Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30126.9ON39739721190.0
ACR017W6.9ON42339313610.0
SAKL0E00814g6.9ON39840013220.0
Kpol_1045.786.9ON39237512571e-172
ZYRO0F00462g6.9ON39337412211e-167
NCAS0F001906.9ON41137512201e-166
KLTH0C11550g6.9ON39839612181e-166
NDAI0K029006.9ON43838812041e-164
Suva_5.126.9ON40139011841e-161
YEL056W (HAT2)6.9ON40139011841e-161
KLLA0D00814g6.9ON40839311811e-161
TDEL0G046206.9ON39237811771e-160
Skud_5.336.9ON40139511751e-160
Smik_5.316.9ON42739011751e-159
Kwal_56.223456.9ON39639411671e-159
KNAG0E009806.9ON41439811511e-156
TPHA0M001906.9ON39138111461e-156
CAGL0B03575g6.9ON41938411411e-154
KAFR0L003206.9ON39138711101e-150
TBLA0A071206.9ON40738510811e-145
TPHA0L017208.548ON4194103693e-39
TBLA0H036508.548ON4194193684e-39
KLTH0E12694g8.548ON4184073651e-38
ZYRO0A13068g8.548ON3974083612e-38
YBR195C (MSI1)8.548ON4224313614e-38
Kwal_27.120708.548ON4184083597e-38
Skud_2.3218.548ON4224203599e-38
SAKL0H09900g8.548ON4254143581e-37
Smik_2.3358.548ON4224213536e-37
NDAI0C055108.548ON4194213483e-36
Kpol_1024.398.548ON4174313474e-36
Suva_4.4498.548ON4244223474e-36
AEL250C8.548ON4174083465e-36
KLLA0E23541g8.548ON4174053449e-36
KNAG0A036708.548ON4264173431e-35
NCAS0B021708.548ON4144313404e-35
CAGL0M05291g8.548ON4194183361e-34
Ecym_70428.548ON4144143316e-34
KAFR0I008408.548ON4134223176e-32
TDEL0B029808.548ON4124083071e-30
NCAS0G011206.276ON4943111801e-13
KLLA0E04093g8.316ON3722801754e-13
KLTH0G12430g8.316ON3672761729e-13
TDEL0A068906.276ON4472191711e-12
Kpol_1060.246.276ON4861921693e-12
Kwal_56.238958.316ON3672731665e-12
Kpol_1048.598.544ON8502351685e-12
NDAI0F012406.276ON5243071632e-11
KAFR0B057008.316ON3722771593e-11
SAKL0H15708g8.316ON3682771593e-11
ZYRO0E08184g6.276ON5063411542e-10
Skud_3.1456.340ON5152771533e-10
Ecym_24986.340ON5422781524e-10
KNAG0I028406.340ON5192761524e-10
YCR072C (RSA4)6.340ON5152771524e-10
KAFR0A003802.401ON5163831515e-10
KLLA0E08449g2.283ON4221811506e-10
Smik_3.1726.340ON5152771508e-10
Kpol_1028.416.340ON5122741491e-09
Kpol_1036.658.316ON3712771471e-09
KAFR0F010606.276ON5532011491e-09
KNAG0F038707.534ON4651781472e-09
SAKL0F11506g7.356ON5681721472e-09
Ecym_42498.316ON3742801462e-09
TPHA0C008608.316ON3782821462e-09
KNAG0I009208.316ON3812851452e-09
KLTH0H02508gna 1ON3091661433e-09
YPL247C6.276ON5231661453e-09
NCAS0C027108.435ON8152201463e-09
Smik_4.457.310ON12702731463e-09
Skud_4.637.310ON12732701454e-09
SAKL0A02970g6.276ON4152981434e-09
KAFR0F043506.340ON5153021444e-09
ZYRO0A08690g2.401ON5162981435e-09
ADR242C2.401ON5212351435e-09
Ecym_60672.401ON5222991435e-09
TDEL0C023607.310ON12642921446e-09
Ecym_33212.283ON4092531426e-09
NDAI0I003506.340ON5153121427e-09
NCAS0B036908.288ON11452571437e-09
TDEL0A075506.340ON5152751428e-09
CAGL0A04037g7.356ON5831731428e-09
TPHA0G026502.401ON5163951418e-09
Smik_6.4516.276ON5231661418e-09
Skud_13.2912.401ON5093811411e-08
KNAG0I010508.288ON11592031421e-08
Kwal_56.236858.288ON11021471421e-08
Kpol_1019.307.310ON12522731411e-08
TBLA0F041306.340ON5142701401e-08
AGL190W8.316ON3702741391e-08
Suva_2.2918.288ON11512021411e-08
NCAS0B035508.316ON3752811381e-08
Suva_3.1096.340ON5152751392e-08
TBLA0C050107.356ON5721721392e-08
ZYRO0F05808g7.310ON12822921402e-08
ZYRO0D05852g8.316ON3712781372e-08
KLLA0E19515g7.356ON5721721392e-08
TPHA0D035906.276ON5983331392e-08
ZYRO0G20152g2.431ON3192491362e-08
YDL195W (SEC31)7.310ON12732691392e-08
SAKL0F10384g7.310ON12612881392e-08
Skud_4.4018.316ON3762801363e-08
KNAG0D007406.276ON5041621373e-08
TDEL0F044308.316ON3672981363e-08
Kwal_23.64296.363ON7502841373e-08
Suva_2.3038.316ON3772841363e-08
NCAS0F019702.401ON5112601363e-08
Kwal_56.244787.310ON12962821374e-08
CAGL0H00781g6.276ON5132601364e-08
AGL234W6.363ON6292671364e-08
KLTH0B03410g5.201ON4771681354e-08
YDR128W (MTC5)8.288ON11482021365e-08
AAR078W7.356ON5621821355e-08
Ecym_47177.356ON6031761355e-08
ZYRO0B02486g7.356ON5751731356e-08
TPHA0I018808.544ON10342411356e-08
Suva_4.537.310ON12712821357e-08
CAGL0B01529g8.316ON3692971328e-08
NCAS0E037507.310ON12762161349e-08
KLTH0H02772g6.276ON4201761321e-07
SAKL0B11836g2.613ON8092321331e-07
SAKL0D04796g1.247ON7691771331e-07
YMR131C (RRB1)2.401ON5113821321e-07
AAL157C5.201ON4791371311e-07
Smik_4.3748.288ON11522021321e-07
CAGL0K03861g2.401ON5133801311e-07
Ecym_70388.544ON8002441321e-07
TDEL0G033402.401ON5143811311e-07
Smik_13.3292.401ON5093811311e-07
NDAI0H027502.401ON5122681311e-07
ZYRO0D08206g6.340ON5151681311e-07
Skud_4.3898.288ON11512021322e-07
Skud_16.326.276ON5221661312e-07
Suva_16.606.276ON5261891312e-07
NCAS0D046106.340ON5152751302e-07
Kpol_530.257.356ON5741721302e-07
SAKL0E03960g2.431ON3202461282e-07
KNAG0E021802.401ON5171341302e-07
CAGL0D05588g5.201ON4771261292e-07
KLLA0F17237g2.401ON5233661293e-07
TPHA0M018306.340ON5152851293e-07
KLTH0A07282g6.363ON7252201303e-07
NCAS0G036001.399ON3272911283e-07
NCAS0A134307.231ON6082211293e-07
Kwal_23.63246.340ON5141541293e-07
TBLA0G014904.122ON7321941293e-07
NCAS0E028407.356ON6071721293e-07
NDAI0J011808.288ON11341941293e-07
Ecym_21396.276ON4352631283e-07
SAKL0A00660g6.363ON6602881284e-07
TBLA0B092502.401ON5262691284e-07
KLTH0F19294g3.25ON4512321274e-07
KAFR0E012303.259ON3692151265e-07
TPHA0A031007.310ON12653001285e-07
Kwal_33.151365.201ON4731261266e-07
TBLA0F042406.363ON7271641276e-07
KLLA0F15598g5.201ON4782131266e-07
KAFR0A064804.122ON5682071267e-07
KLTH0A06754g6.340ON5141541267e-07
YDR142C (PEX7)8.316ON3752811257e-07
TPHA0I032407.534ON4772391267e-07
TDEL0C019207.356ON5631731267e-07
Kwal_56.243326.276ON4181801257e-07
KLTH0A00880g7.534ON4712141257e-07
Smik_4.3868.316ON3762821257e-07
TBLA0B091002.431ON3172391248e-07
Suva_13.3112.401ON5103821258e-07
KAFR0L015207.356ON5841721259e-07
Suva_10.645.201ON4901321259e-07
KNAG0A025108.435ON8492141259e-07
ADL184W3.25ON4492251249e-07
NCAS0D047806.363ON6212211259e-07
KLLA0C08547g6.340ON5153281259e-07
Ecym_80617.310ON12282991251e-06
KLTH0G13068g8.288ON11011251251e-06
NCAS0F018502.431ON3182381231e-06
Smik_12.525.201ON4891321241e-06
ADR090W7.310ON12332841251e-06
Suva_13.2952.431ON3192461221e-06
Skud_13.2752.431ON3192461221e-06
Smik_13.3052.431ON3192461221e-06
YMR116C (ASC1)2.431ON3192461221e-06
TPHA0E030805.201ON4881851241e-06
Kwal_23.53517.534ON4742101231e-06
NCAS0A042702.431ON3182381221e-06
Skud_12.2858.435ON8172151241e-06
TPHA0C033702.283ON4132131222e-06
Skud_12.565.201ON4891861232e-06
Suva_10.3168.435ON8182151232e-06
Kpol_2001.657.322ON12062211242e-06
KLTH0E09394g2.401ON5221291222e-06
TBLA0B087303.25ON4612081222e-06
YLL011W (SOF1)5.201ON4891321222e-06
YLR222C (UTP13)8.435ON8173291232e-06
Sklu_YGOB_Anc_2.4012.401ON5202681222e-06
KAFR0H017508.435ON7832131222e-06
Kwal_47.178272.401ON5231291222e-06
NDAI0J010408.316ON3982161212e-06
Smik_7.2874.122ON5661941222e-06
Suva_16.1598.672ON4512301212e-06
ZYRO0D16742g7.231ON6082101222e-06
NDAI0H027102.431ON3182381202e-06
TDEL0A020702.431ON3192391202e-06
SAKL0H16390g8.288ON11401471223e-06
Suva_14.3112.283ON3891751203e-06
AGR180W8.435ON8062161213e-06
NDAI0A026107.231ON7671911213e-06
Ecym_20263.25ON4512271203e-06
Kpol_1061.364.122ON5892091213e-06
TBLA0D041307.231ON5741821203e-06
KLLA0D02530g4.309ON7071541213e-06
CAGL0J03476g6.340ON5171671203e-06
SAKL0C13266g3.25ON4592251203e-06
ZYRO0F07282g8.672ON4272451203e-06
TPHA0F030307.356ON5821711203e-06
AER263C6.340ON5131671203e-06
YKR036C (CAF4)1.247ON6431631203e-06
Kpol_2002.995.201ON4872451203e-06
Kpol_1013.377.534ON4681671204e-06
Smik_6.3488.672ON4512291194e-06
Skud_14.223.25ON4672381204e-06
KAFR0J009805.201ON4801931194e-06
AEL269C7.534ON4551831194e-06
AFL157C6.276ON4383451194e-06
ZYRO0D06556g8.288ON11471951204e-06
KAFR0L013207.310ON12402881204e-06
Kpol_297.72.431ON3182391184e-06
NDAI0A020907.322ON12002341205e-06
KLTH0G10296g2.283ON4261931195e-06
KLLA0E07085g3.25ON4522311195e-06
KAFR0H031401.399ON3032901175e-06
Suva_11.2681.247ON6451631195e-06
Suva_3.1216.363ON7002231195e-06
Ecym_60982.431ON3182391175e-06
SAKL0A01276g6.340ON5151751195e-06
NCAS0D027305.201ON4751931185e-06
TPHA0G023802.431ON3182491175e-06
TBLA0A023106.276ON5311901195e-06
Skud_14.2982.283ON3891901185e-06
SAKL0H06666g8.672ON4412481185e-06
Kpol_1003.342.283ON3881751186e-06
KAFR0B055808.288ON11201951196e-06
SAKL0H22396g4.122ON5551941186e-06
TDEL0A077806.363ON6572721186e-06
YNL317W (PFS2)3.25ON4652381186e-06
Kwal_27.115502.283ON4071761176e-06
NDAI0E044407.356ON5811701186e-06
Smik_14.143.25ON4662381186e-06
KLTH0E12606g8.544ON7551681186e-06
Suva_14.223.25ON4692381186e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3012
         (397 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   820   0.0  
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   528   0.0  
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   513   0.0  
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   488   e-172
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   474   e-167
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   474   e-166
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   473   e-166
