAYFLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGG 517
           G+LAY+LSLQPD  S++Y   S+ISP+ LKKK++ Y +   L+ +PA T N L++NGGG 
Sbjct: 418 GVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGK 477

Query: 518 SLDSFW 523
           +L  FW
Sbjct: 478 NLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  350 bits (898), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 226/351 (64%), Gaps = 5/351 (1%)

Query: 174 MFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRE 233
           +F+I  +L GY        L L+R+  +V+LIE DS VHA   + Q   PWGL+R+S R 
Sbjct: 107 IFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRP 166

Query: 234 RLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGT 293
           R+ +G    Y YDD     VTAYV+DTGI I H +F GRA+WGKTI  ND D D +GHGT
Sbjct: 167 RVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGT 226

Query: 294 HCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNF-KGS 352
           H AG IAS  +G            LR+NG G MSDVL+G+E+VV +H K   + N+ KGS
Sbjct: 227 HVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK---NKNYSKGS 283

Query: 353 TANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSD 412
             N+SLG  KS                     GNEN DAC TSPA +++ ITV AS  SD
Sbjct: 284 VVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSD 343

Query: 413 DRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSG 472
           +RA+FSNWG CVD+FAPG+N++STYIGSD A  +LSGTS A+P+ AGL+AY+LSLQPD  
Sbjct: 344 ERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKD 403

Query: 473 SEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFW 523
           S Y+TG  ++P  LK+KIVA+GSK++L  +P  T N +I+NG G +L  FW
Sbjct: 404 SGYFTG-EMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  328 bits (840), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 177/424 (41%), Positives = 239/424 (56%), Gaps = 32/424 (7%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IP++YIV+FK   TD     H   + +  + T    DP ++   +               
Sbjct: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNT----DPQYTILHS--------------- 93

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228
                 F++A  L+GY     + ++  +    +++ IEQDS VHA   + Q  +PWGLAR
Sbjct: 94  ------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLAR 147

Query: 229 VSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTI-PSNDADY 286
           +S RERL L     Y YDD+ A      Y++DTGIN +H EF+GRA+WG    P      
Sbjct: 148 ISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQE 207

Query: 287 DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHR---KA 343
           D NGHGTHCAG I S  YG            L   G G MS V+RG+EYV  +H    K 
Sbjct: 208 DENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKK 267

Query: 344 SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 403
                FKGS  N+SLG GKS                     GNE+ DAC+TSPA S   +
Sbjct: 268 QDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHAL 327

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGLLA 462
           TV AS+ SDDR +FSNWG CVD+FAPG+NI+STYIG  +    +LSGTSM++P V GL+A
Sbjct: 328 TVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIA 387

Query: 463 YFLSLQPDSGSEYYTG-SSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521
           YFLSLQPD+ S++YTG +S +P  LK KI+++ ++ +L+ +P  T N +++NGGG SL  
Sbjct: 388 YFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKD 447

Query: 522 FWNS 525
           FWN+
Sbjct: 448 FWNN 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  305 bits (781), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 172/434 (39%), Positives = 243/434 (55%), Gaps = 36/434 (8%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           IP +YIV+F++  TD  +   +  +++   E   + +   ++                  
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY------------------ 104

Query: 169 GGIEEMFEIAGSLRGYF------GYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGA 222
             +   F+I+   +G         +  D   ++     ++K+IE+DS VH + F TQ  +
Sbjct: 105 SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDS 164

Query: 223 PWGLARVSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPS 281
            WGL+R+S R  L L     Y YDDN +GKGV  Y++DTGIN +H+EFEGRA WG ++P 
Sbjct: 165 SWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPV 224

Query: 282 NDADY-DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEH 340
            +    D NGHGTHCAG I SKTYG            L   G G+MSDV+ G+E+V   H
Sbjct: 225 TEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSH 284

Query: 341 RKASGD--------PNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDAC 392
              + +          FKGS  N+SLG  KS                     GNE++DAC
Sbjct: 285 TNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDAC 344

Query: 393 NTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTS 451
            TSPA S   ITV AS+ SDDRA+FSNWG CVD+FAPG+NI STYIG ++    +LSG+S
Sbjct: 345 MTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSS 404

Query: 452 MASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLI 511
           M+SP V+GL AY+LSLQPD  S+++  S ++P+ LK+KI+ + +  +L  +P  TAN L+
Sbjct: 405 MSSPFVSGLTAYYLSLQPDVSSQFH-DSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLV 463

Query: 512 FNGGGGSLDSFWNS 525
           +NGGG  L  FWN+
Sbjct: 464 YNGGGKDLSGFWNA 477

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  290 bits (742), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 151/345 (43%), Positives = 207/345 (60%), Gaps = 5/345 (1%)

Query: 173 EMFEIAGSLRGY-FGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSH 231
           E F IA  L G+    F    +  + +   V+++E +S V+A +   Q   PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 232 RERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNG 290
           R+R+ +G    Y YD   + K V  Y++DTGI +DH EFEGRA+WGKTI  ND D D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 291 HGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFK 350
           HGTHCAG +   TYG            L   G G MSDV+RG+E+ V EH   + D   +
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQD-EVR 253

Query: 351 GSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTL 410
           GS  N+SLG G+S                     GNE+ +AC +SPA+    +TV  ST 
Sbjct: 254 GSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTF 313

Query: 411 SDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTSMASPHVAGLLAYFLSLQP 469
           SDDRA+FSNWG C+D+FAPG+N+ S+Y+G +     +LSGTS ++PHVAGL+AY LSL+P
Sbjct: 314 SDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEP 373

Query: 470 DSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNG 514
           D+ S+++T  S +P  LK+K+V+  ++  L  VP  TAN +IFNG
Sbjct: 374 DTKSQFHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  264 bits (675), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 156/461 (33%), Positives = 238/461 (51%), Gaps = 21/461 (4%)

Query: 99  LASLSDN----SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDAT 154
           +A L +N    +  +P+RYIV+FK+     ++ +H   V    +     L P   FF   
Sbjct: 55  VAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFF--- 111

Query: 155 EGMHHEGISARSVE--GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVH 212
              HH      S E  GG+   F+I     GY GYFTD +++ IR+  +V  +E DSI+ 
Sbjct: 112 ---HHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILT 168

Query: 213 ASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGR 272
             D ET + + W LAR+SHR +L L +FN+Y +D N G+ + AY++DTG+   H  +  R
Sbjct: 169 IDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIER 228

Query: 273 AQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRG 332
              G  I  N+ + D NGHGT  AG +  +  G            L   G GT+S++++G
Sbjct: 229 TIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKG 288

Query: 333 VEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDAC 392
           + +V   H +        G+    S+ G KS                     G +  +AC
Sbjct: 289 LSFVNHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINAC 348

