Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30166.13ON48948926120.0
SAKL0E00946g6.13ON49348123160.0
Kwal_56.223626.13ON49347222650.0
KLTH0C11462g6.13ON49249122590.0
TDEL0G045806.13ON48447021970.0
ACR013C6.13ON48848721970.0
KLLA0D00902g6.13ON49248721840.0
Kpol_1032.46.13ON46746121210.0
CAGL0A01045g6.13ON48348120980.0
TPHA0J002706.13ON49647220750.0
NCAS0D026206.13ON49348120670.0
Kpol_1045.766.13ON48547720650.0
KNAG0E027506.13ON49847220470.0
YPL262W (FUM1)6.13ON48846420420.0
Skud_16.166.13ON48846420330.0
Smik_6.4706.13ON48846420320.0
ZYRO0C07964g6.13ON50548320220.0
Suva_16.436.13ON48846420190.0
KAFR0B065206.13ON49546820180.0
NDAI0I024706.13ON47546019360.0
TBLA0G010006.13ON46546119210.0
TBLA0A071306.13ON50046219130.0
Smik_8.831.354ON4632401232e-06
Suva_15.2011.354ON4632401214e-06
KLLA0A08404g1.354ON4612101196e-06
Skud_8.701.354ON4632401188e-06
YHR018C (ARG4)1.354ON4632401171e-05
NDAI0G059401.354ON4622401162e-05
NCAS0A090101.354ON4622401143e-05
Kpol_1018.1251.354ON4602581124e-05
SAKL0D09746g1.354ON4642471125e-05
CAGL0I08987g1.354ON4612771116e-05
ZYRO0G00748g1.354ON4622401072e-04
Ecym_27491.354ON4702431053e-04
KNAG0I015601.354ON4622181035e-04
TDEL0D022201.354ON4652451036e-04
KAFR0A009501.354ON4642181010.001
TPHA0A021901.354ON4632421000.001
TBLA0F034801.354ON466247990.002
KLTH0G19338g1.354ON465259980.002
Kwal_27.127821.354ON465262980.002
AEL019W1.354ON469218880.037
CAGL0B02794g4.197ON482182860.053
YLR359W (ADE13)4.197ON482190860.055
Suva_10.4594.197ON482185850.072
Smik_12.4464.197ON482190850.074
TPHA0B010404.197ON482182850.077
Kpol_1042.164.197ON482185830.14
NDAI0J019504.197ON482187830.15
NCAS0J012004.197ON482185820.18
KLLA0B13189g4.197ON482188810.28
Kwal_47.180664.197ON482179800.31
ZYRO0B07964g4.197ON482185800.32
KNAG0D034804.117ON116272810.32
KNAG0B058404.197ON482185800.36
Skud_12.4434.197ON482190800.36
Ecym_24524.197ON482184790.48
TBLA0A083204.197ON482210760.86
SAKL0B04972g4.197ON482185761.1
KAFR0A062304.197ON482182751.5
TDEL0D039003.234ON20848685.5
Suva_4.4946.148ON85092706.4
KLLA0C18975gna 1ON1286140697.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3016
         (489 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...  1010   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   896   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   877   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   874   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   850   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   850   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   845   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   821   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   812   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   803   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   800   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   800   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   793   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   791   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   787   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   787   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   783   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   782   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   781   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   750   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   744   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   741   0.0  
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    52   2e-06
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    51   4e-06
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    50   6e-06
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    50   8e-06
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    50   1e-05
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    49   2e-05
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    49   3e-05
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    48   4e-05
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    48   5e-05
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    47   6e-05
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    46   2e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    45   3e-04
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    44   5e-04
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    44   6e-04
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    44   0.001
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    43   0.001
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    43   0.002
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    42   0.002
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    42   0.002
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    39   0.037
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    38   0.053
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    38   0.055
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    37   0.072
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    37   0.074
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    37   0.077
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    37   0.14 
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    37   0.15 
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    36   0.18 
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    36   0.28 
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    35   0.31 
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    35   0.32 
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    36   0.32 
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    35   0.36 
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    35   0.36 
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    35   0.48 
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    34   0.86 
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    34   1.1  
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    33   1.5  
TDEL0D03900 Chr4 (713519..714145) [627 bp, 208 aa] {ON} Anc_3.23...    31   5.5  
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    32   6.4  
KLLA0C18975g Chr3 complement(1684573..1688433) [3861 bp, 1286 aa...    31   7.6  

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/489 (100%), Positives = 489/489 (100%)

Query: 1   MFSASKKIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIG 60
           MFSASKKIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIG
Sbjct: 1   MFSASKKIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIG 60

Query: 61  GPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVF 120
           GPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVF
Sbjct: 61  GPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTE 180
           QTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTE
Sbjct: 121 QTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTE 180

Query: 181 ITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRV 240
           ITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRV
Sbjct: 181 ITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRV 240

Query: 241 EQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVV 300
           EQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVV
Sbjct: 241 EQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVV 300

Query: 301 ECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 360
           ECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ
Sbjct: 301 ECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 360

Query: 361 ACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANE 420
           ACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANE
Sbjct: 361 ACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANE 420

Query: 421 DKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVV 480
           DKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVV
Sbjct: 421 DKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVV 480

Query: 481 PEKMIGPTK 489
           PEKMIGPTK
Sbjct: 481 PEKMIGPTK 489

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/481 (88%), Positives = 460/481 (95%), Gaps = 3/481 (0%)

Query: 8   IPAKRIADRMMSTTAGL-NQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERM 66
           +P+  I  RM+ST++ L  QK+RIETDAFGEIKVPA+KYWGAQTQRS ENFKIGG RERM
Sbjct: 13  LPSSSI--RMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERM 70

Query: 67  PEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGT 126
           PE +++AFG+LKKSAAIVNESLGTLDP+ISKPIQ+AADEVI+GKL+DHFPLVVFQTGSGT
Sbjct: 71  PEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGT 130

Query: 127 QSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLL 186
           QSNMNANEVISNRAIE+IGGE G+KQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEIT++LL
Sbjct: 131 QSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLL 190

Query: 187 PELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHH 246
           PELTALRDSFQKK++EFS IVKIGRTHLQDATPLTLGQEF GY QQ+TNGI RVEQSLHH
Sbjct: 191 PELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHH 250

Query: 247 LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGAL 306
           LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKET I+FKTAPNKFEALAAHDAVVECSGAL
Sbjct: 251 LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGAL 310

Query: 307 NTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVM 366
           NT+ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVM
Sbjct: 311 NTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVM 370

Query: 367 GNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKI 426
           GNN+ ITFAGASGQFELNVFKPVMISNLL+S+RLLADASYSFRVHCVDGIKANED+I+K+
Sbjct: 371 GNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKL 430

Query: 427 LHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIG 486
           LHESLMLVTALNPKIGYD+A KVAKNAHKK ITLKESAL+LGVL+E+EF EWV+PEKMIG
Sbjct: 431 LHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIG 490

Query: 487 P 487
           P
Sbjct: 491 P 491

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/472 (87%), Positives = 444/472 (94%)

Query: 16  RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFG 75
           R++ST++ L QK+R+ETDAFGEIKVP +K WGAQTQRSLENFKIGG RERMPEPI+KAFG
Sbjct: 20  RLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFG 79

Query: 76  ILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEV 135
           ILKKSAAIVNESLGTLDPK+SKPIQ AADEVI GKL+DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 80  ILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEV 139

Query: 136 ISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDS 195
           ISNRAI+L+GGE+G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T+ LLPEL ALRD+
Sbjct: 140 ISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDA 199

Query: 196 FQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGT 255
           F KK +EF  IVKIGRTHLQDATPLTLGQEF GY QQ+TNGI+RVE SLH+LKFLAQGGT
Sbjct: 200 FAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGT 259