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     468   e-164
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   460   e-161
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   460   e-161
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   459   e-161
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   457   e-160
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   457   e-160
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   457   e-159
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   454   e-159
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   447   e-156
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   446   e-156
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   444   e-154
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   432   e-150
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   421   e-145
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   146   3e-39
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   146   4e-39
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   145   1e-38
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   143   2e-38
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   143   4e-38
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   142   7e-38
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   142   9e-38
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   142   1e-37
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   140   6e-37
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   138   3e-36
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   138   4e-36
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   138   4e-36
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   137   5e-36
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   137   9e-36
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   136   1e-35
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   135   4e-35
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   134   1e-34
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   132   6e-34
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   126   6e-32
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   122   1e-30
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    74   1e-13
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    72   4e-13
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    71   9e-13
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    70   1e-12
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    70   3e-12
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    69   5e-12
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    69   5e-12
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    67   2e-11
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    66   3e-11
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    66   3e-11
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    64   2e-10
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    64   3e-10
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    63   4e-10
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    63   4e-10
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    63   4e-10
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    63   5e-10
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    62   6e-10
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    62   8e-10
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    62   1e-09
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    61   1e-09
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    62   1e-09
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    61   2e-09
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    61   2e-09
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    61   2e-09
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    61   2e-09
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    60   2e-09
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    60   3e-09
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    60   3e-09
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    61   3e-09
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    61   3e-09
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    60   4e-09
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    60   4e-09
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    60   4e-09
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    60   5e-09
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    60   5e-09
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    60   5e-09
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    60   6e-09
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    59   6e-09
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       59   7e-09
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    60   7e-09
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    59   8e-09
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    59   8e-09
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    59   8e-09
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    59   8e-09
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    59   1e-08
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    59   1e-08
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    59   1e-08
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    59   1e-08
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    59   1e-08
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    58   1e-08
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    59   1e-08
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    58   1e-08
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    58   2e-08
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    58   2e-08
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    59   2e-08
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    57   2e-08
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    58   2e-08
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    58   2e-08
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    57   2e-08
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    58   2e-08
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    58   2e-08
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    57   3e-08
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    57   3e-08
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    57   3e-08
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    57   3e-08
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    57   3e-08
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    57   3e-08
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    57   4e-08
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    57   4e-08
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    57   4e-08
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    57   4e-08
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    57   5e-08
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    57   5e-08
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    57   5e-08
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    57   6e-08
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    57   6e-08
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    57   7e-08
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    55   8e-08
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    56   9e-08
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    55   1e-07
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    56   1e-07
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    56   1e-07
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    55   1e-07
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    55   1e-07
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    55   1e-07
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    55   1e-07
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    55   1e-07
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    55   1e-07
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    55   1e-07
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    55   1e-07
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    55   1e-07
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    55   2e-07
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    55   2e-07
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    55   2e-07
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     55   2e-07
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    55   2e-07
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    54   2e-07
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    55   2e-07