Query: 393 NTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSD----TAVATLS 448
           N+SPASS K ITVA  +++D+     NWGSCVDI+ PG  + +TY   +    T   +++
Sbjct: 349 NSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVT 408

Query: 449 GTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTAN 508
           G+S A+  VAGLLAYF SLQP  G+       ++PE LK++++ +G+K  L N+   + N
Sbjct: 409 GSSAAAAQVAGLLAYFASLQPGLGTPDVI--PLTPEELKERLIDFGTKGKLTNLERMSPN 466

Query: 509 NLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFESES 549
            + FNG GG+LDSF+N   DG E    ++ +    D  +E+
Sbjct: 467 IIAFNGAGGNLDSFFN---DGSEIVPTATKNVDPSDVPTET 504

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  169 bits (428), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 123/326 (37%), Positives = 165/326 (50%), Gaps = 47/326 (14%)

Query: 219 QTGAPWGLARVSHRERL--NLGSFNKYLYDDNA----------GKGVTAYVIDTGINIDH 266
           Q  AP  L+R+S R +L  ++ + ++Y   DNA          G  V AY+IDTGI  +H
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRY---DNAFDYYFDAKYQGSSVNAYIIDTGIYKEH 171

Query: 267 VEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTM 326
            EFEGR ++   + + +   D NGHGTH AG + SKT+G            L   G G +
Sbjct: 172 PEFEGRVKFAIDL-TQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQL 230

Query: 327 SDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGN 386
           S +L+ +E+ +  H K S D   K   AN+S G  ++                     GN
Sbjct: 231 STILKALEFTI-RHCKESVD---KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGN 286

Query: 387 ENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYIGS 440
            N DAC  SPASSK  ITV A    DDR    A FSNWGSCVD+FAPG+ +  LS   GS
Sbjct: 287 SNIDACWNSPASSKDVITVGAF---DDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGS 343

Query: 441 DTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLN 500
           D  V  LSGTSMASP V+G+ A  L    D G        ++P+ +K KI+   +KN+ +
Sbjct: 344 D--VLLLSGTSMASPSVSGIAAILL----DKG--------LNPKFVKSKIIESSTKNIFH 389

Query: 501 N----VPARTANNLIFNGGGGSLDSF 522
                +   T N ++FNG     DSF
Sbjct: 390 QGTIMIKPNTPNLIVFNGIEKMDDSF 415

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  169 bits (428), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 201/431 (46%), Gaps = 69/431 (16%)

Query: 128 MHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARS-VEGGIEEMFEIAGSLRGYFG 186
           + + +    ++ ++ Q D   SF D+T      G S +  +   I + F I GS +G+  
Sbjct: 17  LQEPIYGREYLVSLKQNDSIQSFMDST---ITRGRSVKEYLRDKIGKTFSI-GSFKGFTV 72

Query: 187 YFTDGMLDLIRESGLVKLIEQDSIVHASD------------------------FETQTGA 222
             TD +L+ I+++ LV  +  +  VHA +                         + Q GA
Sbjct: 73  DLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSVKVQYGA 132

Query: 223 PWGLARVSHRERLN---------LGSFNKYLYDDNA-GKGVTAYVIDTGINIDHVEFEGR 272
           P  LAR+S R++L          L S  KY YD  + G  V AY+ID+GI ++H EF GR
Sbjct: 133 PRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYLEHEEFNGR 191

Query: 273 AQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRG 332
           A  G  + + +   D NGHGTH AG + SK+YG            L   G G+++ VL G
Sbjct: 192 AIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLAMVLGG 250

Query: 333 VEYVVAEHRKASGDPNFKGS-TANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDA 391
           +E+ V   ++ S     KG   AN+SLG  ++                     GN N +A
Sbjct: 251 IEFAVKHCQETSK----KGRCVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAGNNNLNA 306

Query: 392 CNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATL 447
           C  SPAS+ + ITV A    DDR    A FSNWG C+DIFAPG+ I S  I  D    T 
Sbjct: 307 CWYSPASAPEAITVGAF---DDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKDKEDVTY 363

Query: 448 SGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----VP 503
           SGTSMASP VAGL A  L    D G        +S E +K  I+  G+ N+ +       
Sbjct: 364 SGTSMASPTVAGLAALTL----DQG--------VSAEEVKDYILEMGTDNVFHRRSLLFK 411

Query: 504 ARTANNLIFNG 514
             T N + FNG
Sbjct: 412 PGTPNKICFNG 422

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  166 bits (420), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 165/366 (45%), Gaps = 53/366 (14%)

Query: 192 MLDLIRESGLVKLIEQDSIVHA---SDFE----------TQTGAPWGLARVSHRERLNL- 237
           ++D IR S LV  +  +    A    DFE           Q GAP  L+R+S R +L   
Sbjct: 74  LVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYD 133

Query: 238 ---------GSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288
                    GSFN Y  + + G G+ AY+IDTGI  +H EF GRA +G+ + + +   DG
Sbjct: 134 FEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDG 192

Query: 289 NGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN 348
           NGHGTH AG + S  YG            L   G G ++ V+  +E+ V   R + G   
Sbjct: 193 NGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHCRSSEG--- 249

Query: 349 FKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA- 407
            KG   N+SLG  ++                     GN N +AC  SPAS+ + ITV A 
Sbjct: 250 -KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGAF 308

Query: 408 STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSL 467
              +D  A FSNWGSCVDIFAPG+ + S            SGTSMASP + GL A  L  
Sbjct: 309 DDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL-- 366

Query: 468 QPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPAR--------TANNLIFNGGGGSL 519
             D G  Y             KI  Y  K   N+V  R        T N + FNG   + 
Sbjct: 367 --DEGVPY------------DKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKND 412

Query: 520 DSFWNS 525
           D F N+
Sbjct: 413 DKFSNA 418

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  162 bits (410), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 144/450 (32%), Positives = 199/450 (44%), Gaps = 77/450 (17%)

Query: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168
           I H  I +F+  + ++    H+ LV+  + ++I       SF D+T    H  +    + 
Sbjct: 5   ILHSVIFVFQ--LIEF-TAAHEYLVSLKNSDSI------QSFMDSTYA--HGQLMKDYLH 53

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFE----------- 217
           G I + F   GS RG     T  ++  I+E+ LV  +  +  +HA D++           
Sbjct: 54  GKISKTFSF-GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 218 ---------------TQTGAPWGLARVSHRERLNLGSFNKYLYDD---------NAGKGV 253
                           Q GAP  LAR+S R  L     +K  Y+D         + G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 254 TAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXX 313
            AY+ID+GI+I+  EFEGRA  G  + + +   D NGHGTH AG + SKTYG        
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLV 231

Query: 314 XXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXX 373
               L   G+G++  V+  +E+VV    K+      K   AN+SLG              
Sbjct: 232 EVKALDRQGSGSLITVISALEFVVNHCGKSKS----KKCVANLSLGAFMMPLLNEAIKAT 287

Query: 374 XXXXXXXXXXXGNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAP 429
                      GN N DAC  SPAS K  ITV A    DDR    A FSNWGSCVDIFAP
Sbjct: 288 VDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAP 344

Query: 430 GLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEY-----YTGSSISPE 484
           G+ I S  I  +      SGTSMASP VAG+++  L    D G E      Y     + +
Sbjct: 345 GVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILL----DQGVENEDIRDYLFELATDD 400

Query: 485 ALKKKIVAYGSKNLLNNVPARTANNLIFNG 514
             +K+ + +           RT N + FNG
Sbjct: 401 VFQKRTLLF---------KPRTPNRITFNG 421

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  161 bits (408), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 139/458 (30%), Positives = 199/458 (43%), Gaps = 67/458 (14%)

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLV------------------------ 202
           ++  IE+ F I GS RG     +  +++ +++S L+                        
Sbjct: 85  IDHRIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNT 143

Query: 203 --KLIEQDSIVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDNAGK 251
             K   QD I  A +   Q  AP  LAR+S   +L             FN Y  D+  G+
Sbjct: 144 TAKYAYQD-IDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQ 202

Query: 252 GVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXX 311
           GV AY++DTGI+ +H EFE R   G  + + +   D NGHGTH AG + S+T+G      
Sbjct: 203 GVNAYIMDTGIHAEHPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVS 261

Query: 312 XXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXX 371
                 L  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S        
Sbjct: 262 LVEVKVLGKDGSGEASNVLSGLEFIV-EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVE 320

Query: 372 XXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPG 430
                        GN N DA   SPAS++  ITV A     D  A FSNWG CV+IFAPG
Sbjct: 321 GAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPG 380

Query: 431 LNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKI 490
           + I S    +D     LSGTSM++P V G+ A  LS              I PE + ++I
Sbjct: 381 VEIESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS------------KGIEPELIAQEI 428

Query: 491 VAYGSKNLLNN----VPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHGKADDFE 546
               ++N+ +         T N +++NG     D + +        E ++    + +   
Sbjct: 429 EYLSTRNVFHRRTLFFKPSTPNQILYNGVDKLDDPYDDETFPRLNVEAIAKELEEYNATL 488

Query: 547 SESLMDCLHSTSHSL---------FGEIRNFLDRLDLI 575
             ++ D LHS S             GEIR  L R D I
Sbjct: 489 QGAMTDDLHSGSKLWGWNNDVTLPLGEIR--LKRRDFI 524

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  161 bits (407), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 151/476 (31%), Positives = 204/476 (42%), Gaps = 81/476 (17%)

Query: 92  QDFVDMKLASLSDNSRAIPHRYIVIFKDG-VTDYDVGMHQD-LVTTAHMETIAQLDPGHS 149
           Q F+D +L      S+ I  R I  +  G    + + +  + L+       ++Q+ P  S
Sbjct: 30  QRFMDSQLVQEILESKPIRKRIIKTYSFGNFRGFVIDLPNEWLIKIRRSPFVSQVVPNFS 89

Query: 150 F--FDA----TEGMHHEGISARSVEGGIEEM--FEIAGSLRG---YFGYFTDGMLDLIRE 198
           F  FD     +E      I AR   GG  E+  F+     RG   YF  F     D+ + 
Sbjct: 90  FKAFDEETALSEVYRGRTIVARGENGGSPELQGFK-KEECRGDSVYFDKFEASGKDMPQV 148

Query: 199 SGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDNA 249
           +G  KL+ +         +TQ+ AP  LAR+S R +L             FN Y Y  + 
Sbjct: 149 NG--KLLSRY-------IKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQ 199

Query: 250 GKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXX 309
           G+ V AYV+D+G+ IDH +FEGRA +G     +    D NGHGTH AG I SKTYG    
Sbjct: 200 GRSVNAYVLDSGVMIDHCDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKK 259

Query: 310 XXXXXXXXLRTNGTGTMSDVLRGVEYVV--------------------AEHRKASGDPNF 349
                   L + G+GT+  V+ G+E+V                             D   
Sbjct: 260 VNIIDVKVLDSVGSGTLDTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVES 319

Query: 350 KGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAAST 409
           K    N+SLG  +S                     GN N +AC TSPAS    ITV A  
Sbjct: 320 KRCVINLSLGTFRSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA-- 377

Query: 410 LSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFL 465
             DDR    A FSNWG+CVDIFAPG+ + S            +GTSMA+P V GL+A  L
Sbjct: 378 -FDDRIDSIAKFSNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL 436

Query: 466 SLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPAR-------TANNLIFNG 514
               DSG        I P  +KK++    + N+    P R       T N + FNG
Sbjct: 437 ----DSG--------IKPTQIKKRLNELATDNIF---PRRTLLFKPGTPNRIAFNG 477

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  160 bits (404), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 113/312 (36%), Positives = 147/312 (47%), Gaps = 31/312 (9%)

Query: 217 ETQTGAPWGLARVSHRERLNLG---------SFNKYLYDDNAGKGVTAYVIDTGINIDHV 267
           + Q  AP  LAR+S R  L            SFN Y Y  + G+ + AY+IDTGI  +H 
Sbjct: 124 KVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHK 183

Query: 268 EFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMS 327
           +F GRA +G+   + +   D NGHGTH AG + S  +G            L   G G ++
Sbjct: 184 DFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLT 242

Query: 328 DVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNE 387
            V+  VE+ V  H K+SG    KG  AN+SLG  ++                     GN 
Sbjct: 243 TVISAVEFAV-NHCKSSGK---KGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNS 298

Query: 388 NQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVAT 446
           N +AC  SPAS+ + ITV A    +D  A FSNWG CVDIFA G+ + S           
Sbjct: 299 NINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIA 358

Query: 447 LSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----V 502
            SGTSMASP V GL+A  L    D G E        PE +K K+V   + +LL       
Sbjct: 359 FSGTSMASPSVTGLVAILL----DKGVE--------PENIKAKLVELATHDLLQRRTLFF 406

Query: 503 PARTANNLIFNG 514
              T N + FNG
Sbjct: 407 KPGTPNRIAFNG 418

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  160 bits (404), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 153/316 (48%), Gaps = 36/316 (11%)

Query: 218 TQTGAPWGLARVSHRERL--------NLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVE 268
            Q GAP  L R+S R +L            F  Y Y+D   G  + AY++DTGI  +H +
Sbjct: 153 VQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPD 212

Query: 269 FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSD 328
           FE R   G  + + +   D NGHGTH AG + SKT+G            L   G+G ++ 
Sbjct: 213 FENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTT 271

Query: 329 VLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNEN 388
           VL G+++ V +H +   +   K   ANMSLG  ++                     GN N
Sbjct: 272 VLSGIQFAV-DHCRLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNSN 330