Query: 256 AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFK 315
           AVGTGLNTKVGFAEKIAEQVSKET I+FKTAPNKFEALAAHDAVVECSGALNT+ACSLFK
Sbjct: 260 AVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFK 319

Query: 316 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFA 375
           IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ ITFA
Sbjct: 320 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 379

Query: 376 GASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVT 435
           GASGQFELNVFKPVMISNLL+SIRLL DA YSFRVHCV+GI+ANEDKIAK+LHESLMLVT
Sbjct: 380 GASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVT 439

Query: 436 ALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           ALNPKIGYD+A KVAKNAHKK ITLKESALELGVLS  EF EWVVPE M+GP
Sbjct: 440 ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/491 (84%), Positives = 453/491 (92%), Gaps = 4/491 (0%)

Query: 1   MFSASKKIPAKRIA----DRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLEN 56
           MF  + ++  K ++     R++ST++ ++QK R+ETDAFGEI VPA+KYWGAQTQRSLEN
Sbjct: 1   MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLEN 60

Query: 57  FKIGGPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFP 116
           FKIGG RERMPEP+++AFGILKKSAAIVNESLGTLDPKISKPIQQAADEVI GKL+DHFP
Sbjct: 61  FKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFP 120

Query: 117 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIA 176
           LVVFQTGSGTQSNMNANEVISNRAIE++GG++GTK IHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 177 AVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNG 236
           AVTEIT++LLPELTALRDSF  K++EF  IVKIGRTHLQDATPLTLGQEF GY QQ+TNG
Sbjct: 181 AVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 237 ITRVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAH 296
           I+RVEQSL HLKFLAQGGTAVGTGLNTKVGF EKIAEQVSKET I+FKTAPNKFEALAAH
Sbjct: 241 ISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 297 DAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 356
           DA+VECSGALNT+ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 357 AMTQACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGI 416
           AMTQ CVQVMGNN+ ITFAGASGQFELNVFKPVMISNLL+S+RLL DA YSFRVHCVDGI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGI 420

Query: 417 KANEDKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFS 476
           +AN DKIAK+LHESLMLVTALNPKIGYD+A KVAKNAHKK ITLKESALEL VL+  EF 
Sbjct: 421 EANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFD 480

Query: 477 EWVVPEKMIGP 487
           +WVVPE M+GP
Sbjct: 481 QWVVPENMVGP 491

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/470 (85%), Positives = 436/470 (92%), Gaps = 3/470 (0%)

Query: 18  MSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGIL 77
           MST AG   +FR+ETDAFGEIKV A++YWGAQTQRSLENF+IGGPRERMPEPI++AFG+L
Sbjct: 16  MSTKAG---QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVL 72

Query: 78  KKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVIS 137
           KKSAA+VNESLGTLDPK+++PI+QAADEV +GKL  HFPLVVFQTGSGTQSNMNANEVIS
Sbjct: 73  KKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVIS 132

Query: 138 NRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQ 197
           NRAIELIGGELG+KQIHPNNHCNQAQSSNDTFPSVMHIAAVTEIT  LLPEL  LRDS  
Sbjct: 133 NRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLD 192

Query: 198 KKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAV 257
            K++EFS IVKIGRTHLQDATPLTLGQEF GY QQ++NGI RVE SLH LK+LAQGGTAV
Sbjct: 193 AKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAV 252

Query: 258 GTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIA 317
           GTGLNTK+GFAEKIAEQVSKET ++FKTAPNKFEALAAHDAVVE SGALNTVACSLFKIA
Sbjct: 253 GTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIA 312

Query: 318 NDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGA 377
            DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFAGA
Sbjct: 313 QDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGA 372

Query: 378 SGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTAL 437
           SGQFELNVFKPVMISNLL+S+RLLADASYSFRVHCVDGI AN D+I K++HESLMLVTAL
Sbjct: 373 SGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTAL 432

Query: 438 NPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           NPKIGYD+A KVAKNAHKK ITLK+SAL+LGVL+E EF EWVVPE MIGP
Sbjct: 433 NPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/487 (81%), Positives = 445/487 (91%), Gaps = 1/487 (0%)

Query: 1   MFSASKKIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIG 60
           M   S+       A R+MST AG  Q+FR+ETDAFGEI+VPA+KYWGAQTQRSLENF+IG
Sbjct: 1   MLRLSRGCVGSSAARRLMST-AGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIG 59

Query: 61  GPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVF 120
           G RERMPEP+++AFG+LKKSAA+VNE LGTL+P I+K IQQAADEV +G+L++HFPLVVF
Sbjct: 60  GARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVF 119

Query: 121 QTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTE 180
           QTGSGTQSNMNANEVISNRAIEL+GGELG+KQ+HPNNHCNQAQSSNDTFPSVMHIAAVTE
Sbjct: 120 QTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTE 179

Query: 181 ITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRV 240
           IT +LLPEL ALR SFQ+KT+EF+HIVKIGRTHLQDATPLTLGQEF GYTQQI NGI RV
Sbjct: 180 ITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARV 239

Query: 241 EQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVV 300
           E +   L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ET +EF+TAPNKFEALAAHDAVV
Sbjct: 240 EHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVV 299

Query: 301 ECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 360
           E SGALNT+ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 300 EASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ 359

Query: 361 ACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANE 420
           ACVQVMGNN+ ITFAGASGQFELNVFKPVMI+NLL+S+RLLADA+ SFRVHCVDGI+ NE
Sbjct: 360 ACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNE 419

Query: 421 DKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVV 480
           D+IAK+LHESLMLVTALNPKIGYD+A  VAKNAHKK ITL+ SALELGVL++ EF EWVV
Sbjct: 420 DRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVV 479

Query: 481 PEKMIGP 487
           PEKMIGP
Sbjct: 480 PEKMIGP 486

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/487 (82%), Positives = 447/487 (91%), Gaps = 11/487 (2%)

Query: 4   ASKKIPAK--RIAD-RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIG 60
           A  ++ AK  R+A  RM+S        +R+ETDAFGEI+VP++KYWGAQTQRSL+NFKIG
Sbjct: 12  AQTRVSAKVNRLASLRMVS--------YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIG 63

Query: 61  GPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVF 120
           GPRERMPEPI+KAFG+LKKSAA+VNE LGTLDP+I+KPI+QAADEV +GKL++HFPLVVF
Sbjct: 64  GPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVF 123

Query: 121 QTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTE 180
           QTGSGTQSNMNANEVISNRAIELIGGELG+K+IHPNNHCNQAQSSNDTFPSVMHIAAVTE
Sbjct: 124 QTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTE 183

Query: 181 ITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRV 240
           IT+ LLPEL  L+ + ++K++EF HIVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV
Sbjct: 184 ITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARV 243

Query: 241 EQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVV 300
           +QSL+HLKFLAQGGTAVGTGLNTKVGFAE IAEQVSKET I+FKTAPNKFEALAAHDAVV
Sbjct: 244 KQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVV 303

Query: 301 ECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 360
           E SGALNT+A SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ
Sbjct: 304 EASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 363

Query: 361 ACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANE 420
            CVQVMGN++ ITFAGASGQFELNVFKPVMISNLL+SIRLL DAS SFR+HCV+GIKANE
Sbjct: 364 VCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANE 423

Query: 421 DKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVV 480
           D+IAK+LHESLMLVTALNPKIGYD+A KVAKNAHKK ITLKESALEL VLS EEF +WV+
Sbjct: 424 DRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQWVI 483

Query: 481 PEKMIGP 487
           PEKMIGP
Sbjct: 484 PEKMIGP 490

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/461 (84%), Positives = 425/461 (92%)