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    54   2e-07
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    54   3e-07
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    54   3e-07
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    55   3e-07
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    54   3e-07
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    54   3e-07
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    54   3e-07
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    54   3e-07
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    54   3e-07
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    54   3e-07
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    54   3e-07
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    54   4e-07
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    54   4e-07
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    54   4e-07
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    53   5e-07
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    54   5e-07
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    53   6e-07
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    54   6e-07
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    53   6e-07
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    53   7e-07
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    53   7e-07
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    53   7e-07
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    53   7e-07
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    53   7e-07
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    53   7e-07
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    53   7e-07
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    53   7e-07
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    52   8e-07
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    53   8e-07
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    53   9e-07
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    53   9e-07
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    53   9e-07
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    52   9e-07
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     53   9e-07
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    53   9e-07
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    53   1e-06
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    53   1e-06
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    52   1e-06
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    52   1e-06
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    53   1e-06
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    52   1e-06
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    52   1e-06
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    52   1e-06
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    52   1e-06
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    52   1e-06
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    52   1e-06
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    52   1e-06
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    52   1e-06
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    52   2e-06
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    52   2e-06
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    52   2e-06
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    52   2e-06
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    52   2e-06
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    52   2e-06
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    52   2e-06
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    52   2e-06
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    52   2e-06
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    52   2e-06
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    52   2e-06
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    51   2e-06
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    52   2e-06
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    51   2e-06
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    52   2e-06
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    51   2e-06
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    51   2e-06
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    52   3e-06
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    51   3e-06
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    51   3e-06
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     51   3e-06
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    51   3e-06
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    51   3e-06
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    51   3e-06
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    51   3e-06
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    51   3e-06
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    51   3e-06
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    51   3e-06
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    51   3e-06
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    51   3e-06
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    51   3e-06
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    51   3e-06
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    51   4e-06
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    50   4e-06
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    51   4e-06
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    50   4e-06
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    50   4e-06
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    50   4e-06
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    51   4e-06
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    51   4e-06
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    50   4e-06
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    51   5e-06
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    50   5e-06
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    50   5e-06
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    50   5e-06
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    50   5e-06
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    50   5e-06
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    50   5e-06
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    50   5e-06
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     50   5e-06
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    50   5e-06
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    50   5e-06
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    50   5e-06
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    50   5e-06
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    50   6e-06
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    50   6e-06
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    50   6e-06
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    50   6e-06
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    50   6e-06
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    50   6e-06
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    50   6e-06
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    50   6e-06
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    50   6e-06
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    50   6e-06
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    50   7e-06
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    50   7e-06
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    50   7e-06
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      49   7e-06
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    50   8e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    50   8e-06
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    50   8e-06
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    50   8e-06
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    49   8e-06
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    50   8e-06
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    49   8e-06
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    50   8e-06
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    49   8e-06
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    50   8e-06
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    50   8e-06
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    49   9e-06
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    50   9e-06
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    50   9e-06
