Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30146.11ON55155129780.0
ACR015W6.11ON55254918900.0
SAKL0E00902g6.11ON54454418870.0
KLTH0C11506g6.11ON54453517170.0
Kwal_56.223556.11ON54153517130.0
Kpol_1032.26.11ON53954215460.0
KLLA0D00858g6.11ON54153715190.0
TPHA0M002106.11ON54554414670.0
TBLA0G009806.11ON55856614440.0
Smik_5.296.11ON55555014150.0
NCAS0F002006.11ON54955614080.0
Suva_5.106.11ON55355314040.0
Skud_5.316.11ON55754813970.0
NDAI0K028906.11ON56156113940.0
ZYRO0F00506g6.11ON55056513900.0
TDEL0G046006.11ON52854513820.0
YEL058W (PCM1)6.11ON55753313840.0
CAGL0B03597g6.11ON54055313520.0
KAFR0L003406.11ON54054413271e-178
KNAG0E009406.11ON53855612551e-167
CAGL0M02981g8.840ON61790860.071
TDEL0B005708.840ON63022790.50
Kpol_1068.88.840ON63222790.53
NCAS0C004108.840ON62566780.66
KLLA0D01573g8.840ON60722780.72
KNAG0J002708.840ON62558761.2
TPHA0I002508.840ON62926761.3
YMR278W (PGM3)8.840ON62219761.4
Suva_13.4668.840ON62219751.4
Kwal_27.102588.840ON62022751.5
Skud_13.4508.840ON62219751.5
NDAI0K004108.840ON62637751.6
TBLA0B032508.840ON64319751.7
Skud_14.1522.73ON591110742.0
Smik_13.4918.840ON62219742.2
ZYRO0G14190g8.840ON61019732.6
Ecym_46118.840ON63022733.0
KLTH0C03872g8.840ON62141723.7
KAFR0B039208.840ON62418723.7
ABL126W8.840ON62418723.8
SAKL0D01474g8.840ON62418714.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3014
         (551 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...  1151   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   732   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   731   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   665   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   664   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   600   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   589   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   569   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   560   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   549   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   546   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   545   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   542   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   541   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   540   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   536   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   537   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   525   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   515   e-178
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   488   e-167
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.071
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    35   0.50 
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    35   0.53 
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    35   0.66 
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    35   0.72 
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    34   1.2  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    34   1.3  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    34   1.4  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    33   1.4  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    33   1.5  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    33   1.5  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    33   1.6  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    33   1.7  
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    33   2.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    33   2.2  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    33   2.6  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    33   3.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    32   3.7  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    32   3.7  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    32   3.8  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    32   4.6  

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 1151 bits (2978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/551 (100%), Positives = 551/551 (100%)

Query: 1   MSVVEEVSKLYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGA 60
           MSVVEEVSKLYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGA
Sbjct: 1   MSVVEEVSKLYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGA 60

Query: 61  MITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIK 120
           MITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIK
Sbjct: 61  MITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIK 120

Query: 121 ADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMES 180
           ADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMES
Sbjct: 121 ADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMES 180

Query: 181 ERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKD 240
           ERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKD
Sbjct: 181 ERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKD 240

Query: 241 STTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD 300
           STTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD
Sbjct: 241 STTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD 300

Query: 301 VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPV 360
           VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPV
Sbjct: 301 VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPV 360

Query: 361 SCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALK 420
           SCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALK
Sbjct: 361 SCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALK 420

Query: 421 TLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFK 480
           TLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFK
Sbjct: 421 TLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFK 480

Query: 481 TTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKI 540
           TTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKI
Sbjct: 481 TTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKI 540

Query: 541 SQLVISATVTA 551
           SQLVISATVTA
Sbjct: 541 SQLVISATVTA 551

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/549 (64%), Positives = 431/549 (78%), Gaps = 5/549 (0%)

Query: 1   MSVVEEVSKLYDKH-CCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVG 59
           M  V+E+ KLYD+H  C R  Y YGTAGFR +AE+L  V+F TG+LACLRS++L G YVG
Sbjct: 1   MRTVQEMVKLYDRHRGCGRV-YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVG 59

Query: 60  AMITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGI 119
            M+TASHNPP+DNGVKLVDP GEML  EWE +AT LANCAS G+ + L  L  L+++ G+
Sbjct: 60  VMLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGL 119

Query: 120 KADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQME 179
                AR+VVARDSR SG +LL AL+DGT +  +V++VD  MLTTPQLHFLT   N   E
Sbjct: 120 DLALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACN---E 176

Query: 180 SERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFK 239
                 V E  YY+HF++AL+EL  L  +  LP+PLV+D ANGVG  KA ELF ++  FK
Sbjct: 177 RGSAAGVREDLYYAHFVAALEELAALHGLETLPFPLVVDTANGVGALKARELFRRSPLFK 236

Query: 240 DSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYR 299
           +  +IIN NWSQH+LLNS CGADYVKT QCLPQGISA     SL CS+DGDADRVIFYY 
Sbjct: 237 NRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYI 296

Query: 300 DVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVP 359
           D    FHLLDGDKISTL AKF QS L  AGI D+V LGVVQTAYANGSSTRYLSEVL VP
Sbjct: 297 DGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVP 356

Query: 360 VSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMAL 419
           VSCTPTGVK+LHR+AV+ YDVGIYFEANGHGTVIFSE+F  TV + L+  +LSA+++++L
Sbjct: 357 VSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSL 416

Query: 420 KTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLF 479
           +TL++F+ LINQT+GDA++DM+AV+A+L IL W+P+ WD +YTDLPN L+KVVVPDRS+F
Sbjct: 417 QTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMF 476

Query: 480 KTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIK 539
           KTTNAE+QL SP GLQ  ID ++  YD+ RSFVRASGTEDAVRIYAEAA+++QAD+L+ K
Sbjct: 477 KTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATK 536

Query: 540 ISQLVISAT 548
           +S LV+ +T
Sbjct: 537 VSTLVVEST 545

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/544 (62%), Positives = 428/544 (78%), Gaps = 5/544 (0%)

Query: 1   MSVVEEVSKLYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGA 60
           M  ++ + +LYDKHC + F Y YGTAGFRYKA++LDTV+FTTG+LA +RS++LKGQYVG 
Sbjct: 1   MVNIQLLEELYDKHCKTGFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 61  MITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIK 120
           MITASHNPPQDNGVK+VDPKGEML Q WE +ATELAN AS GK + +  L +L+ + GI 
Sbjct: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120