Query: 28  FRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNES 87
           FR+ETD FGEIKVPA+KYWGAQTQRS ENFKIGGPRERMPEP++KAFG+LKKSAAIVNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 88  LGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 147
            G LD  ISK IQQAADEVIEGKL +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 148 LGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIV 207
           +G+K+IHPNNHCN AQSSNDTFP+VMHIAAVTEIT+ L+P++T L+D+   K++EF HIV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 208 KIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGF 267
           KIGRTHLQDATPLTLGQEF GY QQ+ NGI R+E SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 268 AEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGP 327
           AE+IAEQVSKET IEFKTAPNKFEALAAHDA+VE SGALNTVACSLFKIA DIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 328 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNVFK 387
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ ITFAGASGQFELNVFK
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 388 PVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDSAC 447
           PVMISNLL+SIRLL DA +SF +HCV+GI+ANEDKI K+LHESLMLVTALNPKIGYDSA 
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 448 KVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPT 488
           KVAKNAHKK ITLKESALELGVL+E+EF EWVVPEKM+GP+
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/481 (80%), Positives = 428/481 (88%), Gaps = 3/481 (0%)

Query: 12  RIADRMMSTTAGLNQK---FRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPE 68
           R + R  ++  G + +   +R+ETD FGEIKVPA+KYWGAQTQRS +NFKIGG RERMPE
Sbjct: 3   RASSRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPE 62

Query: 69  PIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQS 128
           PI++AFG+LKKSAAIVNE LGTLD +I+ PIQQAADEV +GKL DHFPLVVFQTGSGTQS
Sbjct: 63  PIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQS 122

Query: 129 NMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPE 188
           NMNANEVISNRAIELIGGELG+K+IHPNNHCNQAQSSNDTFPSVMHIAAVTEITN+LLPE
Sbjct: 123 NMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPE 182

Query: 189 LTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLK 248
           +T L+D+  KK EEF  IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI R+E +L HLK
Sbjct: 183 ITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLK 242

Query: 249 FLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
           +LAQGGTAVGTGLNTK GF + IAEQ+SKET I+FKTAPNKFEALAAHDA+VE SGALNT
Sbjct: 243 YLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNT 302

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
           VACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGN
Sbjct: 303 VACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 362

Query: 369 NSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILH 428
           N+ +TFAGA+GQFELNVFKPVMISNLL+SIRLLADA +SFRVHCV+GI+AN +KI   LH
Sbjct: 363 NAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLH 422

Query: 429 ESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPT 488
            SLMLVTALNPKIGYD+A K+AKNA KKNITLKESALEL  L+ EEF EWV+PE M+GPT
Sbjct: 423 NSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGPT 482

Query: 489 K 489
           K
Sbjct: 483 K 483

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/472 (79%), Positives = 425/472 (90%), Gaps = 4/472 (0%)

Query: 16  RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFG 75
           R +S  AG    FRIETD FGEIKVPANKYWGAQT+RS ENF+IGGPRERMP+P++KAFG
Sbjct: 28  RCLSDEAG----FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFG 83

Query: 76  ILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEV 135
           +LKKSAAIVNE  GTLDP+ISK IQ+AADEVI+GKL DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 84  VLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEV 143

Query: 136 ISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDS 195
           ISNRAIEL+GG LG+KQ+HPNNH NQAQSSND+FP+VMHIAAVTEIT+ L+PE+  LRD+
Sbjct: 144 ISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDA 203

Query: 196 FQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGT 255
            + K+++F+HIVKIGRTHLQDATPLTLGQEF GY QQ+TNGI R+E SL +LKFLAQGGT
Sbjct: 204 LESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGT 263

Query: 256 AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFK 315
           AVGTGLNT++GFAEKIAEQ+SKET + FKTAPNKFEALAAHDA+VE SGA+ TVA SLFK
Sbjct: 264 AVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFK 323

Query: 316 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFA 375
           IA DIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQ C Q++GNN TI FA
Sbjct: 324 IAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFA 383

Query: 376 GASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVT 435
           G  GQFELNVFKPVMISNLL+SIRLL D S SFR+HCV+GIKANE++IA ++++SLMLVT
Sbjct: 384 GTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVT 443

Query: 436 ALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           ALNPKIGYD A KVAKNAHKK ITLKESA++LG L+E EF EWVVPEKMIGP
Sbjct: 444 ALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/481 (78%), Positives = 430/481 (89%), Gaps = 2/481 (0%)

Query: 7   KIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERM 66
           ++ A R++  + +TTA   Q++RIETD+FGEIKVPA+KYWGAQTQRS +NFKIGG RER+
Sbjct: 13  RLQASRMS--LSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERI 70

Query: 67  PEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGT 126
           P+PII AFGILKKSAAIVNESLGTLDPK++ PI++AADEV++GKL DHFPLVVFQTGSGT
Sbjct: 71  PDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGT 130

Query: 127 QSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLL 186
           Q+NMN NEVISNRAIEL+GG+LG+KQIHPNNHCNQ+QSSNDTFPSVMHIAAV EITN+L+
Sbjct: 131 QTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLI 190

Query: 187 PELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHH 246
           PELT L+D+   K +EF+ IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI R+E SL+H
Sbjct: 191 PELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYH 250

Query: 247 LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGAL 306
           LKFLAQGGTAVGTGLNTK+GF + IAE+VSKET IEFKTAPNKFEALAAHDA+V  SGAL
Sbjct: 251 LKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGAL 310

Query: 307 NTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVM 366
           NTVA SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQ CVQ+M
Sbjct: 311 NTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIM 370

Query: 367 GNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKI 426
           GNN TI+ AG+ GQFELNV+KP+MI+NLLNSIRL+ DA  SFR+HC+D +KAN+DKI + 
Sbjct: 371 GNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINEN 430

Query: 427 LHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIG 486
           L++SLMLVTALNPKIGYD+A K+AKNAH KNITLKESALEL  L+ EEF EWVVPE MIG
Sbjct: 431 LNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIG 490

Query: 487 P 487
           P
Sbjct: 491 P 491

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/477 (79%), Positives = 422/477 (88%), Gaps = 4/477 (0%)

Query: 12  RIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPII 71
           R+  R +S   G    FR+ETD FGEIKVPANKYWGAQT+RS ENFKIGG RERMPE ++
Sbjct: 12  RVQTRYISNLKG----FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVV 67

Query: 72  KAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMN 131
           +AFG+LKK AAIVN  LG LDP  SK IQQAADEV  GKL DHFPLVVFQTGSGTQSNMN
Sbjct: 68  RAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMN 127

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANEVISNRAIEL GG LG+K+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT 
Sbjct: 128 ANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTH 187

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           LRD+   K+ EF HIVKIGRTHLQDATPLTLGQEF GY QQ+TNGI R+E++  +L+FLA
Sbjct: 188 LRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLA 247

Query: 252 QGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVAC 311
           QGGTAVGTGLNTK G+AE+IA ++SKET + FKTAPNKFEALAAHDA+VE SGALNTVAC
Sbjct: 248 QGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVAC 307

Query: 312 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNST 371
           SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ 
Sbjct: 308 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 367

Query: 372 ITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESL 431
           +TFAGASGQFELNVFKPV+ISNLL+S++LL DAS SFRVHCV+GIKANE KI+++LH SL
Sbjct: 368 VTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSL 427

Query: 432 MLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPT 488
           MLVTALNPKIGYD+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPEKM+GP+
Sbjct: 428 MLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 484

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/472 (78%), Positives = 421/472 (89%)

Query: 16  RMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFG 75
           R MS +A  NQ+FR+ETD+FGEI VPA++YWGAQTQRS +NFKIGG RE++PEP+++AFG
Sbjct: 25  RNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFG 84

Query: 76  ILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEV 135
           ILKKSAA VNE+LGTLD  I+  I+ AADEV EGKL DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 85  ILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEV 144

Query: 136 ISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDS 195
           ISNRAIEL+GGELG+KQ+HPNNH NQ+QSSNDTFP+VMHIAA TEI N L+PEL  L+D+
Sbjct: 145 ISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDA 204

