Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30156.12ON70703662e-47
ACR014C6.12ON70692864e-35
Kwal_56.223596.12ON91712182e-24
KLTH0C11484g6.12ON89712146e-24
SAKL0E00924g6.12ON97782086e-23
KLLA0D00880g6.12ON71712023e-22
YEL059C-A (SOM1)6.12ON74731582e-15
Smik_5.286.12ON74731546e-15
Suva_5.96.12ON73741512e-14
TDEL0G045906.12ON74741494e-14
Kpol_1032.36.12ON78791461e-13
Skud_5.306.12ON74731443e-13
ZYRO0F00528g6.12ON77761401e-12
TPHA0M002206.12ON78611233e-10
KNAG0E009306.12ON109521184e-09
NCAS0F002106.12ON79831034e-07
KAFR0L003506.12ON7153947e-06
TBLA0G009906.12ON7881740.010
KNAG0K001905.13ON57240611.5
Kpol_1039.122.233ON102032583.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3015
         (70 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...   145   2e-47
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...   114   4e-35
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    89   2e-24
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    87   6e-24
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    85   6e-23
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    82   3e-22
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    65   2e-15
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    64   6e-15
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    63   2e-14
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    62   4e-14
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    61   1e-13
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    60   3e-13
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    59   1e-12
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    52   3e-10
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    50   4e-09
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    44   4e-07
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    41   7e-06
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    33   0.010
KNAG0K00190 Chr11 complement(21938..23656) [1719 bp, 572 aa] {ON...    28   1.5  
Kpol_1039.12 s1039 (33410..36472) [3063 bp, 1020 aa] {ON} (33410...    27   3.6  

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score =  145 bits (366), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%)

Query: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRVR 60
          MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRVR
Sbjct: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRVR 60

Query: 61 IEVTDISTNQ 70
          IEVTDISTNQ
Sbjct: 61 IEVTDISTNQ 70

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score =  114 bits (286), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%)

Query: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRVR 60
          MAPPTP++TR+EV P L+ ++DC+LASL QNECHFDG  YVC+PF+RLF ECTLNKRRVR
Sbjct: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRVR 60

Query: 61 IEVTDISTN 69
          IE+T+ +TN
Sbjct: 61 IEITERNTN 69

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 88.6 bits (218), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 54/71 (76%), Gaps = 1/71 (1%)

Query: 1  MAPPTPIITRDEVEPILSRT-KDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRV 59
          MAPPT +  ++E+EP+L      CI  SL Q+EC+FDGH YVC+PFKR+F+EC ++ + +
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI 60

Query: 60 RIEVTDISTNQ 70
          RIEVTD +TN+
Sbjct: 61 RIEVTDRNTNK 71

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 87.0 bits (214), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 50/71 (70%), Gaps = 1/71 (1%)

Query: 1  MAPPTPIITRDEVEPILSRTKD-CILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRV 59
          MAPPT +  ++E++ I  +  + C L +L+QNEC F+GH YVC PFKRLF+EC   KR V
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV 60

Query: 60 RIEVTDISTNQ 70
          RIEVTD  TN 
Sbjct: 61 RIEVTDQDTNH 71

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 84.7 bits (208), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 42/78 (53%), Positives = 53/78 (67%), Gaps = 9/78 (11%)

Query: 1  MAPPTPIITRDEVEPILSRTKD-CILASLIQNECHFDGHNYVCIPFKRLFEECTLN---- 55
          MAPPTP+  +DE+E +L + K  C L SLIQNEC F+G  Y+C+PFKRLF+EC L+    
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60

Query: 56 ----KRRVRIEVTDISTN 69
               R VRIE+TD  TN
Sbjct: 61 DGRTSRTVRIEITDRHTN 78

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 82.4 bits (202), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 53/71 (74%), Gaps = 1/71 (1%)

Query: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRV- 59
          MAPPT I+  D  + +L R ++C L SL+QNEC F+G++YVC PFKRLFE+C +   RV 
Sbjct: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRVL 60

Query: 60 RIEVTDISTNQ 70
           IEVT+++TN+
Sbjct: 61 NIEVTNLNTNR 71

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 65.5 bits (158), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 1  MAPPTPIITRDE-VEPI--LSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTL-NK 56
          MAPPT I TRD+ + P+  L    +C L  L+Q EC F G  YVC PFKRLFE C   +K
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 57 RRVRIEVTDISTN 69
               EVTD  TN
Sbjct: 61 SATNYEVTDTYTN 73

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 63.9 bits (154), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 1  MAPPTPIITRDE-VEPILS--RTKDCILASLIQNECHFDGHNYVCIPFKRLFEECT-LNK 56
          MAPPT I +RD+ + P+++      C L  L+Q EC F G +YVC PFKRLFE C    K
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 57 RRVRIEVTDISTN 69
               EVTD  TN
Sbjct: 61 PATNYEVTDTYTN 73

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 62.8 bits (151), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 1  MAPPTPIITRDEVEPIL----SRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTL-N 55
          MAPPT I  RD+    L    SRT  C L  L+Q EC F G +YVC PF+RLFE CT   
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTH-CHLKELVQWECQFKGADYVCSPFRRLFEHCTAPG 59