Query: 121 ADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMES 180
               A+I ++RDSRESG RLL+A++DGT V  NV +VD+++LTTPQLHFLTY  N+   S
Sbjct: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSS 180

Query: 181 ERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKD 240
           +    V E+ YYS F SA  ++  L +I  LPY ++IDAANG+GG K  E+ +KN FF  
Sbjct: 181 K----VEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSS 236

Query: 241 STTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD 300
           + ++IN  W   +LLN  CGADYVKTNQ  P+G+S  ++   ++CSFDGDADR++FYY D
Sbjct: 237 TVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHD 296

Query: 301 VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPV 360
               F+LLDGDKISTLFAKFF+ +L  AG ++ +KLGVVQTAYANGSST YLS +L VPV
Sbjct: 297 EKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPV 356

Query: 361 SCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALK 420
           SCT TGVK+LH +A+ NYD+GIYFEANGHGTVIFS+ F+ T+ K+LKE      +K ALK
Sbjct: 357 SCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAK-ALK 415

Query: 421 TLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFK 480
           TL  F+ LINQTVGDA+SDM+AVLAVLCILKW+PQ+WD EYTDLPN L+KV+VPDRS+FK
Sbjct: 416 TLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFK 475

Query: 481 TTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKI 540
           T+NAERQLVSPKGLQ +ID  ++ +++ RSFVRASGTEDAVR+YAEAATKE+AD L+  +
Sbjct: 476 TSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASV 535

Query: 541 SQLV 544
           S LV
Sbjct: 536 SDLV 539

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/535 (59%), Positives = 402/535 (75%), Gaps = 4/535 (0%)

Query: 10  LYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPP 69
           LY+ HC S F Y YGTAGFRYKA++LDTV+FTTGVLA LRS++L+G+ VG MITASHNPP
Sbjct: 10  LYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPP 69

Query: 70  QDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADSEARIVV 129
           +DNGVK+VDPKGEML+Q WE YAT+LAN A+     FL  LQ L+++ G+  D+   + V
Sbjct: 70  EDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLDTDALGSLAV 129

Query: 130 ARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEVNEA 189
           ARDSRESG RLL AL++G+ V  N+ I DY +LTTPQLHFLT   +++ E      ++  
Sbjct: 130 ARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLT---SKRNELPNDTAIDRF 186

Query: 190 FYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKDSTTIINGNW 249
           FYY  FLSA  ++T L  I  LPY L IDAANG+G  + +E+   + FF     ++N +W
Sbjct: 187 FYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFRVVNDDW 246

Query: 250 SQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRDVDGMFHLLD 309
                LN  CGADYVKTNQ LP GI A  D   + CSFDGDADR++FY+ D +G F LLD
Sbjct: 247 ETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEGQFRLLD 306

Query: 310 GDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCTPTGVKY 369
           GDK++TLFAKFFQ +L  A +Q+ + LGVVQTAYANGSST Y+  VL +PV+CTPTGVK+
Sbjct: 307 GDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTGVKH 366

Query: 370 LHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQSFSKLI 429
           LH +A+ NYD+G+YFEANGHGTV+FS+ F+  V+  L     S  S  +L+ L  F+ LI
Sbjct: 367 LHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFANLI 425

Query: 430 NQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTNAERQLV 489
           NQTVGDA+SDMM VLAVL ILKWTPQ+W+ EYTDLPN L+KV+VPDR++FKTTNAERQL+
Sbjct: 426 NQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAERQLL 485

Query: 490 SPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQLV 544
           SP GLQ +I+ ++  Y  ARSFVRASGTEDAVR+YAEA+T+E+AD L+ ++SQ+V
Sbjct: 486 SPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/535 (58%), Positives = 405/535 (75%), Gaps = 4/535 (0%)

Query: 10  LYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPP 69
           LY+ HC + F Y YGTAGFRYKA++LDTV+FTTGV+A LRS+ L+G+ VG MITASHNPP
Sbjct: 10  LYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITASHNPP 69

Query: 70  QDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADSEARIVV 129
           +DNGVK+VDPKGEML+Q WEVYAT+LAN AS G  +F+  ++ LM +  + ++    IVV
Sbjct: 70  EDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVGSNDHGSIVV 129

Query: 130 ARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEVNEA 189
           ARDSRESG RLL A + G  V  NV + D+ +LTTPQLHFLT   N   E  +  E+ ++
Sbjct: 130 ARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSN---ELPKGTEIGKS 186

Query: 190 FYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKDSTTIINGNW 249
            YY +FLSA  E+ EL  I  LPY L IDAANG+G     E+  ++ FFK +  ++N  W
Sbjct: 187 LYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFAVVNDEW 246

Query: 250 SQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRDVDGMFHLLD 309
              D LN  CGAD+VKTNQ LP GI+   + N + CSFDGDADR++FYY   +G FHLLD
Sbjct: 247 ETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNGDFHLLD 306

Query: 310 GDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCTPTGVKY 369
           GDK++TLFAKFFQ +L  AG+QD ++LGVVQTAYANGSST Y+ +VL + V+CTPTGVK+
Sbjct: 307 GDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCTPTGVKH 366

Query: 370 LHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQSFSKLI 429
           LH +AV+ YD+G+YFEANGHGTV+FS  F + + ++L E   S  ++ +LK L  F+KLI
Sbjct: 367 LHHEAVK-YDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHLFAKLI 425

Query: 430 NQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTNAERQLV 489
           NQTVGDA+SDM+AVLAVL ILKW+P++WD EYTDLPN L+KV+VPDR++FKT NAERQLV
Sbjct: 426 NQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNAERQLV 485

Query: 490 SPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQLV 544
           SP G+Q +ID ++ ++   RSFVRASGTEDAVR+YAEAAT ++ + LS ++ +L+
Sbjct: 486 SPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/542 (54%), Positives = 393/542 (72%), Gaps = 14/542 (2%)

Query: 8   SKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASH 66
           SKL++K+C ++  KY+YGTAGFR  A IL+TV+FTTG++ACLRS+ L G+ VG MITASH
Sbjct: 3   SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62