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    50   9e-06
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    49   1e-05
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    50   1e-05
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    49   1e-05
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    49   1e-05
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    49   1e-05
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    49   1e-05
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    49   1e-05
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    49   1e-05
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    49   1e-05
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    49   1e-05
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    49   1e-05
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    49   1e-05
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    49   1e-05
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    49   2e-05
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    49   2e-05
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    49   2e-05
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    49   2e-05
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    49   2e-05
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    49   2e-05
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    49   2e-05
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    48   2e-05
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    48   2e-05
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    49   2e-05
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    49   2e-05
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    49   2e-05
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    48   2e-05
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    49   2e-05
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    49   2e-05
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    49   2e-05
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    48   2e-05
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    48   3e-05
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    48   3e-05
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    48   3e-05
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    48   3e-05
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    47   3e-05
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    48   3e-05
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    48   3e-05
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    48   3e-05
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    48   3e-05
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    48   3e-05
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    48   3e-05
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    48   4e-05
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    48   4e-05
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    48   4e-05
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    48   4e-05
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    48   4e-05
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    48   4e-05
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              47   4e-05
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    48   4e-05
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    48   4e-05
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    47   4e-05
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    47   4e-05
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    47   4e-05
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    47   4e-05
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    47   4e-05
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             47   4e-05
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    47   5e-05
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    47   5e-05
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    47   5e-05
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    47   5e-05
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    47   5e-05
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    47   5e-05
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    47   5e-05
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    47   5e-05
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    47   6e-05
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    47   6e-05
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    47   6e-05
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    47   6e-05
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    47   7e-05
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    47   7e-05
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    47   7e-05
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    47   7e-05
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    47   7e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    46   7e-05
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    47   7e-05
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    47   8e-05
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    46   8e-05
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    47   8e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    47   8e-05
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    47   8e-05
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    47   9e-05
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    47   9e-05
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    46   9e-05
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    47   1e-04
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    46   1e-04
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    46   1e-04
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    46   1e-04
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    46   1e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    46   1e-04
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    46   1e-04
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    45   1e-04
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    46   1e-04
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    46   1e-04
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    46   1e-04
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     46   1e-04
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    46   1e-04
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    46   1e-04
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    46   1e-04
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    45   2e-04
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    45   2e-04
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    46   2e-04
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    45   2e-04
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    45   2e-04
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    45   2e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    45   2e-04
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    45   2e-04
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    46   2e-04
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    45   2e-04
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    45   2e-04
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    45   2e-04
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    45   2e-04
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    45   2e-04
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    45   2e-04
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    45   2e-04
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    45   2e-04
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    45   2e-04
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    45   3e-04
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    44   3e-04
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      45   3e-04
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    45   3e-04
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    44   3e-04
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    44   3e-04
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             45   3e-04
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    45   3e-04
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    45   3e-04
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    45   3e-04
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    45   3e-04
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    44   3e-04
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      45   3e-04