Query: 196 FQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGT 255
            Q K EEFS IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV+ SL+HL FLAQGGT
Sbjct: 205 LQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGT 264

Query: 256 AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFK 315
           AVGTGLNTKVGF + +AE+VSKET + F+TAPNKFEALAAHDA+VE SGALNT+ACSLFK
Sbjct: 265 AVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFK 324

Query: 316 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFA 375
           IA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQ CVQVMGNNSTITFA
Sbjct: 325 IAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFA 384

Query: 376 GASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVT 435
           G+ GQFELNV+KP+MISNLL+SIRLL DAS SFR+HC++ +KAN+DKI + L++SLMLVT
Sbjct: 385 GSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVT 444

Query: 436 ALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           ALNPKIGYD+A KVAKNAH KNITLKESALELGVL+E+EF EWV+PE MI P
Sbjct: 445 ALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISP 496

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/464 (80%), Positives = 416/464 (89%)

Query: 24  LNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAI 83
           +N  FR ETDAFGEI VPA+KYWGAQTQRS +NFKIGG RERMP P++ AFG+LKKSAAI
Sbjct: 24  MNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAI 83

Query: 84  VNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 143
           VNESLG LDPKISK IQQAADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 84  VNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143

Query: 144 IGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEF 203
           +GG++G+KQ+HPNNHCNQ+QSSNDTFP+VMHIAA  +I N L+PELT L+++ + K++EF
Sbjct: 144 LGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEF 203

Query: 204 SHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNT 263
            HIVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV  SL  L FLAQGGTAVGTGLNT
Sbjct: 204 DHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNT 263

Query: 264 KVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYL 323
           K GF  KIAEQ+SKET ++F+TAPNKFEALAAHDA+VECSGALNT+ACSLFKIA DIRYL
Sbjct: 264 KPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323

Query: 324 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFEL 383
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFAG+ GQFEL
Sbjct: 324 GSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFEL 383

Query: 384 NVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGY 443
           NVFKPVMI+NLLNSIRL+ DA+YSFRVHCV+GIKANE +I ++L +SLMLVTALNPKIGY
Sbjct: 384 NVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443

Query: 444 DSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           D+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPE M+GP
Sbjct: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGP 487

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/464 (79%), Positives = 416/464 (89%)

Query: 24  LNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAI 83
           +N  FRIETDAFGEI VPA+KYWGAQTQRS +NFKIGG RERMP P++ AFG+LKKSAA+
Sbjct: 24  MNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAV 83

Query: 84  VNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 143
           VNESLG LDPKISK IQQAADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 84  VNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143

Query: 144 IGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEF 203
           +GG++G+K++HPNNHCNQ+QSSNDTFP+VMHIAA  +I N L+PELT L+++ + K++EF
Sbjct: 144 LGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEF 203

Query: 204 SHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNT 263
            HIVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV  SL  L FLAQGGTAVGTGLNT
Sbjct: 204 EHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNT 263

Query: 264 KVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYL 323
           K GF  KIAEQ+S ET ++F+TAPNKFEALAAHDA+VECSGALNT+ACSLFKIA DIRYL
Sbjct: 264 KPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323

Query: 324 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFEL 383
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFAG+ GQFEL
Sbjct: 324 GSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFEL 383

Query: 384 NVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGY 443
           NVFKPVMI+NLLNSIRL+ D++YSFRVHCV+GIKANE +I ++L +SLMLVTALNPKIGY
Sbjct: 384 NVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443

Query: 444 DSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           D+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPE M+GP
Sbjct: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/464 (79%), Positives = 415/464 (89%)

Query: 24  LNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAI 83
           +N  FR ETDAFGEI VPA+KYWGAQTQRS +NFKIGG RERMP P++ AFG+LKKSAAI
Sbjct: 24  MNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAI 83

Query: 84  VNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 143
           VNESLG LDPKISK IQ+AADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 84  VNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143

Query: 144 IGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEF 203
           +GG++G+K++HPNNHCNQ+QSSNDTFP+VMHIAA  +I N L+PEL  L+++ + K++EF
Sbjct: 144 LGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEF 203

Query: 204 SHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNT 263
            HIVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV  SL  L FLAQGGTAVGTGLNT
Sbjct: 204 DHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNT 263

Query: 264 KVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYL 323
           K GF  KIAEQ+SKET ++F+TAPNKFEALAAHDA+VECSGALNT+ACSLFKIA DIRYL
Sbjct: 264 KPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323

Query: 324 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFEL 383
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFAG+ GQFEL
Sbjct: 324 GSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFEL 383

Query: 384 NVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGY 443
           NVFKPVMI+NLLNSIRL+ DA+YSFRVHCV+GIKANE +I ++L +SLMLVTALNPKIGY
Sbjct: 384 NVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443

Query: 444 DSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           D+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPE M+GP
Sbjct: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/483 (77%), Positives = 422/483 (87%), Gaps = 2/483 (0%)

Query: 5   SKKIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRE 64
           + K P  +I+ ++ +TT  L Q+ R+ETDAFGEIKVPA+KYWGAQTQRS ENF+IGG RE
Sbjct: 23  TSKTPMSQIS-QLHTTTPWL-QEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRE 80

Query: 65  RMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGS 124
           RMPE ++ AFGILKK+ A VNE+ G LDPK++  I+QAADEV  GKL DHFPLVVFQTGS
Sbjct: 81  RMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGS 140

Query: 125 GTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNT 184
           GTQSNMNANEVISNRAIEL+GG+LG+K +HPNNH N +QSSNDTFP+VMHIAAV  IT  
Sbjct: 141 GTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKD 200

Query: 185 LLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSL 244
           LLP LTAL+DS QKK+EEF+ IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RVE +L
Sbjct: 201 LLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTL 260

Query: 245 HHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSG 304
             LK LAQGGTAVGTGLNTK+G+AE +A +V+KET I+F+TAPNKFEALAAHDAVVE SG
Sbjct: 261 DSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASG 320

Query: 305 ALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQ 364
           ALNT+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQ
Sbjct: 321 ALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQ 380

Query: 365 VMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIA 424
           V GN+S ITFAGASGQFELNVFKPVMISNLL+SI LL+DASYSFRVHCVDGI+AN + IA
Sbjct: 381 VFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIA 440

Query: 425 KILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKM 484
           K+LHESLMLVTALNPKIGYD+A KVAKNAHK  ITLKESAL+L +L+ EEF  WVVPE M
Sbjct: 441 KLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHM 500

Query: 485 IGP 487
           IGP
Sbjct: 501 IGP 503

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/464 (79%), Positives = 413/464 (89%)

Query: 24  LNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAI 83
           +N  FR ETDAFGEI VPA+KYWGAQTQRS +NFKIGG RERMP P++ AFG+LKKSAAI
Sbjct: 24  MNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAI 83

Query: 84  VNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 143
           VNESLG LDPK+SK IQQAADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 84  VNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143

Query: 144 IGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEF 203
           +GG++G+KQ+HPNN CNQ+QSSNDTFP+VMHIAA  +I   L+PELT L+++ + K++EF
Sbjct: 144 LGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEF 203

Query: 204 SHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNT 263
            HIVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV  +L  L FLAQGGTAVGTGLNT
Sbjct: 204 EHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNT 263

Query: 264 KVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYL 323
           K GF  KIAEQ+SKET ++F+TAPNKFEALAAHDA+VECSGALNT+ACSLFKIA DIRYL
Sbjct: 264 KPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323

Query: 324 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFEL 383
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITF G+ GQFEL
Sbjct: 324 GSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFEL 383

Query: 384 NVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGY 443
           NVFKPVMI+NLLNSIRL+ADAS SFR+HCV+GIKANE +I ++L +SLMLVTALNPKIGY
Sbjct: 384 NVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443