Query: 67  NPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHR-LQELMNQFGIKADSEA 125
           NPP+DNGVK+V+P G ML Q WE  ATELAN A++     L   ++E + +F  ++ S+ 
Sbjct: 63  NPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKV 122

Query: 126 R--IVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERV 183
           +  +VV RDSRESGS LL+ L+     + N  I++Y +LTTPQLHFLT  +N +    + 
Sbjct: 123 QPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVK----KS 178

Query: 184 IEVNEAFYYSHFLSALKELTELFNIPGL-PYPLVIDAANGVGGAKAEELFMKNTFFKDST 242
             V E+ YY++F+ +  ++T L NI  L    L ID ANG+GG K +EL +K+  F    
Sbjct: 179 YAVQESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQEL-LKSWPFASKV 237

Query: 243 TIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRDVD 302
           T++N  W + DLLN  CGAD+VKTNQ LP G+S  +  N L+CS+DGDADR++FY++D D
Sbjct: 238 TLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQD 297

Query: 303 GMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSC 362
             FHLLDGDKISTLFAK    +L  A +   + LGVVQTAYANGSST YL   L VPVSC
Sbjct: 298 KQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSC 357

Query: 363 TPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTL 422
             TGVK+LH +AV NYD+G+YFEANGHGT+IFS++F     K LK  S S    +A+ TL
Sbjct: 358 AKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSES----IAVNTL 413

Query: 423 QSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTT 482
            + S LINQTVGDA+SDM+ VL+VL I+K + QQWD EYTDLPN L KV+VPDRS+F TT
Sbjct: 414 VALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITT 473

Query: 483 NAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQ 542
           + ER+L+SP+GLQ++IDK I  + N RSFVRASGTEDAVR+YAEA+++E+A +L+  +++
Sbjct: 474 DQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTK 533

Query: 543 LV 544
           LV
Sbjct: 534 LV 535

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/537 (55%), Positives = 381/537 (70%), Gaps = 7/537 (1%)

Query: 10  LYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPP 69
           LY+++C     Y YGTAGFR    +LDTV+FTTG++A LRS++LK ++VG MITASHNPP
Sbjct: 6   LYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPP 65

Query: 70  QDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADSEARIVV 129
           +DNGVK+V+P GEML Q WE  AT+LAN AS    Q    LQ ++ +  I     A I V
Sbjct: 66  EDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANITV 125

Query: 130 ARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEVNEA 189
           ARDSRESG RLL AL  G SVF  V I+D+++LTTPQLHFL Y LN    S +  +V ++
Sbjct: 126 ARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNT---SSQPSQVRDS 182

Query: 190 FYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMK-NTFFKDSTTIINGN 248
            YY HF+S   +LT+L+ +  LP+ L ID ANG+G  K ++L  +     ++S T +NG 
Sbjct: 183 TYYDHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGE 242

Query: 249 WSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD-VDGMFHL 307
                LLN  CGAD+VKTNQ  P   +     + L+CSFDGDADRV+FYY D  +  FHL
Sbjct: 243 TKTFQLLNESCGADFVKTNQTFPANCNPKP--SQLYCSFDGDADRVVFYYVDGKENKFHL 300

Query: 308 LDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCTPTGV 367
           LDGDKI+TL AK    +L   G+ D +KLGVVQTAYANGSST+Y+++ L +PVSCT TGV
Sbjct: 301 LDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGV 360

Query: 368 KYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQSFSK 427
           K+LH +AV  YD+GIYFEANGHGTVIFS  F  TV  RL+E S + +   +L +L+  S+
Sbjct: 361 KHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLSQ 420

Query: 428 LINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTNAERQ 487
           LINQTVGDA+SDM+AV+A L I    P+ WDG Y DLPN L KV+VPDRS+F +TNAERQ
Sbjct: 421 LINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQ 480

Query: 488 LVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQLV 544
           L+SP+GLQA+ID ++  + N+RSFVRASGTEDAVR+YAEA T E A +L+ K+ +LV
Sbjct: 481 LLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/544 (54%), Positives = 370/544 (68%), Gaps = 23/544 (4%)

Query: 15  CCS--RFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPPQDN 72
           CC+    +Y+YGTAGFR  A +LDTV+ TTG+LACLRS+ L G+ VG MITASHN P DN
Sbjct: 13  CCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDN 72

Query: 73  GVKLVDPKGEMLKQEWEVYATELANCAS--DGKHQFLHRLQELMNQFGIKADSEARIVVA 130
           GVK+V+P G ML Q WE +ATELAN AS      +F   LQE   Q+ + +     +VV 
Sbjct: 73  GVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVG 132

Query: 131 RDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEVNEAF 190
           RDSR+SG RLL+ L           I+DY +LTTPQLHFLT  +N       V E +   
Sbjct: 133 RDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTEDD--- 189

Query: 191 YYSHFLSALKELTELFNIPGLPYP-LVIDAANGVGGAKAEELF----MKNTFFKDSTTII 245
           YYS F+ A   +T L  I  L  P L IDAANG+GG K  +LF        F     T++
Sbjct: 190 YYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQF-----TLV 244

Query: 246 NGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDIN--SLHCSFDGDADRVIFYYRDVDG 303
           N +W    LLN+ CGADYVKTNQ LP+ I  A D +  +L+CSFDGDADR++FYY+D   
Sbjct: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304

Query: 304 MFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCT 363
            FHLLDGDKISTLFA F    L  AG+ + + +GVVQTAYANG+ST YL  VL +PVSC 
Sbjct: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364

Query: 364 PTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQ 423
            TGVK+LH +A+ NYDVGIYFEANGHGT++FS  F  T    LKE + S E    +KTL 
Sbjct: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNESLE----VKTLL 420

Query: 424 SFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTN 483
           SF+ LINQTVGDA+SDM+ VLAVL I+K TP  WD EYTDLPN L KVVVPDRSLF TT+
Sbjct: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480

Query: 484 AERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQL 543
            ER+L++P+G Q +ID ++  Y N RSFVRASGTEDAVR+YAEA+T + A  L+ ++S+ 
Sbjct: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540

Query: 544 VISA 547
           V+++
Sbjct: 541 VLAS 544

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/566 (53%), Positives = 389/566 (68%), Gaps = 40/566 (7%)

Query: 4   VEEVSKLYDKHCCSRFK-YIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMI 62
           + + + L+ K C ++   Y YGTAGFR KA ILDTV+FTTG +ACLRS+   G+ VG M+
Sbjct: 7   LSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMV 66