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    45   3e-04
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    45   3e-04
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    44   3e-04
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    44   3e-04
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    45   3e-04
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    45   4e-04
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    44   4e-04
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    45   4e-04
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    44   4e-04
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    45   4e-04
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    44   4e-04
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    44   4e-04
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    44   5e-04
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    44   5e-04
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    44   5e-04
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    44   5e-04
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    44   5e-04
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    44   5e-04
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    44   5e-04
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    44   5e-04
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    44   6e-04
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    44   6e-04
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    44   6e-04
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    44   6e-04
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    44   6e-04
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    44   6e-04
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    44   6e-04
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    44   6e-04
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    44   6e-04
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    44   7e-04
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    44   7e-04
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    44   7e-04
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    43   7e-04
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    44   7e-04
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    44   7e-04
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    44   7e-04
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    44   7e-04
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    44   7e-04
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    44   7e-04
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    43   7e-04
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    44   8e-04
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    43   8e-04
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    44   8e-04
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    44   8e-04
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    44   8e-04
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    43   9e-04
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    44   9e-04
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    44   9e-04
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    43   0.001
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    44   0.001
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    43   0.001
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    43   0.001
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    43   0.001
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    43   0.001
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    43   0.001
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    43   0.001
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    43   0.001
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    43   0.001
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    43   0.001
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    43   0.001
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    43   0.001
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    42   0.001
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    42   0.001
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    43   0.001
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    43   0.001
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    42   0.001
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    43   0.001
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    43   0.001
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    42   0.002
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    42   0.002
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    42   0.002
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    43   0.002
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    42   0.002
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    42   0.002
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    42   0.002
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    42   0.002
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    42   0.002
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    42   0.002
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    42   0.002
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    42   0.002
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    42   0.002
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    42   0.002
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    42   0.002
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    42   0.002
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    42   0.002
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    42   0.002
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    42   0.002
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    42   0.002
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    42   0.002
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    42   0.002
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    42   0.002
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    42   0.002
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    42   0.002
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    42   0.002
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    42   0.002
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    42   0.003
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    42   0.003
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    41   0.003
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               41   0.003
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    42   0.003
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    42   0.003
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    42   0.003
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    42   0.003
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    42   0.003
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    42   0.003
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    42   0.003
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    42   0.003
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    42   0.004
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    42   0.004
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    41   0.004
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    41   0.004
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    41   0.004
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    41   0.004
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    41   0.004
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    41   0.004
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    41   0.004
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    41   0.004
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    41   0.004
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    41   0.004
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    41   0.004
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     41   0.005
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    41   0.005
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    41   0.005
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    41   0.005
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       41   0.005
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    41   0.005
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    41   0.005
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    41   0.005
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    41   0.005
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    40   0.005
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      41   0.005