Query: 444 DSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           D+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPE M+GP
Sbjct: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/468 (78%), Positives = 420/468 (89%)

Query: 20  TTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKK 79
           T + +   FR ETD+FGEI VP +KYWGAQTQRSL+NFKIGG RE++P PII+AFGILKK
Sbjct: 26  TMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKK 85

Query: 80  SAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNR 139
           SAAIVNE LGTLD +++K I  AADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNR
Sbjct: 86  SAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 145

Query: 140 AIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKK 199
           AIEL+GG+LG+K +HPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPEL +L++S  KK
Sbjct: 146 AIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKK 205

Query: 200 TEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGT 259
           + EF+ IVKIGRTHLQDATPLTLGQEF GY QQ+TNGI R+E +L+HLKFLAQGGTAVGT
Sbjct: 206 SNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGT 265

Query: 260 GLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIAND 319
           GLNTK GF + IAEQ+S+ET I F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIA D
Sbjct: 266 GLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQD 325

Query: 320 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASG 379
           IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ C+QVMGN+STITFAG+ G
Sbjct: 326 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQG 385

Query: 380 QFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNP 439
           QFELNV+KP++ISNLL+SIRLL DASYSFRVHC+DG+KAN + I + L++SLMLVTALNP
Sbjct: 386 QFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNP 445

Query: 440 KIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
            IGYD+A K+AKNAH KNITLKESALELG+L+EE+FSEWV+PEKMIGP
Sbjct: 446 YIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/460 (78%), Positives = 414/460 (90%)

Query: 28  FRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNES 87
           FR+ETD+FGEIKVP+NKYWGAQTQRS +NFKIGG RE++P PIIKAFGILKKSAAIVN+S
Sbjct: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73

Query: 88  LGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 147
           LGTLDP I+ PI +A+DEVI+GKL DHFPLVVFQTGSGTQ+NMNANEVISNRA ELIG E
Sbjct: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133

Query: 148 LGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIV 207
           LG+K+IHPNNH NQ+QSSNDTFPSVMHIAAV E+ N L+P+LT L++S   K +E+++IV
Sbjct: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193

Query: 208 KIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGF 267
           KIGRTHLQDATPLTLGQEF GY QQ+TNGI R++ SL+HLKFLAQGGTAVGTGLNTKVGF
Sbjct: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253

Query: 268 AEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGP 327
            + IA++VSKET I+F+TAPNKFEALAAHDA+V  S A+ TVA SLFKIA DIRYLGSGP
Sbjct: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313

Query: 328 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNVFK 387
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQ  +Q+MGNN TI  AG+ GQFELNV+K
Sbjct: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373

Query: 388 PVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDSAC 447
           P+MI+NLLNSIRL++DA +SF++HCVDG+KAN DKI + LH+SLMLVTALNPKIGYD+A 
Sbjct: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433

Query: 448 KVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           K+AKNAH KNITLKESALELG+L+EEEF +WV+PE MIGP
Sbjct: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/461 (75%), Positives = 405/461 (87%)

Query: 29  RIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNESL 88
           RIE D FGE++VPANKYWGAQTQR+L NF IGG RERMPEP+I A+GILKKS AIVNESL
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 89  GTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 148
           GTLDPKISK IQ+AADEV +G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIE++GG+L
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 149 GTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVK 208
           G+K +HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+ + K+ EF+ IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 209 IGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGFA 268
           IGRTHLQDATPLTLGQEF GY QQ+ NGITRV+ SL +LKF+AQGGTAVGTG+NTK  F 
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 269 EKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPR 328
             +A+Q+S ET IEFKTAPNKFEALA+HDA+VECSGALNT+ACSLFKI+ DIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 329 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNVFKP 388
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM QAC+QVMGNNS ITFAGASGQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 389 VMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDSACK 448
           +MISNLLNSIRLL D+  SFR+HC+ GI+ANEDKI K+L+ESLMLVTALNPKIGYD+A  
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 449 VAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPTK 489
           +AK+AHK  +TLKE+AL+  +L+ E+F EW+VPE M+ P++
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/462 (74%), Positives = 401/462 (86%)

Query: 26  QKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVN 85
           Q  R ETD+FGEI+VPANKYWGAQTQRS  NFKIGG RERMPEPII+AFG  KK+AAIVN
Sbjct: 38  QGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVN 97

Query: 86  ESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIG 145
            SLGTLD  +   I QAA+EV +G L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL+G
Sbjct: 98  NSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 157

Query: 146 GELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSH 205
           G LG+KQ+HPNNH NQ+QSSNDTFP+VMHIAA+TEITNTLLP L  LR++   K +EF  
Sbjct: 158 GTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEK 217

Query: 206 IVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKV 265
           I+KIGRTHLQDATPLTLGQEF GYTQQ+TN I R+E++L  L+++AQGGTAVGTGLNTK+
Sbjct: 218 IIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKI 277

Query: 266 GFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGS 325
           GFAE+ A Q+S +TN+ F T+PNKFE+LAAHDA+V    +LNT+ACSLFKI+ DIRYL S
Sbjct: 278 GFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLAS 337

Query: 326 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNV 385
           GPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM QACVQVMGNNSTI+FAGASGQFELN 
Sbjct: 338 GPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNT 397

Query: 386 FKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDS 445
           +KP+MI+NLL+S RLL+DA +SF +HC  GI+AN+DKI ++LHESLMLVT+LNPKIGYD+
Sbjct: 398 YKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDA 457

Query: 446 ACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487
           A KVAKNAH K ITLK+SALEL +LS ++F EWV PE M+GP
Sbjct: 458 ASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 93/240 (38%), Gaps = 25/240 (10%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  ELIG ++  K        +  +S ND   + + I     +  TL P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L D   K+ E    I+  G THLQ A P+        Y    T    R+ Q LH L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 252 QGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
            G  A+     G++      E +AE +   + I      N   A++  D +VE       
Sbjct: 201 LGAGALAGHPYGIDR-----EFLAEGLGFNSVI-----GNSLVAVSDRDFIVELMFWGTL 250

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
               + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 94/240 (39%), Gaps = 25/240 (10%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  ELIG ++  K        +  +S ND   + + I     + ++L P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L D   K+ E    I+  G THLQ A P+        Y    T    R+ Q LH L    
Sbjct: 141 LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSP 200

Query: 252 QGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
            G  A+     G++      E +AE +   + I      N   A++  D +VE       
Sbjct: 201 LGAGALAGHPYGIDR-----EFLAEGLGFNSVI-----GNSLVAVSDRDFIVELMFWGTL 250

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
               + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 82/210 (39%), Gaps = 11/210 (5%)

Query: 159 CNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDAT 218
            +  +S ND   + M I     +  T+LP L++L     ++ EE   ++  G THLQ A 
Sbjct: 107 VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQ 166

Query: 219 PLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKE 278
           P+        Y    T    R++Q +  L     G  A+        G    I  +    
Sbjct: 167 PIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALA-------GHPYGIDREFLA- 218

Query: 279 TNIEFK-TAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLP 337
             + F     N   A+A  D VVE     +     + + A D+  + S    G+ +LS  
Sbjct: 219 AGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS-D 276

Query: 338 ENEPGSSIMPGKVNPTQNEAMTQACVQVMG 367
               GSS+MP K NP   E +     +V G
Sbjct: 277 AYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 95/240 (39%), Gaps = 25/240 (10%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  E+IG ++  K        +  +S ND   + + I     + + L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L D   K+ +   +I+  G THLQ A P+        Y    T    R++Q LH L    
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSP 200

Query: 252 QGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
            G  A+     G++      E +AE +   + I      N   A++  D +VE       
Sbjct: 201 LGAGALAGHPYGIDR-----EFLAEGLGFNSVI-----GNSMVAVSDRDFIVELMFWGTL 250