Query: 389 QDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYIGSDT 442
             AC TSPAS+K  ITV A    DDR    AYFSNWG+CVDIFAPG+ I  LS    S  
Sbjct: 331 VSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESHH 387

Query: 443 AVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNV 502
              T SGTSMASP VAGL A  L    D G E        P  +K K++   +K++ N +
Sbjct: 388 KHVTHSGTSMASPVVAGLAAILL----DKGVE--------PFDVKDKLLHLSTKDVFNKL 435

Query: 503 PAR----TANNLIFNG 514
                  T N + +NG
Sbjct: 436 TLFFKYGTPNKIAYNG 451

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  157 bits (397), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 174/384 (45%), Gaps = 52/384 (13%)

Query: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASD------------F 216
           G I + F+I G L+G     +  +LD I+    VK +  + +V A +             
Sbjct: 50  GKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 217 ETQTGAPWGLARVSHRERLNLGSFNKYLYDDN---------AGKGVTAYVIDTGINIDHV 267
           + Q GAP  LAR+S R +L     NK  Y D+          G    AY++DTG+  DH 
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 268 EFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMS 327
           EFE R ++G T  + + + D NGHGTH AG + SKT+G            L   G GT+ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 328 DVLRGVEYVVA---EHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXX 384
            +L  +E+ V    EH  +           NMSLG  KS                     
Sbjct: 228 SILSALEFAVQDCQEHEDSQ-------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAA 280

Query: 385 GNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGS 440
           GN N +AC TSP+S+   ITV A    DDR    A FSNWG CVDIFAPG+N+ S     
Sbjct: 281 GNFNMNACWTSPSSATGAITVGAF---DDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRD 337

Query: 441 DTAVATLSGTSMASPHVAGLLAYFLS--LQPDSGSEYYTGSSISPEALKKKIVAYGSKNL 498
             +    SGTSMASP V G++A  L   + P+   +Y    + +    KK+ + +     
Sbjct: 338 WPSFVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELA-TDGVFKKRTLVFKPG-- 394

Query: 499 LNNVPARTANNLIFNGGGGSLDSF 522
                  T N++++NG     D +
Sbjct: 395 -------TPNSVLYNGNKKHDDEY 411

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  158 bits (400), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 144/464 (31%), Positives = 200/464 (43%), Gaps = 75/464 (16%)

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLV------------------------ 202
           ++  IE+ F I GS RG     +  +++ +++S LV                        
Sbjct: 94  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDGTNDAELNY 152

Query: 203 ------KLIEQDSIVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDD 247
                 K + +D I  A +   Q+ AP  LAR+S   +L             FN Y  DD
Sbjct: 153 TFNATAKYLYED-IDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDD 211

Query: 248 NAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXX 307
             G+ V AY++DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG  
Sbjct: 212 YLGQDVNAYIMDTGIFSDHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAA 270

Query: 308 XXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXX 367
                     L  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S    
Sbjct: 271 KKVNLVEVKVLGKDGSGEASNVLSGLEFIV-EHCTRVSRPQGKKCVANLSLGSFRSPIIN 329

Query: 368 XXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDI 426
                            GN N DA   SPAS++  ITV A     D  A FSNWG CV+I
Sbjct: 330 MAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNI 389

Query: 427 FAPGLNI--LSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPE 484
           FAPG+ I  LS     DT +  LSGTSM++P V G+ A  LS              I P 
Sbjct: 390 FAPGVEIESLSHLNYEDTLI--LSGTSMSTPIVTGVAAVLLS------------KGIEPA 435

Query: 485 ALKKKIVAYGSKNLLNN----VPARTANNLIFNGGGGSLDSFWNSKCDGCEQEKVSSSHG 540
            + ++I    ++N+ +         TAN +++NG     D + +        E ++    
Sbjct: 436 LIAQEIEYLSTRNVFHRRTLFFKPSTANQILYNGVDKLDDPYNDETFPRLNIEAIAKELE 495

Query: 541 KADDFESESLMDCLHSTSHSL---------FGEIRNFLDRLDLI 575
           + +      + D LHS S             GEIR  L R D I
Sbjct: 496 EYNATLQNPMADGLHSGSKLWGWNNDVTLPLGEIR--LKRRDFI 537

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  160 bits (405), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 127/376 (33%), Positives = 173/376 (46%), Gaps = 40/376 (10%)

Query: 213 ASDFETQTGAPWGLARVSHRERL-----NLGSFNK---YLYDDN-AGKGVTAYVIDTGIN 263
            S F+ Q GAP  LAR+S R++L     N   F +   Y YDDN  G+GV AYVIDTGI 
Sbjct: 281 KSKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGIL 340

Query: 264 IDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGT 323
            +H +FE R ++G  +    A  D NGHGTH AG I SKTYG            +   G+
Sbjct: 341 KEHKDFEDRVEFGTDLTGEGAG-DLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGS 399

Query: 324 GTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXX 383
             +S ++  +EY V +    +   + K    NMSLG                        
Sbjct: 400 TQLSHIIEAIEYTVND---CNSRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVA 456

Query: 384 XGNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIG 439
            GN N DAC +SP SSK  ITV A    DDR    A FSNWG CVDIFA G+ + S    
Sbjct: 457 AGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQ 513

Query: 440 SDTAVATLSGTSMASPHVAGLLAYFLS--LQPDSGSEYYTGSSISPEALKKKIVAYGSKN 497
                   SGTSMASP V G ++  LS  ++P+   E     S   +  ++ ++      
Sbjct: 514 VPYKYIKYSGTSMASPIVCGFVSILLSQGVKPNDVQEEMVKLSTKGDFTRRSLI------ 567

Query: 498 LLNNVPARTANNLIFNGGGGSLDSFWNSKCDG-C----EQEKVSSSHGKADDFESESLMD 552
                   T+N ++FNG     DS+ N + +  C    E+E +  +  K      +S   
Sbjct: 568 ----FKPFTSNRILFNGMDPR-DSYENDEMENDCGEDYEEEIIDRNSNKL--LMEKSSKL 620

Query: 553 CLHSTSHSLFGEIRNF 568
            L      ++ +IRNF
Sbjct: 621 VLDLDLDLIYEDIRNF 636

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  156 bits (394), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 129/393 (32%), Positives = 178/393 (45%), Gaps = 62/393 (15%)

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLI---------EQDS-------- 209
           ++  IE+ F I GS RG     +  +++ +++S LV  I         E DS        
Sbjct: 45  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDSARDVEYNY 103

Query: 210 ------------IVHASDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDN 248
                       +    +   Q+ AP  LAR+S   +L             FN Y  DD 
Sbjct: 104 TFNATAKYSYENLDEEQNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDY 163