Query: 63  TASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKAD 122
           TASHNPP DNGVK+V+P G ML Q+WE  AT+LAN AS GK   +  L + +N   I+ +
Sbjct: 67  TASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGK---IDELVQFVNAKLIELN 123

Query: 123 SE--ARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMES 180
           S     ++V RDSRES + LL+ L +G+    +  IVDY++LTTPQLHFLT   N + + 
Sbjct: 124 SNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDL 183

Query: 181 ERVIEVNEAFYYSHFLSALKELTELFN-----IPGLPYPLVIDAANGVGGAKAEEL--FM 233
            +     E  YY HF +A  +L  + N            L+ID+ANG+GG K E L  + 
Sbjct: 184 PK-----ETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYW 238

Query: 234 KNTFFKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDI------NSLHCSF 287
           K  +      +IN NW + + LN+ CGADYVKTNQ LP GI+  TDI      N +HCSF
Sbjct: 239 KTNY---KVRLINNNWKRPESLNNNCGADYVKTNQKLPNGIT--TDIINESSKNVIHCSF 293

Query: 288 DGDADRVIFYYRDVD-GMFHLLDGDKISTLFAKFFQSMLPVAGI--QDNVKLGVVQTAYA 344
           DGDADRV+FYY+D     F+LLDGDKISTLFA F    L +AGI  ++ +KLGVVQTAYA
Sbjct: 294 DGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYA 353

Query: 345 NGSSTRYLSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSK 404
           NGSST YL + L +PV+C  TGVK+LH +A   YD+G+YFEANGHGT+IFSENF   +++
Sbjct: 354 NGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQ 413

Query: 405 RLK-EGSLSAESKM-ALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYT 462
           ++  E  +    K+ ALKTL+  S LINQTVGDA+SDMM V+AVL IL WTPQ W+ EYT
Sbjct: 414 KINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYT 473

Query: 463 DLPNTLMKVVVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVR 522
           DLPN L K+VVPDRS+F+TT+ ER+L SP GLQ++I+K++  Y+N RSFVRASGTEDAVR
Sbjct: 474 DLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVR 533

Query: 523 IYAEAATKEQADDLSIKISQLVISAT 548
           +YAEA     +DD++ K+ Q V+ AT
Sbjct: 534 VYAEA-----SDDVN-KLCQEVLDAT 553

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/550 (53%), Positives = 369/550 (67%), Gaps = 14/550 (2%)

Query: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63
           E++S+LYDK C ++  +Y YGTAGFR  A+ LDTV+FTTG+LA LRS+ L+GQYVG MIT
Sbjct: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKH--QFLHRLQELMNQFGIKA 121
           ASHNP QDNGVK+V+P G ML   WE YA +LAN AS   +  +F   L  L+    I  
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 125

Query: 122 DSE--ARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQME 179
           D+     IVV RDSRES   LL+ L        +  ++D   +TTPQLH++T   N++  
Sbjct: 126 DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 185

Query: 180 SERVIEV-NEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMKNT 236
                EV  E  YYS F+ A  EL   + I   L  P L IDAANG+GG + ++L     
Sbjct: 186 EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 245

Query: 237 FF--KDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRV 294
           +    D   +IN      +LLN  CGADYVKTNQ LP+G+S ++  +SL+CSFDGDADRV
Sbjct: 246 WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSH-DSLYCSFDGDADRV 304

Query: 295 IFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSE 354
           +FYY D +  FHLLDGDKISTLFAKF    L +A +++++++GVVQTAYANGSST Y+  
Sbjct: 305 VFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIEN 364

Query: 355 VLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAE 414
            L  PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFSE F+  +   L   S +  
Sbjct: 365 TLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL---SRARG 421

Query: 415 SKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVP 474
             +ALKTL  FSKLINQTVGDA+SDM+AVLA L I+K  P  WD EYTDLPN L+K +VP
Sbjct: 422 DMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVP 481

Query: 475 DRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQAD 534
           DRS+F+T + ER+L +P GLQA+ID VI  Y   RSFVRASGTEDAVRIYAE     Q D
Sbjct: 482 DRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLD 541

Query: 535 DLSIKISQLV 544
               +I +LV
Sbjct: 542 QFCNEIVELV 551

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/556 (51%), Positives = 379/556 (68%), Gaps = 25/556 (4%)

Query: 2   SVVEEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGA 60
           SV+++V   Y+  C +R +KY YGTAGFR KA  LDTV+F TG++AC RSM L G  VG 
Sbjct: 6   SVLQQV---YNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62

Query: 61  MITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHR-LQELMN--QF 117
           M+TASHNPP DNGVK+V+P G ML QEWE   T+LAN A++   + ++  + E+    +F
Sbjct: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKF 122

Query: 118 GIKADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQ 177
             + +++  +++  DSRES  RL K LV+      N DI +Y ++TTPQLHF+T   N +
Sbjct: 123 PFQ-ENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAK 181

Query: 178 ME--SERVIEVNEAFYYSHFLSALKELTELFNIPGLPY--PLVIDAANGVGGAKAEELFM 233
               +  VI V+   YY++F ++  +  EL++         L+ID+ANG+GG K  +L  
Sbjct: 182 YNKNTNDVISVDN--YYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIS 239

Query: 234 K-NTFFKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDAD 292
              +  + + +IIN +W   +LLN+ CGADYVKTNQ LP+GI   +++N LHCSFDGDAD
Sbjct: 240 TWPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLN-LHCSFDGDAD 298

Query: 293 RVIFYY-RDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRY 351
           R++FYY  +VD  FHLLDGDKI+TLFAKF  ++L    + D +KLGVVQTAYANGSST Y
Sbjct: 299 RIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNY 358

Query: 352 LSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSL 411
           L+ VL VPVSCT TGVK+LH +A   YD+GIYFEANGHGTV+FSE F   +    K    
Sbjct: 359 LTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPK---- 414

Query: 412 SAESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKV 471
                 A +TL  F K+INQTVGDAM+DM+ V+ VL + K TP QWD  Y DLPN L KV
Sbjct: 415 ----TTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKV 470

Query: 472 VVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKE 531
           +VPDRS+F TTN ERQL SP GLQ +ID  +    N RSFVRASGTEDAVR+YAEAAT+E
Sbjct: 471 IVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQE 530