Query: 56 KRRVRIEVTDISTN 69
          +     EVTD  TN
Sbjct: 60 EAATNYEVTDTYTN 73

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 62.0 bits (149), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 6/74 (8%)

Query: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHN---YVCIPFKRLFEEC--TLN 55
          MAPPTP++ R+E+ P + ++K+C+L SL Q +C         Y C+PFKRLF+EC     
Sbjct: 1  MAPPTPVLAREEL-PEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59

Query: 56 KRRVRIEVTDISTN 69
          + + RIEVT   TN
Sbjct: 60 RFKSRIEVTSPLTN 73

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 60.8 bits (146), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 14/79 (17%)

Query: 1  MAPPTPIITRDEV-------EPILSRTKDCILASLIQNECHFDGH---NYVCIPFKRLFE 50
          MAPPTPI +R+EV         + ++   C L S+ Q +C F+      Y+C+PFKRLFE
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 51 ECTLNKRRVRIEVTDISTN 69
          EC+     +RIEVTD  TN
Sbjct: 61 ECS----GIRIEVTDRFTN 75

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 60.1 bits (144), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 1  MAPPTPIITRDE-VEPI--LSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTL-NK 56
          MAPPT I +RD+ + P+  L     C L  L+Q EC F   +YVC PFKRLFE C   +K
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 57 RRVRIEVTDISTN 69
               EVTD  TN
Sbjct: 61 SATDYEVTDTYTN 73

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 58.5 bits (140), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 11/76 (14%)

Query: 1  MAPPTPIITRDEVE------PILSRTKDCILASLIQNECHFDG-HNYVCIPFKRLFEECT 53
          MAPPTPI+T ++V        IL     C L SL Q+ CH +    Y+C+PFKR+FE+C 
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 54 LNKRRVRIEVTDISTN 69
           +     +EVTD  TN
Sbjct: 61 GHA----LEVTDADTN 72

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 52.0 bits (123), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 1  MAPPTPIITRDEVEPILSRTK-----DCILASLIQNECHF---DGHNYVCIPFKRLFEEC 52
          MAP TP++ R+ V   L  +K     +C L +L Q EC F   + + Y+C PFKRLFE C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 53 T 53
           
Sbjct: 61 A 61

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 50.1 bits (118), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEEC 52
          MAP   ++TR++V P+      C+L  L+Q  C  DG  + C PF+RLFE+C
Sbjct: 1  MAPNVRVLTRNDV-PLPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC 51

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 44.3 bits (103), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 19/83 (22%)

Query: 1  MAPPTPIITRDE--VEPILSRTK----------DCILASLIQNECHF--DGHNYVCIPFK 46
          MAPP  +  +D+  V+  LS  +           C    L Q +C    DG  Y+C PFK
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQ-YICFPFK 59

Query: 47 RLFEECTLNKRRVRIEVTDISTN 69
          R+F+EC    + VR EVT++ +N
Sbjct: 60 RVFQEC----QGVRTEVTNVDSN 78

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 40.8 bits (94), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFD-GHNYVCIPFKRLFEEC 52
          MAP   ++  D  E  +   + C L SL+Q  C +  G    C PFKR+F EC
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 33.1 bits (74), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 16/81 (19%)

Query: 1  MAPPTPIITRDEVEPI-----LSRTKDCILA------SLIQNECHFDGHNYV-CIPFKRL 48
          MAPP  I T++E++ +      +R  D   +      S+ Q EC  +    + C PFKR+
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKRI 60

Query: 49 FEECTLNKRRVRIEVTDISTN 69
          F++    +R    E+TD +TN
Sbjct: 61 FQQVGEYRR----EITDETTN 77

>KNAG0K00190 Chr11 complement(21938..23656) [1719 bp, 572 aa] {ON}
           Anc_5.13 YMR307W
          Length = 572

 Score = 28.1 bits (61), Expect = 1.5,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 3   PPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVC 42
           PPTP    +++   +S    C++AS +  + + D  NYVC
Sbjct: 362 PPTP---NEDLCSCMSAANSCVVASDVSEDDYEDLFNYVC 398

>Kpol_1039.12 s1039 (33410..36472) [3063 bp, 1020 aa] {ON}
           (33410..36472) [3063 nt, 1021 aa]
          Length = 1020

 Score = 26.9 bits (58), Expect = 3.6,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 21/32 (65%)

Query: 5   TPIITRDEVEPILSRTKDCILASLIQNECHFD 36
           T IIT D+ + I + T+D +  S++QN+  ++
Sbjct: 623 TTIITEDDADFIKAHTQDSVFKSILQNKSIYE 654

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,408,677
Number of extensions: 238299
Number of successful extensions: 745
Number of sequences better than 10.0: 21
Number of HSP's gapped: 732
Number of HSP's successfully gapped: 21
Length of query: 70
Length of database: 53,481,399
Length adjustment: 43
Effective length of query: 27
Effective length of database: 48,550,761
Effective search space: 1310870547
Effective search space used: 1310870547
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)