Query: 249 AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXX 308
            G+ V AY++DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG   
Sbjct: 164 QGQDVNAYIMDTGIFADHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAK 222

Query: 309 XXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXX 368
                    L  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S     
Sbjct: 223 KVNLVEVKVLGKDGSGEASNVLSGLEFIV-EHCTRVSRPQGKKCVANLSLGSFRSPIINM 281

Query: 369 XXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIF 427
                           GN N DA   SPAS++  ITV A     D  A FSNWG CV+IF
Sbjct: 282 AVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIF 341

Query: 428 APGLNI--LSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEA 485
           APG+ I  LS    +DT V  LSGTSM++P V G+ A  LS              I PE 
Sbjct: 342 APGVEIESLSHLNFNDTLV--LSGTSMSTPIVTGVAAVLLS------------KGIEPEM 387

Query: 486 LKKKIVAYGSKNLLNN----VPARTANNLIFNG 514
           + +++    ++N+ +         T N +++NG
Sbjct: 388 IAQELEYLSTRNVFHRRTLFFKPSTPNQILYNG 420

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  154 bits (390), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 129/393 (32%), Positives = 177/393 (45%), Gaps = 62/393 (15%)

Query: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLI---------EQDSIVHA---- 213
           ++  IE+ F I GS RG     +  +++ +++S LV  I         E DS+  A    
Sbjct: 45  IDNKIEKKFSI-GSFRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSY 103

Query: 214 ----------------SDFETQTGAPWGLARVSHRERLNL---------GSFNKYLYDDN 248
                            +   Q  AP  LAR+S   +L             FN Y   D 
Sbjct: 104 TFNATAKYSYEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDY 163

Query: 249 AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXX 308
            G+ V AY++DTGI  DH EFE R   G  + + +   D NGHGTH AG + SKTYG   
Sbjct: 164 QGQDVNAYIMDTGIFADHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAK 222

Query: 309 XXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXX 368
                    L  +G+G  S+VL G+E++V EH      P  K   AN+SLG  +S     
Sbjct: 223 RVNLVEVKVLGKDGSGEASNVLSGLEFIV-EHCTKVSRPQGKKCVANLSLGSFRSPIINM 281

Query: 369 XXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIF 427
                           GN N DA   SPAS++  ITV A     D  A FSNWG CV+IF
Sbjct: 282 AVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIF 341

Query: 428 APGLNI--LSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEA 485
           APG+ I  LS    +DT +  LSGTSM++P V G+ A  LS              I PE 
Sbjct: 342 APGVEIESLSHLNYNDTLI--LSGTSMSTPIVTGVAAILLS------------KGIEPEM 387

Query: 486 LKKKIVAYGSKNLLNN----VPARTANNLIFNG 514
           + ++I    ++N+ +         T N +++NG
Sbjct: 388 IAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNG 420

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  154 bits (390), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/264 (38%), Positives = 130/264 (49%), Gaps = 22/264 (8%)

Query: 215 DFETQTGAPWGLARVSHRERLNLGSFN--------KYLYDDN-AGKGVTAYVIDTGINID 265
           DF  Q  AP  LAR+S R  L     N         Y YDD+  G  V AYVIDTGI  +
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 266 HVEFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGT 325
           H +F+GRA++G  +   +   D NGHGTH AG I S+ YG            L   G G 
Sbjct: 189 HRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 326 MSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXG 385
           ++ V+  +E+ V   RK+      +G  AN+SLG  ++                     G
Sbjct: 248 LTSVISAIEFTVNHCRKSK-----RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAG 302

Query: 386 NENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSD 441
           N N +AC +SPASS   I+V A    DDR    A FSNWG+CVD+FAPG+ I S      
Sbjct: 303 NSNANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPP 359

Query: 442 TAVATLSGTSMASPHVAGLLAYFL 465
                 SGTSMASP V G++A  L
Sbjct: 360 FKSVAYSGTSMASPLVTGMVAVLL 383

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  153 bits (386), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 101/260 (38%), Positives = 132/260 (50%), Gaps = 22/260 (8%)

Query: 219 QTGAPWGLARVSHR-------ERLNLGSFN-KYLYDDN-AGKGVTAYVIDTGINIDHVEF 269
           Q  AP  LAR+S R       E +++ + N  Y YDD  +G  V AYVIDTGI  +H + 
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 270 EGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDV 329
           EGRA++G  +   +   D NGHGTH AG I S+ +G            L   G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 330 LRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQ 389
           +  +E+ V   RK+      +G  AN+SLG  ++                     GN N 
Sbjct: 254 ISAIEFTVNHCRKSR-----RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSNA 308

Query: 390 DACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSDTAVA 445
           +AC +SPASS   ITV A    DDR    A FSNWG+CVDIFAPG+ I S          
Sbjct: 309 NACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKPV 365

Query: 446 TLSGTSMASPHVAGLLAYFL 465
             SGTSMASP V+G++A  L
Sbjct: 366 AFSGTSMASPIVSGMVANLL 385

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  151 bits (381), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 120/329 (36%), Positives = 163/329 (49%), Gaps = 48/329 (14%)

Query: 215 DFETQTGAPWGLARVSHRERLNL------GSFNKYLY-DDNAGKGVTAYVIDTGINIDHV 267
           DF +Q+ AP  LAR+S R +L +       S  KY Y +++ G+GV  YV+D+G+N DH 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 268 EFEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMS 327
           +FEGRA  G    + +   D  GHGTH AG I SKTYG            L + G GT++
Sbjct: 210 DFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVT 268

Query: 328 DVLRGVEYVV----AEHRKASGDPNFKGSTANMSLGG-GKSXXXXXXXXXXXXXXXXXXX 382
           +++ G+EYVV     + RK            NMSLG  G                     
Sbjct: 269 NIIEGLEYVVNQCIGKKRKC---------VINMSLGAPGTHSILDKAVSAVIEEGVVVVV 319

Query: 383 XXGNENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILS-TY 437
             GN   +AC  SPA  +K ITVAA    DDR    A FSNWG+C+DI+APG+N+ S + 
Sbjct: 320 AGGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLSN 376

Query: 438 IGSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKN 497
            G  T V  LSGTSMASP VAG  A +L    D G++        P  ++K +    ++ 
Sbjct: 377 KGRGTFV--LSGTSMASPIVAGAAAIYL----DQGAD--------PAEVRKILSKTATRG 422

Query: 498 LLNN----VPARTANNLIFNGGGGSLDSF 522
           +       V  RT N +++ G     D F
Sbjct: 423 VFKKRAIAVRPRTPNKVLYTGNNQEDDEF 451

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  150 bits (378), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 116/361 (32%), Positives = 160/361 (44%), Gaps = 44/361 (12%)