Query: 532 QADDLSIKISQLVISA 547
           + + LS ++ + V+S+
Sbjct: 531 ETEKLSQEVCKFVLSS 546

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/553 (52%), Positives = 369/553 (66%), Gaps = 16/553 (2%)

Query: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63
           +++ KLY++ CC++  +Y YGTAGFR  A+ LDTV+FTTG+LA LRS+ L+GQYVG MIT
Sbjct: 6   DQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGK--HQFLHRLQELMNQFGIKA 121
           ASHNP QDNGVK+V+P G ML   WE YA +LAN AS      +F   L +L+    I  
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDL 125

Query: 122 DSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLN-RQMES 180
           D+   +VV RDSRES   LL+ L    +   +  +VD   +TTPQLH++T   N RQ E 
Sbjct: 126 DAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREG 185

Query: 181 ERVIEVNEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMKNTFF 238
                  E  YYS F++A  EL     I   L  P L +D ANG+GG + ++L     + 
Sbjct: 186 GSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWA 245

Query: 239 --KDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIF 296
              D   I+N       LLN  CGADYVKTNQ LP+G+S ++  +SL+CSFDGDADRV+F
Sbjct: 246 VPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSP-DSLYCSFDGDADRVVF 304

Query: 297 YYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVL 356
           YY D +  FHLLDGDKISTLFAKF    L +A + D++K+GVVQTAYANGSST Y+ + L
Sbjct: 305 YYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTL 364

Query: 357 IVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLK--EGSLSAE 414
             PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFS+ F+ T+   L   +GSL   
Sbjct: 365 HCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGSL--- 421

Query: 415 SKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVP 474
             +AL TL+ F+ LINQTVGDA+SDM+AVLA L IL   P  WD EYTDLPN L+K +VP
Sbjct: 422 --LALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVP 479

Query: 475 DRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQAD 534
           DRS+F+TT+ ER+L +P GLQ +ID VI  Y   RSFVRASGTEDAVR+YAE     + D
Sbjct: 480 DRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLD 539

Query: 535 DLSIKISQLVISA 547
               ++ + V S+
Sbjct: 540 QFCNEVVEYVKSS 552

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/548 (53%), Positives = 370/548 (67%), Gaps = 16/548 (2%)

Query: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63
           E++ KLYD+ C ++  +Y YGTAGFR  A+ LDTV+FTTG+LA LRS+ L+GQYVG MIT
Sbjct: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKH--QFLHRLQEL--MNQFGI 119
           ASHNP QDNGVK+V+P G ML   WE YA +LAN AS   H  +F   L +L  + +  +
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDL 125

Query: 120 KADSEA-RIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNR-Q 177
            A + A  IVV RDSRES   LL+ L    +   +  ++D   +TTPQLH++T   NR +
Sbjct: 126 GASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRRE 185

Query: 178 MESERVIEV-NEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMK 234
            E +  +    E  YYS F+ A  EL   +++   L  P L ID ANG+GG + ++L   
Sbjct: 186 REGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLAS 245

Query: 235 NTFF--KDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDAD 292
             +    D   IIN       LLNS CGADYVKTNQ LP+G+S ++   SL+CSFDGDAD
Sbjct: 246 KDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSS-FESLYCSFDGDAD 304

Query: 293 RVIFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYL 352
           RV+FYY D +  FHLLDGDKISTLFAKF    L +A ++ ++K+GVVQTAYANGSST Y+
Sbjct: 305 RVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYI 364

Query: 353 SEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLS 412
            + L  PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFSE F+ T+   L + +  
Sbjct: 365 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPN-- 422

Query: 413 AESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVV 472
               +ALKTL  F+KLINQTVGDAMSDM+AVLA L ILK  P  WD EY DLPN L+K +
Sbjct: 423 -GHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCI 481

Query: 473 VPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQ 532
           VPDRS+F+TT+ ER+L +P GLQ++ID VI  Y   RSFVRASGTEDAVR+YAE     +
Sbjct: 482 VPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSK 541

Query: 533 ADDLSIKI 540
            D    +I
Sbjct: 542 LDQFCNEI 549

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/561 (52%), Positives = 384/561 (68%), Gaps = 31/561 (5%)

Query: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHL----KGQYVG 59
           +++   +++ C ++ + Y YGTAGFR  A+ LDTV+FTTG++ACLRS+ L    K   +G
Sbjct: 10  DQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIG 69

Query: 60  AMITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCAS----DGKHQFL-HRLQELM 114
            M+TASHNPP+DNGVK+++P G ML QEWE  AT+ AN A+    D  +Q L   +  L 
Sbjct: 70  VMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLE 129

Query: 115 NQFGIKADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHL 174
           N   IK      +++  DSR+S   L+  ++   ++  N  I++Y+ +TTPQLHFLT   
Sbjct: 130 NDLNIK--QPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLT 187

Query: 175 NRQMESERVIEVNEAFYYSHFLSALKELTELFNIPGLPYP-LVIDAANGVGGAKAEEL-F 232
           N    +E   E+N   YY HF   L +L  L+    LP+  L+IDAANG+G  + E+L F
Sbjct: 188 NTTGTAE---EIN---YYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLF 241

Query: 233 MKNTF----FKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINS-LHCSF 287
            KN F     K+   IIN +    +LLN  CGADYVKTNQ LPQGI    D NS L CS+
Sbjct: 242 TKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSY 301

Query: 288 DGDADRVIFYYRD-VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANG 346
           DGDADR++FYY D +   F+LLDGDKI+TLFAKFF ++L +A +   +KLGVVQTAYANG
Sbjct: 302 DGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANG 361

Query: 347 SSTRYLSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRL 406
           SST Y+S  L VPVSCT TGVK+LH +A+  YD+GIYFEANGHGTVIFS+ F++ ++K L
Sbjct: 362 SSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTK-L 420

Query: 407 KEGSLSAESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPN 466
           KE   S E    +KTL  FS+LINQTVGDAMSDM+AV+AVL IL+ +P  WD EY DLPN
Sbjct: 421 KESGSSRE----IKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPN 476

Query: 467 TLMKVVVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAE 526
            L KV+VPDRS F TT+ ER+LV PKGLQ  +++ + S    RSFVRASGTEDAVR+YAE
Sbjct: 477 KLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAE 536