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
               + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 94/240 (39%), Gaps = 25/240 (10%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  ELIG ++  K        +  +S ND   + + I     + +TL P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L +   K+ E    ++  G THLQ A P+        Y    T    R+ Q LH L    
Sbjct: 141 LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 252 QGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
            G  A+     G++      E +AE +   + I      N   A++  D +VE       
Sbjct: 201 LGAGALAGHPYGIDR-----EFLAEGLGFNSVI-----GNSLVAVSDRDFIVELMFWGTL 250

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
               + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 96/240 (40%), Gaps = 25/240 (10%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  E+IG ++  K        +  +S ND   + + I     +   L P +T+
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMTS 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L +   K+ EE   I+  G THLQ A P+        Y    T  + R++Q L       
Sbjct: 141 LIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKSP 200

Query: 252 QGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
            G  A+     G++      E +AE +  +  I      N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGIDR-----EFLAEGLGFDGVI-----GNSLVAVSDRDFVVELMFWGTL 250

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
               + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 97/240 (40%), Gaps = 21/240 (8%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  E+IG ++  K        +  +S ND   + + I     +   L P LT+
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L     K+ EE   I+  G THLQ A P+        Y    T  + R++Q L  ++F  
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQIL--VRF-- 196

Query: 252 QGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFK-TAPNKFEALAAHDAVVECSGALNTVA 310
              + +G G     G    I  +   E  +EF     N   A++  D VVE         
Sbjct: 197 -NKSPLGAG--ALAGHPYGIDREFLAE-GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 311 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNS 370
             + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ S
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLS 310

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 92/258 (35%), Gaps = 47/258 (18%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  ELIG ++  K        +  +S ND   + + I     I + LLP L +
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L     K+ E    I+  G THLQ A P+        Y    T    R++Q L  L    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 252 QGGTAV--------------GTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHD 297
            G  A+              G G N  +G                     N   A++  D
Sbjct: 199 LGAGALAGHPYGIDREFLANGLGFNGVIG---------------------NSLVAVSDRD 237

Query: 298 AVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 357
            VVE           + + A D+  + S    G+  LS      GSS+MP K N    E 
Sbjct: 238 FVVELLFWGTLFMNHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLEL 295

Query: 358 MTQACVQVMGNNSTITFA 375
           +     +V GN S +  +
Sbjct: 296 LRGKSGRVFGNLSGLLMS 313

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 92/247 (37%), Gaps = 35/247 (14%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  E+IG E+  K        +  +S ND   + M I     +   LLP L A
Sbjct: 92  ANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
                  + +E   ++  G THLQ A P+        Y    T    R++Q +  L    
Sbjct: 142 FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 252 QGGTAVG---TGLNTK-----VGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECS 303
            G  A+     G++ +     +GF   I                N   A++  D VVE  
Sbjct: 202 LGAGALAGHPYGIDREFLARGLGFQGVIG---------------NSLTAVSDRDFVVEIM 246

Query: 304 GALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACV 363
                    + + + D+  + S    G+ +LS      GSS+MP K NP   E +     
Sbjct: 247 FWGTLFMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAG 304

Query: 364 QVMGNNS 370
           +V G  S
Sbjct: 305 RVFGELS 311

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 103/277 (37%), Gaps = 28/277 (10%)

Query: 94  KISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGTKQI 153
           KI   ++   +E  EGK + H            +S+ + +     R  ELIG ++  K  
Sbjct: 63  KIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGELIGRDIAGK-- 108

Query: 154 HPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTH 213
                 +  +S ND   + M I     +   + P + +L +    + E+   I+  G TH
Sbjct: 109 -----VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTH 163

Query: 214 LQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAE 273
           LQ A P+        Y    T  + R+EQ    L       + +G+G     G    I  
Sbjct: 164 LQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLN-----KSPLGSG--ALAGHPYGIDR 216

Query: 274 QVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGE 333
           Q   E         N   A++  D VVE           + + + D+  + S    G+ +
Sbjct: 217 QFLAEGLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFGFIK 275

Query: 334 LSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNS 370
           LS      GSS+MP K N    E +     +V G  S
Sbjct: 276 LS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGELS 311

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 93/240 (38%), Gaps = 25/240 (10%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  E+IG ++  K        +  +S ND   + M I     +   LLP L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L     K+ E+    +  G THLQ A P+        Y    T  + R+ Q L       
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSP 200

Query: 252 QGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
            G  A+     G++      E +AE++  +  I      N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGIDR-----EFLAEELGFQGVI-----GNSLVAVSDRDFVVELMFWGTL 250

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
               + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 93/243 (38%), Gaps = 27/243 (11%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  ELIG  +  K        +  +S ND   + M I     +   +LP +++
Sbjct: 91  ANE---RRLGELIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSS 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
                  +  E   ++  G THLQ A P+        Y    T    R+ Q +  L    
Sbjct: 141 FIRVLINRAREEVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSP 200

Query: 252 QGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
            G  A+     G++ K      +AEQ+     I      N   A++  D V+E     + 
Sbjct: 201 LGAGALAGHPYGIDRKY-----LAEQLGFNGII-----GNSLVAVSDRDFVIEIMFWGSL 250

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMTQACVQVMG 367
               + + A D+    +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 251 FMNHISRFAEDLIIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

Query: 368 NNS 370
             S
Sbjct: 308 QLS 310

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 82/218 (37%), Gaps = 15/218 (6%)

Query: 154 HPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTH 213
           H     +  +S ND   + M I     +   LLP +  L     K+ E     +  G TH
Sbjct: 103 HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTH 162

Query: 214 LQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVG---TGLNTKVGFAEK 270
           LQ A P+        Y    T    R++Q L  L     G  A+     G++      E 
Sbjct: 163 LQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALAGHPYGIDR-----EF 217

Query: 271 IAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCG 330
           +AE ++    I      N   A++  D VVE           + + A D+  + S    G
Sbjct: 218 LAEGLNFGGVI-----GNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFG 271

Query: 331 YGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
           + +LS      GSS+MP K N    E +     +V G+
Sbjct: 272 FVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 93/245 (37%), Gaps = 35/245 (14%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  E+IG  +  K        +  +S ND   + + I     + + L P+L A
Sbjct: 91  ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L D   K+ +E   ++  G THLQ A P+        Y    T    R+ Q +  +    
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSP 200

Query: 252 QGGTAVG---TGLNTK-----VGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECS 303
            G  A+     G++ +     +GF   I                N   A++  D +VE  
Sbjct: 201 LGAGALAGHPYGIDREFLAAGLGFDGVIG---------------NSLVAVSDRDFIVELM 245

Query: 304 GALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACV 363
                    + + A D+  + S    G+ +L+      GSS+MP K N    E +     
Sbjct: 246 FWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSG 303

Query: 364 QVMGN 368
           +V G+
Sbjct: 304 RVFGD 308

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 83/218 (38%), Gaps = 25/218 (11%)

Query: 159 CNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDAT 218
            +  +S ND   + M I     +TN LL  L  L     ++  E   I+  G THLQ A 
Sbjct: 109 VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKELISVICRRANEEMDILMPGYTHLQRAQ 168

Query: 219 PLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVG---TGLNTK-----VGFAEK 270
           P+        Y    T    R+++ L  L     G  A+     G++ +     +GF+  
Sbjct: 169 PIRWSHWLSFYATYFTEDYKRLQEILARLNVSPLGAGALAGHPYGIDREFLAQDLGFSGV 228

Query: 271 IAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCG 330
           I                N   A++  D VVE     +     + + + D+  + S    G
Sbjct: 229 IG---------------NSLVAVSDRDFVVEIMFWGSLFMNHISRFSEDL-IIYSTAEFG 272

Query: 331 YGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
           + +LS      GSS+MP K N    E +     +V G+
Sbjct: 273 FIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 309