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    41   0.006
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    41   0.006
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    40   0.006
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    40   0.006
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    41   0.006
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    41   0.006
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    41   0.007
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    40   0.007
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    40   0.007
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     40   0.007
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    40   0.007
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    40   0.007
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    40   0.007
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    40   0.007
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    40   0.007
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    40   0.007
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    40   0.008
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    40   0.008
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    40   0.008
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    40   0.008
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               40   0.008
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    40   0.008
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    40   0.009
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    40   0.009
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    40   0.009
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    40   0.009
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    40   0.009
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    40   0.009
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    40   0.009
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    40   0.010
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    40   0.010
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    40   0.010
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    40   0.010
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    40   0.010
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    39   0.010
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    40   0.010
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    40   0.010
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    40   0.011
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    40   0.011
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    40   0.012
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    40   0.012
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    39   0.012
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    39   0.013
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    39   0.013
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    40   0.013
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    39   0.013
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    39   0.014
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    39   0.014
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    40   0.014
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    40   0.014
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    39   0.014
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    39   0.014
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    40   0.015
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    40   0.015
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    39   0.015
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    40   0.015
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    39   0.016
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    39   0.016
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     39   0.016
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    39   0.016
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               39   0.017
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    39   0.018
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    39   0.018
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    39   0.018
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    39   0.018
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    39   0.019
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    39   0.019
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    39   0.020
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               39   0.020
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    39   0.020
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    39   0.023
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    39   0.023
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    39   0.023
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    39   0.024
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    39   0.024
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    39   0.025
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    39   0.025
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    39   0.025
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    39   0.026
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    39   0.026
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    39   0.027
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    39   0.027
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    39   0.027
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    38   0.028
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    39   0.028
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    39   0.028
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    38   0.029
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    39   0.029
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    39   0.029
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    38   0.030
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    39   0.030
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    39   0.032
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    39   0.032
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    38   0.033
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    38   0.034
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    38   0.034
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    38   0.034
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    39   0.035
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     38   0.035
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    38   0.037
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    38   0.037
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    38   0.037
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    38   0.037
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    38   0.038
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    38   0.038
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    38   0.038
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    38   0.038
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    38   0.039
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    38   0.039
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    38   0.039
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    38   0.039
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    38   0.042
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    38   0.043
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    38   0.044
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    38   0.045
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    38   0.045
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    38   0.046
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    38   0.047
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    38   0.048
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    38   0.049
Smik_2.15 Chr2 complement(17939..21052) [3114 bp, 1037 aa] {ON} ...    38   0.050
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    37   0.051
TDEL0D02160 Chr4 complement(417281..419167) [1887 bp, 628 aa] {O...    38   0.053
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    38   0.054
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    38   0.055
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    37   0.058
KLTH0C09636g Chr3 (800421..802229) [1809 bp, 602 aa] {ON} weakly...    37   0.059
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    37   0.059
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    37   0.059