Query: 527 AATKEQADDLSIKISQLVISA 547
           A T+E+ + LS K+ QLVI +
Sbjct: 537 AKTQEETEWLSKKVCQLVIES 557

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/565 (50%), Positives = 364/565 (64%), Gaps = 36/565 (6%)

Query: 1   MSVVEEVSKLYDKHCC-SRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVG 59
           M  V+ ++KL D++C  S   Y+YGTAGFR  A  LDTVLF TG+LACLRS+ LKG  +G
Sbjct: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60

Query: 60  AMITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANC---------ASDGKHQFLHRL 110
            M+TASHNPP DNGVK+V+P G M+ + WE  ATELAN           +   H +L R 
Sbjct: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQR- 119

Query: 111 QELMNQFGIKADSE-----ARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTP 165
            EL  Q     +S        +VV RDSRESG +LL  LV       +  I D  +LTTP
Sbjct: 120 -ELKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTP 178

Query: 166 QLHFLTYHLNRQMESERVIEVNEAFYYSHFLSALKELTELFNI-PGLPY--PLVIDAANG 222
           QLHFLT        ++ V  V E+ YY HFL A   + +L  I   LP    L IDAANG
Sbjct: 179 QLHFLTSET-----AKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANG 233

Query: 223 VGGAKAEELFMKNTFFKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINS 282
           +G  K +EL +     +     IN  W+  +LLN  CGAD+VK+NQ  P G +   D   
Sbjct: 234 IGAPKVQEL-LSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN---DSTG 289

Query: 283 LHCSFDGDADRVIFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTA 342
           L CS+DGDADRV+FYY +    F LLDGD+IS LFA FF  +L  AG+Q  + LGVVQTA
Sbjct: 290 LGCSYDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTA 349

Query: 343 YANGSSTRYLSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTV 402
           YANG+ST YL + L VPVSC  TGVK+LH +AV  YD+GIYFEANGHGT+IFS  F   +
Sbjct: 350 YANGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI 409

Query: 403 SKRLKEGSLSAESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYT 462
            ++        E  +A++TL++FS+LINQTVGDA+SDM+ VLA L I KWTP+ W  E+T
Sbjct: 410 KEQ-------KERSVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFT 462

Query: 463 DLPNTLMKVVVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVR 522
           DLPN L KVVVPDRS+F TT+ ER+L  P+GLQ +ID+ +K +   RSFVRASGTEDAVR
Sbjct: 463 DLPNRLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVR 522

Query: 523 IYAEAATKEQADDLSIKISQLVISA 547
           +YAEAA+ E  + LS  + +LV+ +
Sbjct: 523 VYAEAASLEDVEKLSNTVKELVVKS 547

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/545 (52%), Positives = 367/545 (67%), Gaps = 28/545 (5%)

Query: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63
           E +  L +++C +R ++Y+YGTAGFR  +E LDTV+F TG++ACLRS  L G+ VG MIT
Sbjct: 3   EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62

Query: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADS 123
           ASHNP  DNGVK+V+P G ML Q WE  ATELAN  ++        L+++  + G     
Sbjct: 63  ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLAN------RPLEDIKAKVGQLTSG 116

Query: 124 EA----RIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQME 179
           E+    +++V RDSR SG  LL  LV   +   +  I DY +LTTPQLHFLT   N  M 
Sbjct: 117 ESSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMI 173

Query: 180 SERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFK 239
           +     V+E  Y++HFL A  ++  L  +  LP  +V+D ANG+GG K   L  +  F K
Sbjct: 174 TG--AHVDEQAYFAHFLGAWDQIAALQPVK-LPN-VVVDCANGIGGPKMSALLTQWGFAK 229

Query: 240 DSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYR 299
              ++IN    + +LLN  CGAD+VKT+Q LP G+    + N L+CSFDGDADRV+FYY 
Sbjct: 230 -QCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKP--NANDLYCSFDGDADRVVFYYL 286

Query: 300 DVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVP 359
           D +  FHLLDGDKISTLFA F   +L    +   + +GVVQTAYANGSST+YL + L VP
Sbjct: 287 DQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVP 346

Query: 360 VSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMAL 419
           VSCT TGVK+LH +AV NYD+GIYFEANGHGTV+FS  F+ TV+         A+    L
Sbjct: 347 VSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNH-------ADQTPEL 399

Query: 420 KTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLF 479
           K L+  +KLINQTVGDA+SDMMAVLAVL IL+W+P +WD E+TDLPN L KVVV DRS F
Sbjct: 400 KILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAF 459

Query: 480 KTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIK 539
            TT+ ER+LVSP GLQ +ID+ +    + RSFVRASGTEDAVR+YAEAAT+ + D LS  
Sbjct: 460 TTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSI 519

Query: 540 ISQLV 544
           +  LV
Sbjct: 520 VGDLV 524

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/533 (52%), Positives = 367/533 (68%), Gaps = 12/533 (2%)

Query: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63
           E++ KLYD  C ++  ++ YGTAGFR  A+ LDTV+F+TG+LA LRS+ L+GQYVG MIT
Sbjct: 6   EQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKH--QFLHRLQELMNQFGIKA 121
           ASHNP QDNGVK+V+P G ML   WE YA +LAN AS   +  +F   L +L+    I  
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDL 125

Query: 122 DSEA--RIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNR-QM 178
           ++     IVV RDSRES   LL+ L    +   +  ++D   +TTPQLH++T   NR ++
Sbjct: 126 NTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRKL 185

Query: 179 ESERVIEVNEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMKNT 236
           E +      E  YYS F+ A  EL   + +   L  P L ID ANG+GG + ++L     
Sbjct: 186 EGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASED 245

Query: 237 F--FKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRV 294
           +    +   +IN      +LLN  CGADYVKTNQ LP+G+S ++  +SL+CSFDGDADRV
Sbjct: 246 WDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSS-FDSLYCSFDGDADRV 304

Query: 295 IFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSE 354
           +FYY D    FHLLDGDKISTLFAKF    L +A ++ ++K+GVVQTAYANGSST Y+  
Sbjct: 305 VFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYIKN 364

Query: 355 VLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAE 414
            L  PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFSE F+ T+   L +  L+ +
Sbjct: 365 TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLNGD 424

Query: 415 SKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVP 474
           + +AL+TL+ FS+LINQTVGDA+SDM+AVLA L ILK +P  WD EYTDLPN L+K +VP
Sbjct: 425 T-LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIVP 483