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 94/242 (38%), Gaps = 25/242 (10%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  E+IG ++  K        +  +S ND   + + I     +++ LL  L  
Sbjct: 91  ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L +    + EE    +  G THLQ A P+        Y         R+ Q    L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 252 QGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308
            G  A+     G++      E +AE++  ++ I      N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGIDR-----EYLAEKLGFDSVI-----GNSLVAVSDRDFVVEILFWSTL 250

Query: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
               + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

Query: 369 NS 370
            S
Sbjct: 309 LS 310

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 89/247 (36%), Gaps = 35/247 (14%)

Query: 132 ANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTA 191
           ANE    R  E+IG  +  K        +  +S ND   + + I     +   LLP +  
Sbjct: 91  ANE---RRLGEIIGTHIAGK-------VHTGRSRNDQCVTDLRIYCRDILVEKLLPFMID 140

Query: 192 LRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLA 251
           L     K+ E    I+  G THLQ A P+        Y    T    R++Q L  L    
Sbjct: 141 LVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCP 200

Query: 252 QGGTAVG--------TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECS 303
            G  A+           L+ ++GF   I                N   A++  D +V+  
Sbjct: 201 LGAGAIAGHPYGIDRQYLSDELGFNSIIG---------------NSLVAVSDRDFIVDIM 245

Query: 304 GALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACV 363
                    + + + D+  + S    G+ +LS      GSS+MP K N    E +     
Sbjct: 246 FWSTLFMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSG 303

Query: 364 QVMGNNS 370
           +V G  S
Sbjct: 304 RVFGQLS 310

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 100/259 (38%), Gaps = 36/259 (13%)

Query: 120 FQTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVT 179
           F    G +    ANE    R  E+IG  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-R 129

Query: 180 EITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITR 239
           E  + +   L  L  +  ++ E+    +  G THLQ A P+        Y    T    R
Sbjct: 130 EALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 240 VEQSLHHLKFLAQGGTAVG---TGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAH 296
           ++Q    L     G  A+     G++      E IAE++  +  I      N  +A++  
Sbjct: 190 LKQIRERLNVSPLGCGALAGHPYGIDR-----EHIAERLGFDGVI-----GNSLQAVSDR 239

Query: 297 DAVVECSGALNTVACSLF-----KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 351
           D VVE         CSLF     + + D+  + S     + +LS      GSS+MP K N
Sbjct: 240 DFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKN 292

Query: 352 PTQNEAMTQACVQVMGNNS 370
           P   E +     +V G+ S
Sbjct: 293 PDSLELLRGKSGRVFGSLS 311

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 97/262 (37%), Gaps = 46/262 (17%)

Query: 120 FQTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVT 179
           F    G +    ANE    R  E+IG  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-R 129

Query: 180 EITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITR 239
           E  + L   L  L  +  +++E+    +  G THLQ A P+        Y    T    R
Sbjct: 130 EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 240 VEQSLHHLKFLAQGGTAVGTG--------LNTKVGFAEKIAEQVSKETNIEFKTAPNKFE 291
           ++Q    L     G  A+           L  ++GF++ I                N  +
Sbjct: 190 LKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---------------NSLQ 234

Query: 292 ALAAHDAVVECSGALNTVACSLF-----KIANDIRYLGSGPRCGYGELSLPENEPGSSIM 346
           A++  D VVE         CSLF     + + D+  + S     + +LS      GSS+M
Sbjct: 235 AVSDRDFVVEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLM 287

Query: 347 PGKVNPTQNEAMTQACVQVMGN 368
           P K NP   E +     +V G+
Sbjct: 288 PQKKNPDSLELLRGKSGRVFGS 309

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 84/218 (38%), Gaps = 15/218 (6%)

Query: 154 HPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTH 213
           H +   +  +S ND   + M +     + + + P L  L      +  E   ++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 214 LQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVG---TGLNTKVGFAEK 270
           LQ A P+        Y         R+++ +  L     G  A+     G++      E 
Sbjct: 163 LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGALAGHPYGIDR-----EY 217

Query: 271 IAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCG 330
           +A ++  +  I      N   A++  D VVE     +     + ++A D+  + S    G
Sbjct: 218 LACELGFDGVI-----GNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFG 271

Query: 331 YGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368
           + +L+      GSS+MP K NP   E +     +V G 
Sbjct: 272 FVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQ 308

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 80/182 (43%), Gaps = 16/182 (8%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + +   K   E+  +  +G TH Q A   TLG+    + Q++   +   E+
Sbjct: 126 DIVIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALA 294
           + + +      GT        A+  G + KV   E++ E+V++   + F T         
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTEL--LGFDTVYPVTGQTY 240

Query: 295 AHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 354
           +    ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 355 NE 356
            E
Sbjct: 298 CE 299

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 81/190 (42%), Gaps = 22/190 (11%)

Query: 178 VTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGI 237
           + +  + ++P+L  + +   K   E+  +  +G TH Q A   TLG+    + Q++   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 238 TRVEQSLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQV--SKETNIEFKTA 286
              E++ + +      GT        A+  G + KV    E++ E +   K   +  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTY 240

Query: 287 PNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIM 346
             K +        ++    L++ A +  K+A DIR L +       E    +++ GSS M
Sbjct: 241 SRKID--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAM 289

Query: 347 PGKVNPTQNE 356
             K NP + E
Sbjct: 290 AYKRNPMRCE 299

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 79/185 (42%), Gaps = 22/185 (11%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + +   K   E+  +  +G TH Q A   TLG+    + Q++   +   E+
Sbjct: 126 DIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFER 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQV--SKETNIEFKTAPNKFE 291
           + + +      GT        A+  G + KV    E++ E +   K   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID 245

Query: 292 ALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 351
                   ++    L++ A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNE 356
           P + E
Sbjct: 295 PMRCE 299

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 80/190 (42%), Gaps = 22/190 (11%)

Query: 178 VTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGI 237
           + +  + ++P+L  + +   K   E+  +  +G TH Q A   TLG+    + Q++   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 238 TRVEQSLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQV--SKETNIEFKTA 286
              E++ + +      GT        A+  G + KV    E++ E +   K   +  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTY 240

Query: 287 PNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIM 346
             K +        ++    L++ A +  K+A DIR L +       E    + + GSS M
Sbjct: 241 SRKID--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAM 289

Query: 347 PGKVNPTQNE 356
             K NP + E
Sbjct: 290 AYKRNPMRCE 299

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 78/182 (42%), Gaps = 16/182 (8%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + D   K   E+  +  +G TH Q A   TLG+    + Q++   +    +
Sbjct: 126 DVIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALA 294
           + + L      GT        A+  G + KV   E++ E+V++   + F T         
Sbjct: 186 ARNDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTEL--LGFDTVYPVTGQTY 240

Query: 295 AHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 354
           +    ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 355 NE 356
            E
Sbjct: 298 CE 299

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 79/185 (42%), Gaps = 22/185 (11%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + D   K   E+  +  +G TH Q A   T+G+    + Q++   +    +
Sbjct: 126 DIIIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQVSKET--NIEFKTAPNKFE 291
           + + +      GT        A+  G + KV    +++ E +  +T   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKID 245

Query: 292 ALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 351
                   ++    L++ A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNE 356
           P + E
Sbjct: 295 PMRCE 299

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 81/187 (43%), Gaps = 26/187 (13%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + D   K   E+  +  +G TH Q A   TLG+    + Q++   +    +
Sbjct: 126 DLVIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQVSKET--NIEFKTAPNKFE 291
           + + +      GT        A+  G + KV    +++ E +  +T   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID 245

Query: 292 ALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGK 349
                   ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K
Sbjct: 246 --------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYK 292