Query: 179 GSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASD------------FETQTGAPWGL 226
           G   G+   F    ++ ++++ LV  +  +S+ +  D            ++ Q  AP  L
Sbjct: 59  GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 227 ARVSHRERLNLGS-------FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGK-T 278
           AR+S R  L           FN Y    + G  V AY+IDTGI   H +  GRA +G   
Sbjct: 119 ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 279 IPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVA 338
           +     DY  NGHGTH AG + S+T+G            L   G G ++ V+  +E+ V 
Sbjct: 179 VGEGPGDY--NGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV- 235

Query: 339 EHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPAS 398
            H K SG        AN+SLG  ++                     GN N +AC  SPAS
Sbjct: 236 NHCKKSG----MLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPAS 291

Query: 399 SKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHV 457
           +   ITV A    +D  A FSNWG CVD+FA G+ ++S            SGTSMASP V
Sbjct: 292 AISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSV 351

Query: 458 AGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN----VPARTANNLIFN 513
           AGL A  L    DSG        I P  +K+KI+   ++N+           T N + FN
Sbjct: 352 AGLAAVLL----DSG--------IDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFN 399

Query: 514 G 514
           G
Sbjct: 400 G 400

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 111/310 (35%), Positives = 155/310 (50%), Gaps = 33/310 (10%)

Query: 219 QTGAPWGLARVSHRERLNLGS-------FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG 271
           Q+GAP  LAR   R  L   +       FN Y   ++ G+ V  Y++D+GI+  H EFEG
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 272 RAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLR 331
           RA +G    +N+   D NGHGTH AG + SKTYG            +  +G G+ S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 332 GVEYVVAEHRKASGDPNFKGSTANMSLGG---GKSXXXXXXXXXXXXXXXXXXXXXGNEN 388
           GVE+ V +H + SG    K   ANMSLGG   G S                     GN  
Sbjct: 389 GVEFAV-KHCQQSG----KKCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAA-GNSK 442

Query: 389 QDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATL 447
           + AC  SPA  K  ITV A    SD  A FSN+G CVDIFAPG+ + S        V  L
Sbjct: 443 ERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVRVL 502

Query: 448 SGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN---VPA 504
           +GTSM++P  AG++A  L    D G ++        E +K++++   +K + +    V +
Sbjct: 503 NGTSMSAPITAGVVAVLL----DQGVKH--------EDVKERLIDLSTKGVFHRRRLVSS 550

Query: 505 RTANNLIFNG 514
           RT +  +FNG
Sbjct: 551 RTPDRTLFNG 560

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  149 bits (375), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 155/325 (47%), Gaps = 33/325 (10%)

Query: 216 FETQTGAPWGLARVSHRERLNLG-------SFNKYLYDDNAGKGVTAYVIDTGINIDHVE 268
           +  Q  AP  LAR   R  L          +FN Y  +++ G+GV  YV+D+GI   H E
Sbjct: 425 YAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPE 484

Query: 269 FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSD 328
           F+GRA +G    + +   D NGHGTH AG + S+T+G            +  +G G+ S+
Sbjct: 485 FDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSN 543

Query: 329 VLRGVEYVVAEHRKASGDPNFKGSTANMSLGG---GKSXXXXXXXXXXXXXXXXXXXXXG 385
           ++ GVE+ V +H + SG    K   ANMSLGG   G S                     G
Sbjct: 544 IIAGVEFAV-KHCQQSG----KRCVANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAA-G 597

Query: 386 NENQDACNTSPASSKKCITVAA-STLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAV 444
           N  + AC  SPA  K  ITV A    SD  A FSN+G CVDIFAPG+ + S        +
Sbjct: 598 NSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTM 657

Query: 445 ATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN--- 501
             L+GTSM++P  AG++A  L    D G        I P  +K  +++  +K L +    
Sbjct: 658 RVLNGTSMSAPITAGVVAVLL----DQG--------IEPHEVKDHLLSISTKGLFHKRRL 705

Query: 502 VPARTANNLIFNGGGGSLDSFWNSK 526
           V +RT +  +F G     DSF   K
Sbjct: 706 VSSRTPDRALFTGVKREDDSFSTEK 730

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 150/317 (47%), Gaps = 43/317 (13%)

Query: 218 TQTGAPWGLARVSHRERLNL---------GSFNKYLYDDNAGKGVTAYVIDTGINIDHVE 268
            Q+ AP  LAR+S R++L            SFN Y   ++ G  V AY++D+G++ +  +
Sbjct: 118 VQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTD 177

Query: 269 FEGRAQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSD 328
           FEGR ++G    + D + D NGHGTH AG + SKTYG            L   G GT+  
Sbjct: 178 FEGRVEFGFDF-TGDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLIT 236

Query: 329 VLRGVEYVVA---EHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXG 385
           VL  +E+ V    EH +       K   AN+SLG  K+                     G
Sbjct: 237 VLSAIEFAVNDCHEHPE-------KRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAG 289

Query: 386 NENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNILSTYIGSD 441
           N N +AC TSPAS+++ ITV A    DDR    A FSNWG CVDI+APG+ + S      
Sbjct: 290 NFNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPM 346

Query: 442 TAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN 501
               + SGTSMASP V G +A  L    D G        I  + +K  ++   + ++   
Sbjct: 347 VKNISYSGTSMASPIVCGQVAILL----DKG--------IPNDDIKSTLIKMATDDVFQK 394

Query: 502 ----VPARTANNLIFNG 514
                   T N ++FNG
Sbjct: 395 RTLLFKPNTPNRVLFNG 411

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  141 bits (356), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 145/318 (45%), Gaps = 40/318 (12%)

Query: 217 ETQTGAPWGLARVSHRERL--------NLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHV 267
           + Q GAP  L ++S R +L            F  Y YD    G     Y+IDTG+  +H 
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 268 EFEGRAQWG-KTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTM 326
           EF  R  +G   I     DY  NGHGTH AG I SKT+G            L   G G +
Sbjct: 208 EFGNRVHFGGDFIGEGKGDY--NGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNL 265

Query: 327 SDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGN 386
           + VL G+E+ V  + K    P  K    NMSLG  ++                     GN
Sbjct: 266 TSVLEGIEFAV-NNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGN 324

Query: 387 ENQDACNTSPASSKKCITVAASTLSDDR----AYFSNWGSCVDIFAPGLNI--LSTYIGS 440
            N  AC TSPASS   ITV A    DDR    A FSNWG CVDIFAPG+ I  LS  +  
Sbjct: 325 NNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLE 381

Query: 441 DTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLN 500
           +  +   SGTSMASP VAGL+A  +                  + +K+K++   SK++ +
Sbjct: 382 NGVIH--SGTSMASPIVAGLVAILME------------KGYKCDEIKQKLIDDSSKSIFS 427

Query: 501 NVPAR----TANNLIFNG 514
            +       T N +I+NG
Sbjct: 428 KLTLFFKYGTPNRVIYNG 445

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  128 bits (322), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 139/297 (46%), Gaps = 10/297 (3%)