Query: 475 DRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEA 527
           DRS+F+TT+ ER+L++P GLQ +ID V+  Y   RSFVRASGTEDAVR+YAE 
Sbjct: 484 DRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAEC 536

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/553 (51%), Positives = 366/553 (66%), Gaps = 37/553 (6%)

Query: 9   KLYDKHCCSRFK-YIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHN 67
           +LY+K+C +R + Y YGTAGFR  A ILD+V+FTTGV+A LRS+  +   VG MITASHN
Sbjct: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 68  PPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADSEARI 127
           PP+DNGVK+V+  G ML Q+WE  AT LAN  +D  H F   L  +M +  I      +I
Sbjct: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD-YHTFESTLNAIMQELNISPGHAPQI 122

Query: 128 VVARDSRESGSRLLKALVDGT-SVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEV 186
           VV  DSRES  RLL  L+DG  +V  +  I ++ +LTTPQLHFLT +             
Sbjct: 123 VVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAH---------- 172

Query: 187 NEAFYYSHFLSALKELTELFNIPGLPY--PLVIDAANGVGGAKAEELFMKNTFFKDS--- 241
            E +YY +FL A  +L EL+ I G      LVID ANG+GG +    F+K   +  +   
Sbjct: 173 FEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQ----FLKMLSYSQTDLP 228

Query: 242 ---------TTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDAD 292
                      I N +W    +LNS CGAD+VKTNQ LP+GI+A  D  +L+CSFDGDAD
Sbjct: 229 HLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINA--DPRNLYCSFDGDAD 286

Query: 293 RVIFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYL 352
           RV+FYY D    FHLLDGDKISTL A F  ++L  AG+ + +KLGVVQTAYANGSST Y+
Sbjct: 287 RVVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYV 346

Query: 353 SEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLS 412
           ++ L VPVS   TGVK+LH +AV NYD+G+YFEANGHGTVIFS++F   +  RL +   +
Sbjct: 347 TKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAK---N 403

Query: 413 AESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVV 472
           A  K  L      S+LINQT+GDA+SDM+A++ VL IL W+P  WD EYTDLPN L KVV
Sbjct: 404 AHDKSTLTLRLL-SRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVV 462

Query: 473 VPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQ 532
           VPDRS+F TT+ ER+LVSP GLQ +ID ++      RSF+RASGTEDAVR+YAEA T E 
Sbjct: 463 VPDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEA 522

Query: 533 ADDLSIKISQLVI 545
            + LS +++  +I
Sbjct: 523 TEKLSTEVTDALI 535

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  515 bits (1327), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 268/544 (49%), Positives = 362/544 (66%), Gaps = 13/544 (2%)

Query: 4   VEEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMI 62
           + ++   + K+C +R   Y YGTAGFR  A  LDTV+FTTG++A LRS+ L+G+Y+G MI
Sbjct: 4   ITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMI 63

Query: 63  TASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQ-FLHRLQELMNQFGIKA 121
           TASHNPPQDNGVK+V+P G ML + WE  AT+LAN AS G    F+  L +++ +  I  
Sbjct: 64  TASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDE 123

Query: 122 DSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESE 181
            +  R++V  DSRES   L++ L     VF  + ++++ ++TTPQLH+LT      ++++
Sbjct: 124 TTTPRLIVGHDSRESSPYLMECLQAAAPVFDTI-VINHTLITTPQLHYLT-----MLQND 177

Query: 182 RVIEVNEAFYYSHFLSALKELTELFNIPGLPYP-LVIDAANGVGGAKAEELFMKNTFFKD 240
            V EV+   YY  F ++   L  L+    L +  L++D ANGVG  +  +          
Sbjct: 178 VVTEVD---YYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLAT 234

Query: 241 STTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD 300
            TTIIN   +   +LN  CGAD+VKTNQ LP GI    + + L+ SFDGDADR++FYY D
Sbjct: 235 LTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGI-VNPNPSDLYASFDGDADRIVFYYVD 293

Query: 301 VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPV 360
            +  FHLLDGDKIST+  K   SML  + + +++ LGVVQTAYANGSST+Y+++ L VPV
Sbjct: 294 NNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPV 353

Query: 361 SCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALK 420
            CT TGVK+LH  A   +D+GIYFEANGHGTV+FS  F   + K +  GS S +   A  
Sbjct: 354 ECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARL 413

Query: 421 TLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFK 480
           +L  FSKLINQTVGD+M+D++AV+A L IL+ +P  WD EY DLPN L K  V +R +FK
Sbjct: 414 SLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFK 473

Query: 481 TTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKI 540
           TT+ ER+L SP GLQ +ID  +  YD+ RSFVRASGTEDAVRIYAEA TK + + LS ++
Sbjct: 474 TTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEV 533

Query: 541 SQLV 544
           +QLV
Sbjct: 534 TQLV 537

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  488 bits (1255), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 267/556 (48%), Positives = 355/556 (63%), Gaps = 35/556 (6%)

Query: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63
           E V  ++D  C ++ + Y YGTAGFR KA +LDTV+F TG +A LRS  L G  VG M+T
Sbjct: 4   EAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63

Query: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGK-HQFLHRLQELMNQFGIKAD 122
           ASHNPP+DNGVK+VDP+G ML ++WE  AT LAN A++G   Q+      L+ +      
Sbjct: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTGG 123

Query: 123 SEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTT--PQLHFLTYHLNRQMES 180
             AR+ V  D+RES  RLLK L+D     +   I       T  PQLH+LT      ++ 
Sbjct: 124 --ARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLT-----SLQR 176

Query: 181 ERVIEVNEAFYYSHFLSALKELTELFNIPGLPYP---LVIDAANGVGGAKAEELFMKNTF 237
           + V +   A Y  HF    ++L   F    + +P   L ID ANGVG  + ++ F     
Sbjct: 177 DGVTDA--AAYNDHFQGCWQKL---FPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAV 231

Query: 238 FKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLP------QGISAATDINSLHCSFDGDA 291
            ++   ++N ++   + LN  CGAD+VKTN  LP      +G S A  +  L+CSFDGDA
Sbjct: 232 DQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGA--LPDLYCSFDGDA 289

Query: 292 DRVIFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRY 351
           DR++FY+   +  FHLLDGDKISTLFAKF   +   AG  D + +GVVQTAYANG+STRY
Sbjct: 290 DRIVFYFVK-NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRY 348