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    37   0.060
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    38   0.060
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    37   0.062
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    37   0.062
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    37   0.063
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    37   0.063
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    37   0.064
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    37   0.066
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    37   0.067
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    37   0.068
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    37   0.071
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    37   0.072
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    37   0.072
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    37   0.073
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    37   0.078
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    37   0.079
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    37   0.079
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    37   0.083
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    37   0.085
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    37   0.089
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    36   0.089
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    37   0.091
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    37   0.092
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               37   0.095
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    37   0.095
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    37   0.10 
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    37   0.10 
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    37   0.10 
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    37   0.11 
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    37   0.11 
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    37   0.11 
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    37   0.11 
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    36   0.11 
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    37   0.11 
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    36   0.12 
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    36   0.13 
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    36   0.13 
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    36   0.13 
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    37   0.13 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    36   0.13 
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    36   0.14 
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    36   0.14 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    36   0.14 
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    36   0.14 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    36   0.15 
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    36   0.15 
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    36   0.15 
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    36   0.16 
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    36   0.16 
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    36   0.16 
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    36   0.16 
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    36   0.16 
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    36   0.17 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    36   0.17 
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    36   0.17 
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    36   0.17 
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     36   0.17 
KLTH0H11286g Chr8 complement(965578..967500) [1923 bp, 640 aa] {...    36   0.17 
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    36   0.18 
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    36   0.18 
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    36   0.18 
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    36   0.18 
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    35   0.18 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    36   0.18 
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    36   0.18 
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    36   0.19 
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    35   0.19 
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    36   0.19 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    35   0.20 
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    36   0.21 
YBL104C Chr2 complement(18177..21293) [3117 bp, 1038 aa] {ON}  S...    36   0.21 
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    36   0.21 
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    35   0.22 
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    36   0.22 
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    36   0.22 
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    35   0.22 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    36   0.23 
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    36   0.23 
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    35   0.23 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    35   0.24 
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    35   0.24 
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    35   0.24 
SAKL0D07568g Chr4 complement(620394..622535) [2142 bp, 713 aa] {...    35   0.25 
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    35   0.25 
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    35   0.25 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    35   0.26 
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    35   0.26 
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    35   0.26 
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    35   0.29 
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    35   0.30 
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    35   0.30 
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    35   0.30 
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    35   0.31 
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    35   0.31 
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    35   0.32 
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    35   0.32 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    35   0.32 
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    35   0.34 
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    35   0.34 
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    35   0.35 
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    35   0.35 
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    35   0.36 
ZYRO0F13288g Chr6 (1089259..1092207) [2949 bp, 982 aa] {ON} simi...    35   0.37 
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    35   0.37 
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    35   0.38 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    35   0.39 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    35   0.39 
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    35   0.41 
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    35   0.41 
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    35   0.41 
Ecym_2327 Chr2 (639108..641045) [1938 bp, 645 aa] {ON} similar t...    35   0.41 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    35   0.41 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    35   0.42 
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    35   0.42 
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    35   0.43 
KLLA0F02255g Chr6 complement(200492..202426) [1935 bp, 644 aa] {...    35   0.45 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    35   0.45 
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    35   0.46 
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    35   0.47 
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    35   0.48 
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    34   0.49 
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    34   0.50 
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    34   0.50 
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    35   0.51 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    35   0.51 
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    34   0.52 
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    34   0.55 
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    34   0.55 
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    34   0.56 