Query: 350 VNPTQNE 356
            NP + E
Sbjct: 293 RNPMRCE 299

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 78/185 (42%), Gaps = 22/185 (11%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + D   K   E+  +  +G TH Q A   TLG+    + Q++   +    +
Sbjct: 126 DIIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQVSKET--NIEFKTAPNKFE 291
           + + +      GT        A+  G + KV    +++ E +  +T   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID 245

Query: 292 ALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 351
                   ++    L + A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNE 356
           P + E
Sbjct: 295 PMRCE 299

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 28/188 (14%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + L+P+L  + +   K   E+  +  +G TH Q A   TLG+    + Q++   +    +
Sbjct: 126 DILIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGTAVGT---------GLNTKV-GFAEKIAEQVSKET--NIEFKTAPNKF 290
           + + +      GT  GT         G + KV    +++AE +   T   +  +T   K 
Sbjct: 186 ARNDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKI 244

Query: 291 EALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 348
           +        ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAY 291

Query: 349 KVNPTQNE 356
           K NP + E
Sbjct: 292 KRNPMRCE 299

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 75/179 (41%), Gaps = 10/179 (5%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + L+P+L  + D   K   E+  +  +G TH Q A   TLG+    + Q++   +    +
Sbjct: 126 DILIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGTAVGTG-----LNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHD 297
           + + +      GT    G      ++     E + ++V++   + F T         +  
Sbjct: 186 ARNDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTE--LLGFDTVYPVTGQTYSRK 243

Query: 298 AVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 356
             ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 244 IDIDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 76/185 (41%), Gaps = 22/185 (11%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + D   K    +  +  +G TH Q A   TLG+    + Q +   +   ++
Sbjct: 126 DVIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDR 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQVSKET--NIEFKTAPNKFE 291
           + + +      GT        A+  G + KV    +++ E +  ET   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTYSRKID 245

Query: 292 ALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 351
                   ++    L + A +  K+A DIR L +       E    + + GSS M  K N
Sbjct: 246 --------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRN 294

Query: 352 PTQNE 356
           P + E
Sbjct: 295 PMRCE 299

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1162

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 13/72 (18%)

Query: 30  IETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFG------------IL 77
           ++TD    IKVP N+  G Q  RS + ++  G   R+PE + K+FG            +L
Sbjct: 52  LKTDLETGIKVPLNETEGTQNHRSTDRYRKYGDN-RIPERLPKSFGKLIWEAFNDKTMLL 110

Query: 78  KKSAAIVNESLG 89
             +AAIV+ +LG
Sbjct: 111 LTAAAIVSFALG 122

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 79/185 (42%), Gaps = 22/185 (11%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + D   K   ++  +  +G TH Q A   TLG+    + Q++   +    +
Sbjct: 126 DLVIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQVSKET--NIEFKTAPNKFE 291
           + + +      GT        A+  G + KV    +++ E +  +T   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID 245

Query: 292 ALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 351
                   ++    L++ A S  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNE 356
           P + E
Sbjct: 295 PMRCE 299

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 80/190 (42%), Gaps = 22/190 (11%)

Query: 178 VTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGI 237
           + +  + ++P+L  + +   K   E+  +  +G TH Q A   TLG+    + Q++   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 238 TRVEQSLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQV--SKETNIEFKTA 286
              E++ + +      GT        A+  G + KV     ++ E +   K   +  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQTY 240

Query: 287 PNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIM 346
             K +        ++    L++ A +  K+A DIR L +       E    +++ GSS M
Sbjct: 241 SRKID--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAM 289

Query: 347 PGKVNPTQNE 356
             K NP + E
Sbjct: 290 AYKRNPMRCE 299

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 79/184 (42%), Gaps = 20/184 (10%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + L+P+L  + +       ++  +  +G TH Q A   TLG+    + Q++   +    +
Sbjct: 126 DILIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALA 294
           + + + F    GT        A+  G + KV   +K   ++S   +I +      +    
Sbjct: 186 ARNDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAELSG-FDIIYPVTGQTY---- 240

Query: 295 AHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNP 352
           +    ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  K NP
Sbjct: 241 SRKVDIDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYKRNP 295

Query: 353 TQNE 356
            + E
Sbjct: 296 MRCE 299

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 90/210 (42%), Gaps = 23/210 (10%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + ++P+L  + +       E+  +  +G TH Q A   TLG+    + Q++   +   E+
Sbjct: 126 DLVIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQVSKET--NIEFKTAPNKFE 291
           + + +      GT        A+  G + KV    E++ E +  +T   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVELLGFDTVYPVTGQTYSRKID 245

Query: 292 ALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 351
                   ++    L + A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNEAMTQACVQVMGNNSTITFAGASGQF 381
           P + E +  +  + +G+  + T   AS Q+
Sbjct: 295 PMRCERVC-SLARHLGSLLSDTVQTASVQW 323

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 79/185 (42%), Gaps = 22/185 (11%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + L+P+L  + +   +   E+  +  +G TH Q A   TLG+    + Q++   +    +
Sbjct: 126 DILIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVR 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKV-GFAEKIAEQVSKET--NIEFKTAPNKFE 291
           + + +      GT        A+  G + KV    +++ E +  +T   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID 245

Query: 292 ALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 351
                   ++    L++ A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNE 356
           P + E
Sbjct: 295 PMRCE 299

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 77/182 (42%), Gaps = 16/182 (8%)

Query: 183 NTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQ 242
           + L+P+L  + +   K       +  +G TH Q A   TLG+    + Q++   +   E+
Sbjct: 126 DILIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 243 SLHHLKFLAQGGT--------AVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALA 294
           + + +      GT        A+  G + KV   EK+ E+V +   + F T         
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVEL--LGFDTVYPVTGQTY 240

Query: 295 AHDAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 354
           +    ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 355 NE 356
            E
Sbjct: 298 CE 299

>TDEL0D03900 Chr4 (713519..714145) [627 bp, 208 aa] {ON} Anc_3.234
          YDR013W
          Length = 208

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 52 RSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNE--SLGTLDPKISK 97
          RS   +K+    E + + I+K  G LKK+   + E  S+G+LD ++SK
Sbjct: 22 RSSNGYKLPMYHEELIQGILKEVGQLKKNTEFLKEQQSIGSLDDRVSK 69

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 80  SAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNR 139
           S A+ ++ L   DP  +K + + +D+   G     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 140 AIELIGGELGTKQIH------PNNHCNQAQSS 165
            +E   G+    Q+       PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>KLLA0C18975g Chr3 complement(1684573..1688433) [3861 bp, 1286 aa]
           {ON} highly similar to uniprot|P28273 YKL215C
           Saccharomyces cerevisiae Hypothetical ORF
          Length = 1286

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 61/140 (43%), Gaps = 22/140 (15%)

Query: 356 EAMTQACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDG 415
            A+T+A    + N+  +TF GA GQ  + V K + I  +L      +    ++ +   D 
Sbjct: 481 RAITEAKGHAVQNHRLVTFGGAGGQHAVAVAKSLGIKEVL--AHRYSSILSAYGIFLADV 538

Query: 416 IKANEDKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKK--------------NITLK 461
           ++  ++  + IL +S    T    K+ +D+ C ++K + +               N+  +
Sbjct: 539 VEEKQEPCSFILEDS---STMDKVKLRFDNLCAMSKASFRNQGFDDSDLVFEKYLNLRYE 595

Query: 462 ESALELGVLSEE---EFSEW 478
            +   L +L E+   EF +W
Sbjct: 596 GTETSLMILQEDDSYEFKKW 615

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,257,011
Number of extensions: 2083335
Number of successful extensions: 5694
Number of sequences better than 10.0: 71
Number of HSP's gapped: 5849
Number of HSP's successfully gapped: 71
Length of query: 489
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 375
Effective length of database: 40,409,475
Effective search space: 15153553125
Effective search space used: 15153553125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)