Query: 352 LSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSL 411
           ++  L +P +CT TGVK+LH  A   YD+GIYFEANGHGTV+FS+ FN  V+        
Sbjct: 349 IASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAG------- 401

Query: 412 SAESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKV 471
            A +  A  TL  FSKLINQTVGDA++DM+ VLAVL  L+WTP+ W  EYTDLPN L KV
Sbjct: 402 VASTNDAASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKV 461

Query: 472 VVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKE 531
           VVPDRS+F+TT+ ER+LVSP+GLQ +ID  +  +  ARSFVRASGTE+AVRIY EA   +
Sbjct: 462 VVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQ 521

Query: 532 QADDLSIKISQLVISA 547
           +  +LS ++++ V+++
Sbjct: 522 EVQELSKQVTEAVLNS 537

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 25/90 (27%)

Query: 52  HLKGQYVGAMITASHNPPQDNGVKLVDPKG------------EMLKQEWEVYATE----- 94
           HL    VG MITASHNP  DNG K+    G            E +    E ++T+     
Sbjct: 143 HLNAS-VGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTK 201

Query: 95  -LANCASDGKHQFLHR------LQELMNQF 117
            L+N  +DGK +++ +      L  ++NQ 
Sbjct: 202 ILSNAETDGKIEYVRKRMLTSYLNSVVNQL 231

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (72%)

Query: 55  GQYVGAMITASHNPPQDNGVKL 76
           G  VG MITASHNP  DNG K+
Sbjct: 156 GASVGVMITASHNPKMDNGYKV 177

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 503 KSYDNARSFVRASGTEDAVRIYAEAATK--EQADDLS 537
           K Y++ R  +R SGTE  +++Y EA +K  E+A +L+
Sbjct: 571 KPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (72%)

Query: 55  GQYVGAMITASHNPPQDNGVKL 76
           G  VG MITASHNP  DNG K+
Sbjct: 154 GASVGVMITASHNPKMDNGYKV 175

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 13/66 (19%)

Query: 40  FTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVK--------LVDPK----GEMLKQE 87
           F    L     ++LK   VG MITASHNP  DNG K        ++ P      EM+++ 
Sbjct: 136 FVHTPLVPFSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKN 194

Query: 88  WEVYAT 93
            E ++T
Sbjct: 195 LEPWST 200

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (72%)

Query: 55  GQYVGAMITASHNPPQDNGVKL 76
           G  VG MITASHNP  DNG K+
Sbjct: 151 GASVGIMITASHNPKMDNGYKV 172

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 11/58 (18%)

Query: 19  FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVKL 76
           FK +Y   G        DT++ T   L      HL    VG MITASHNP  DNG K+
Sbjct: 126 FKVLYLNPG--------DTLVHTP--LVPFTVDHLNAS-VGVMITASHNPKMDNGYKV 172

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 51  MHLKGQYVGAMITASHNPPQDNGVKL 76
           ++L    +G MITASHNP  DNG K+
Sbjct: 150 INLYSASIGVMITASHNPEMDNGYKV 175

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 58  VGAMITASHNPPQDNGVKL 76
           VG MITASHNP  DNG K+
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 58  VGAMITASHNPPQDNGVKL 76
           VG MITASHNP  DNG K+
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 15/22 (68%)

Query: 55  GQYVGAMITASHNPPQDNGVKL 76
           G   G MITASHNP  DNG K+
Sbjct: 152 GASAGVMITASHNPKMDNGYKV 173

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 58  VGAMITASHNPPQDNGVKL 76
           VG MITASHNP  DNG K+
Sbjct: 151 VGVMITASHNPKMDNGYKV 169

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 40  FTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVKL 76
           F    L      HL    +G MITASHNP  DNG K+
Sbjct: 137 FVHTPLVPFSVNHLNAS-IGVMITASHNPKMDNGYKV 172

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (78%)

Query: 58  VGAMITASHNPPQDNGVKL 76
           VG M+TASHNP  DNG K+
Sbjct: 166 VGVMVTASHNPKMDNGYKV 184

>Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {ON}
           YNL182C (REAL)
          Length = 591

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 22  IYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVKLVDPKG 81
           +Y  AG  +K E ++  L    VL CL  +   G     + + SHN P+ N   L+    
Sbjct: 93  VYNLAG-SFKRESVEQRLPLPEVLKCLEVVQNTGVQYDRIESVSHNLPEFNLPYLLLGST 151

Query: 82  EMLKQE-WEVYATELANCASDGKHQFLHRLQELMN-QFGIKADSEARIVV 129
           E  K   WE+ +  L N      +Q + +++ ++N ++ I + +++R+++
Sbjct: 152 ESGKLYIWELNSGALLNVKPMAHYQSITKIKSILNGKYIITSGNDSRVII 201

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (78%)

Query: 58  VGAMITASHNPPQDNGVKL 76
           VG M+TASHNP  DNG K+
Sbjct: 151 VGVMVTASHNPKMDNGYKV 169

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 58  VGAMITASHNPPQDNGVKL 76
           VG MITASHNP  DNG K+
Sbjct: 147 VGVMITASHNPKLDNGYKV 165

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 15/22 (68%)

Query: 55  GQYVGAMITASHNPPQDNGVKL 76
           G   G MITASHNP  DNG K+
Sbjct: 160 GASCGIMITASHNPKMDNGYKV 181

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 36  DTVLFTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVKL 76
           D V+ T  V   +  +   G   G MITASHNP  DNG K+
Sbjct: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKV 174

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (77%)

Query: 59  GAMITASHNPPQDNGVKL 76
           G MITASHNP  DNG K+
Sbjct: 158 GVMITASHNPKDDNGYKV 175

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (77%)

Query: 59  GAMITASHNPPQDNGVKL 76
           G MITASHNP  DNG K+
Sbjct: 160 GVMITASHNPKMDNGYKV 177

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (77%)

Query: 59  GAMITASHNPPQDNGVKL 76
           G MITASHNP  DNG K+
Sbjct: 156 GIMITASHNPKMDNGYKV 173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,462,365
Number of extensions: 2460725
Number of successful extensions: 6829
Number of sequences better than 10.0: 43
Number of HSP's gapped: 6945
Number of HSP's successfully gapped: 44
Length of query: 551
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 436
Effective length of database: 40,294,809
Effective search space: 17568536724
Effective search space used: 17568536724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)