Query: 175 FEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRER 234
             +  S R  +G F   +L+ +   G +  +  D I+  +++  Q  AP  LAR+S +  
Sbjct: 49  ISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKST 108

Query: 235 LNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY-DGNGHGT 293
           L  GS   Y+Y  N G GV  Y++DTGI+  H E EGR Q    + SN   + D +GHGT
Sbjct: 109 LR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGT 167

Query: 294 HCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGST 353
             AG I S T+G              + G  T+  V+R +     EH         + S 
Sbjct: 168 AVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRAL-----EHASKLASVTQRPSV 222

Query: 354 ANMSLGGGKSXXXXXXXXXXXX-XXXXXXXXXGNENQDACNTSPASSKKCITVAA--STL 410
             +     K+                      GN NQ+AC++SPAS+   +T+ +   T 
Sbjct: 223 VVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTK 282

Query: 411 SDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSL 467
            D  A F+N+G C+D FA G+NI S   G   +    SGTS+++   +G++AY++SL
Sbjct: 283 GDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  124 bits (312), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 101/317 (31%), Positives = 137/317 (43%), Gaps = 28/317 (8%)

Query: 216 FETQTGAPWGLARVSHRERLNLGS---FNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGR 272
           + TQ  AP  L+R S   +L   S   +N Y   D  G  VT YV+D+GI +DH EFEGR
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 273 AQWGKTIPSNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRG 332
                    +    D  GHGT  AG I SKTYG            L   G G +  +L+G
Sbjct: 202 ILEAYDFTDSGVG-DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQG 260

Query: 333 VEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDAC 392
           ++++  +H + + + N      N SLG                         GN   +AC
Sbjct: 261 LQFI-TKHCEENTNGN---CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVNAC 316

Query: 393 NTSPASSKKCITVAASTLSDDR-AYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTS 451
             +PA SK   TV +    DD  A FSNWG CVD+ APG+ + +    +       SGTS
Sbjct: 317 WITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSGTS 376

Query: 452 MASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNN-----VPART 506
           +++P V GL A  LS              +  E L  +I   GS++LL N     +P   
Sbjct: 377 VSTPIVTGLAAILLS------------KGVPKENLYDEIRKMGSRDLLRNKEFSRLPG-- 422

Query: 507 ANNLIFNGGGGSLDSFW 523
             NLI N G    D  +
Sbjct: 423 TPNLIVNIGPQKEDDVY 439

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  118 bits (295), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 89/311 (28%), Positives = 147/311 (47%), Gaps = 13/311 (4%)

Query: 164 ARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAP 223
           A +V GG      +  S R  +G F   +L+    SG +  +  D  +  +++  Q  AP
Sbjct: 38  AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAP 97

Query: 224 WGLARVSHRERLNLGSFN---KYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIP 280
             LAR+S +  L  G+ +    Y+Y  NAG GV  Y++DTGI+  H  FEGR Q      
Sbjct: 98  NHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFS 157

Query: 281 SND-ADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAE 339
           S+  A  D +GHGT  AG I S  +G              + G  ++  VLR +E+  ++
Sbjct: 158 SDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEH-ASK 216

Query: 340 HRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASS 399
               +  P+       M      +                     GNEN+ AC+ SPA +
Sbjct: 217 LAAVTKRPSLITIPLEMPR---NTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGA 273

Query: 400 KKCITVAASTLS--DDRAYFSNWGSCVDIFAPGLNILSTYIGSD-TAVATLSGTSMASPH 456
              +T+ +  ++  D  A F+N+  CVD+F  G+++ +  +G D ++   LSGTS+++  
Sbjct: 274 YGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGV 331

Query: 457 VAGLLAYFLSL 467
            +GL+AY++S+
Sbjct: 332 ASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  102 bits (254), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 139/306 (45%), Gaps = 22/306 (7%)

Query: 177 IAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSH---RE 233
           I     G+ G F D ++  +     V  I  D +++  ++  Q  AP  LAR+S+     
Sbjct: 57  IGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNS 116

Query: 234 RLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY---DGNG 290
           R++  + N +++  +AG GV  Y++D+GI+  H  F  R    K I   D      D +G
Sbjct: 117 RVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHG 175

Query: 291 HGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGT-MSDVLRGVEYVVAEHRKASGDPNF 349
           HGT  AG + S T+G            +     G  +S +L+ +E+ +  H +A+  P  
Sbjct: 176 HGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRATMRP-- 232

Query: 350 KGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCITVAAST 409
             S A +     K+                     GN++  ACN SPAS++   ++ +  
Sbjct: 233 --SVAVLPFSMSKN-AILNSAIESMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVG 289

Query: 410 LSDDR-----AYFSNWGSCVDIFAPGLNI--LSTYIGSD-TAVATLSGTSMASPHVAGLL 461
             D R     A FSN+G CVD+F  G+ +  L     SD   ++ +SGTSM+    AG +
Sbjct: 290 SLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTV 349

Query: 462 AYFLSL 467
            Y++SL
Sbjct: 350 GYYMSL 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 134/307 (43%), Gaps = 31/307 (10%)

Query: 173 EMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHR 232
           EM  +    +   G F+   L+ +     V  I +D  +   +++ Q G+P  L+++S  
Sbjct: 45  EMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS-- 102

Query: 233 ERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY------ 286
              + GSF    +D  +G  V  YV DTGI+  H   +         P   AD+      
Sbjct: 103 ---SGGSFT---FDPVSGNLVDVYVFDTGIDFKHPGLQ------NVNPHKLADFTSSPVP 150

Query: 287 ---DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKA 343
              D +GHGT  AG IAS+T+G               +G   +S +++G+   VA H + 
Sbjct: 151 RGADPHGHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASVA-HARF 209

Query: 344 SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKKCI 403
           +  P    S   + +  GK                      GN+  DAC+ SP +    +
Sbjct: 210 TKRP----SVFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNIL 265

Query: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNIL---STYIGSDTAVATLSGTSMASPHVAGL 460
            + +    +  A FSN+G+CVD++  G +IL   ST  G++  + + +GTS +    AG+
Sbjct: 266 VIGSLDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGI 325

Query: 461 LAYFLSL 467
           + Y +S+
Sbjct: 326 VGYHMSM 332

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 134/314 (42%), Gaps = 28/314 (8%)

Query: 171 IEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVS 230
           I ++FE+ GS R + G F+  +L  +     V  I +D  +   +   Q  AP  L  +S
Sbjct: 45  ITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 231 HRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEG-----RAQWGKT-IPSNDA 284
               L   S   ++Y  N G GV  Y++DTGI+I H           A   ++ +P    
Sbjct: 104 SISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGT- 159

Query: 285 DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGTGTMSDVLRGVEYVVAEHRKAS 344
             D  GHGT  AG IAS+T+G              +NG   +S +L+ +  +   H + +
Sbjct: 160 --DPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALT-LTQRHIEGT 216

Query: 345 GDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPAS----SK 400
             P+       +  G                         GN  QDA N SPA+     K
Sbjct: 217 KRPSVVVIPLEVEDGNNP---ILTEAIASFDQSVPIIIPAGNNAQDALNFSPANVNPKPK 273

Query: 401 KCITVAASTLSDDRAYFSNWGSCVDIFAPGLNI-------LSTYIGSDTAVATLSGTSMA 453
             I V +  ++++   F+N+GS VD+F  G  I       L +   S++    +SGTS +
Sbjct: 274 NIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSAS 333

Query: 454 SPHVAGLLAYFLSL 467
           S   AG++ Y++SL
Sbjct: 334 SAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 135/314 (42%), Gaps = 33/314 (10%)

Query: 175 FEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSHRER 234
            EI  S   + G  +   +  + E      I  +  +    +  QT AP  L R++ ++ 
Sbjct: 53  IEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDS 111

Query: 235 LNLGSF----NKYLYDDNAGKGVTAYVIDTGINIDH-VEFEGRAQ-----WGKTIPSNDA 284
           +    +    N+Y++ D +G GV  Y++DTGI+I H +  +             IPS D 
Sbjct: 112 IKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSGDF 171

Query: 285 DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRTNGT-GTMSDVLRGVEYVVAEHRKA 343
               NGHGT  AG I S  +G            +  N    TMS VL  +  ++ +H + 
Sbjct: 172 ----NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALS-LIEKHEQK 226

Query: 344 SGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXXXXXXXGNENQDACNTSPASSKK-- 401
           +  P    S   +     K+                     GN++Q+AC  SP   KK  
Sbjct: 227 TMRP----SIIVLPFQTEKN-TILESAIENISKKIPVIIPAGNKHQNACKLSPMGIKKLS 281

Query: 402 -CITVAASTLSDDRAY-----FSNWGSCVDIFAPGLNILSTYIGSD---TAVATLSGTSM 452
             + V +   S+++ Y     FSN+GSCVDI+  G++I +    S+     +  ++GTS 
Sbjct: 282 NVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSY 341

Query: 453 ASPHVAGLLAYFLS 466
           +   VAG++ Y++S
Sbjct: 342 SCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 126/313 (40%), Gaps = 29/313 (9%)

Query: 202 VKLIEQDSIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTG 261
           +  I  D  +   +   Q  AP  L ++   E       N+++YD  AG GV  Y+ DTG
Sbjct: 80  IAAISIDRQLEPQEMIVQKDAPRHLTKLLETE----AGDNEFVYDSTAGNGVDIYIFDTG 135

Query: 262 INIDHVEFEG-RAQWGKTIPSNDA-DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLR 319
           I  +       R      +P     D +   HGT  +G I S  +G              
Sbjct: 136 IARNSPGLSASRIHDMPGMPGPPIRDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGD 195

Query: 320 TNGTGTMSDVLRGVEYVVAEHRKASGDPNFKGSTANMSLGGGKSXXXXXXXXXXXXXXXX 379
            NG   MS VL+G+  +V +H K +  P    S  N S    K+                
Sbjct: 196 ENGKVFMSKVLKGLN-LVQQHVKHTNRP----SVINFSYCTLKNAILNSAFDNFPRDVPI 250

Query: 380 XXXXXGNENQDACNTSPASSKKCITVAA--STLSDDRAY----FSNWGSCVDIFAPGLNI 433
                GN  Q  C+ SP   ++  ++ A  S L +D       FSN+GSCV  +APG  +
Sbjct: 251 AVAA-GNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGL 309

Query: 434 LSTYI------GSDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALK 487
           L+  I       S   V  +SGTS +S   AG++ Y+++ Q   G E      I    ++
Sbjct: 310 LTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA-QGIPGEEVVDSLRI----VQ 364

Query: 488 KKIVAYGSKNLLN 500
             + +YG  N +N
Sbjct: 365 PNLTSYGKNNGIN 377

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 48/114 (42%), Gaps = 14/114 (12%)

Query: 196 IRESGLVKLIEQDSIVHASD--FETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGV 253
           I +S +  +++    +H SD  F  Q    W L   +     N  +  +  Y++  G G+
Sbjct: 141 IIDSSMEPIVQAQKQLHISDPSFPKQ----WHLINAAFPG--NDVNVKQLWYENVTGTGI 194

Query: 254 TAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGTIAS 301
            A ++D G++ D+         EG   +    P        + HGT CAG IA+
Sbjct: 195 VAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRCAGEIAA 248

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 245 YDDNAGKGVTAYVIDTGINIDHVEF------EGRAQWGKTIPSNDADYDGNGHGTHCAGT 298
           Y++  G GV A ++D G++ ++ +       EG   +    P        + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 299 IAS 301
           IA+
Sbjct: 245 IAA 247

>TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.261
           YKR024C
          Length = 715

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 137 HMETIAQLDPGHSFFDATEGMHHEGISARSVEGGIEEMFEIAGSLRGYFG 186
           H+ T+ ++DP    F   + +H  G +AR+ +GG   +F + G   GY G
Sbjct: 515 HVGTVLEVDPP---FSTEDHLHRVGRTARAGQGGEALLFLLPGEEEGYLG 561

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 14/71 (19%)

Query: 242 KYLYDDNAGKGVTAYVIDTGINIDHVE----FEGRAQW------GKTIPSNDADYDGNGH 291
           K  Y++  G GV A ++D G++ ++ +    F     W          P    DY    H
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----H 213

Query: 292 GTHCAGTIASK 302
           GT CAG IA+K
Sbjct: 214 GTRCAGEIAAK 224

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 22/116 (18%)

Query: 198 ESGLVKLIEQDSIVHASD--FETQTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTA 255
           +S  + + E +  +H  D  FE Q    W L   + +   N  +     Y +  GKGV A
Sbjct: 109 DSSFIPIKEAEERLHIDDPLFEKQ----WHLINPAFKG--NDVNVQDVWYQNITGKGVVA 162

Query: 256 YVIDTGINIDHVE----FEGRAQW------GKTIPSNDADYDGNGHGTHCAGTIAS 301
            V+D G++ ++ +    F     W          P+   DY    HGT CAG IA+
Sbjct: 163 AVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDY----HGTRCAGEIAA 214

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,365,777
Number of extensions: 2309474
Number of successful extensions: 5825
Number of sequences better than 10.0: 78
Number of HSP's gapped: 5714
Number of HSP's successfully gapped: 84
Length of query: 575
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 460
Effective length of database: 40,294,809
Effective search space: 18535612140
Effective search space used: 18535612140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)