Suva_2.13 Chr2 complement(21441..24557) [3117 bp, 1038 aa] {ON} ...    34   0.57 
NCAS0B07290 Chr2 (1378951..1380975) [2025 bp, 674 aa] {ON} Anc_1...    34   0.57 
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    34   0.57 
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    34   0.57 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    34   0.58 
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    34   0.59 
Ecym_2274 Chr2 (539468..540592) [1125 bp, 374 aa] {ON} similar t...    34   0.60 
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    34   0.60 
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    34   0.61 
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    34   0.61 
TDEL0A01650 Chr1 (298190..299332) [1143 bp, 380 aa] {ON} Anc_6.1...    34   0.63 
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    34   0.64 
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    34   0.65 
Kpol_1036.90 s1036 (235306..236667) [1362 bp, 453 aa] {ON} (2353...    34   0.65 
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    34   0.66 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    34   0.66 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    34   0.67 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    34   0.68 
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    34   0.70 
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    33   0.71 
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    34   0.72 
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    34   0.72 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    34   0.73 
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    34   0.73 
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    34   0.75 
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    34   0.75 
NCAS0D03400 Chr4 complement(635698..636840) [1143 bp, 380 aa] {O...    34   0.75 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    34   0.80 
Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON} (2401...    33   0.80 
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    34   0.80 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    34   0.80 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    34   0.81 
YFR029W Chr6 (210937..212973) [2037 bp, 678 aa] {ON}  PTR3Compon...    34   0.81 
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    33   0.85 
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    34   0.86 
Smik_7.344 Chr7 (571995..574040) [2046 bp, 681 aa] {ON} YFR029W ...    34   0.87 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    34   0.89 
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    33   0.91 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    34   0.91 
Skud_6.117 Chr6 (206279..208303) [2025 bp, 674 aa] {ON} YFR029W ...    33   0.91 
Kwal_0.82 s0 complement(38098..40035) [1938 bp, 645 aa] {ON} YFR...    33   0.93 
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    33   0.94 
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    33   0.98 
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    33   0.98 
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    33   0.99 
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   1.0  
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    33   1.0  
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    33   1.0  
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    33   1.0  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    33   1.0  
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    33   1.0  
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    33   1.1  
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    33   1.1  
Suva_6.102 Chr6 (177779..179791) [2013 bp, 670 aa] {ON} YFR029W ...    33   1.1  
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    33   1.1  
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    33   1.1  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    33   1.1  
ZYRO0B08910g Chr2 (698409..700400) [1992 bp, 663 aa] {ON} simila...    33   1.2  
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    33   1.2  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    33   1.2  
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    33   1.2  
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    33   1.2  
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    33   1.2  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    33   1.3  
ZYRO0C14762g Chr3 complement(1148438..1149568) [1131 bp, 376 aa]...    33   1.3  
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               33   1.3  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    33   1.4  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    33   1.4  
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    33   1.4  
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    33   1.4  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    33   1.4  
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    33   1.4  
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    33   1.5  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    33   1.5  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    33   1.5  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    33   1.5  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    33   1.5  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    33   1.5  
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    33   1.6  
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    33   1.6  
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    33   1.6  
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    33   1.6  
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    33   1.7  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    33   1.7  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    33   1.7  
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    33   1.7  
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    33   1.8  
Skud_2.5 Chr2 complement(8730..11846) [3117 bp, 1038 aa] {ON} YB...    33   1.8  
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    33   1.8  
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    33   1.8  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    33   1.8  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    32   1.8  
KNAG0A04990 Chr1 complement(726567..727844) [1278 bp, 425 aa] {O...    33   1.9  
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    32   1.9  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    33   1.9  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    33   2.0  
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    32   2.2  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    32   2.2  
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    32   2.2  
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    32   2.2  
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    33   2.2  
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    32   2.2  
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    32   2.2  
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    32   2.3  
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    32   2.3  
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    32   2.3  
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    32   2.3  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    32   2.4  
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               32   2.4  
TBLA0A04150 Chr1 (1027635..1029005) [1371 bp, 456 aa] {ON} Anc_8...    32   2.4  
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    32   2.4  
KAFR0C05660 Chr3 complement(1126734..1129262) [2529 bp, 842 aa] ...    32   2.5  
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    32   2.5  
CAGL0I03542g Chr9 (299881..301485) [1605 bp, 534 aa] {ON} simila...    32   2.6  
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    32   2.8  
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    32   2.8  
CAGL0K07095g Chr11 (698857..699972) [1116 bp, 371 aa] {ON} highl...    32   2.8  
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    32   2.9  
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    32   2.9  
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    32   3.0  
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    32   3.0  
KAFR0B05890 Chr2 (1215010..1216317) [1308 bp, 435 aa] {ON} Anc_8...    32   3.0  
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    32   3.0  
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    32   3.0  
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    32   3.1  
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    32   3.2  
KNAG0G01320 Chr7 (295446..296891) [1446 bp, 481 aa] {ON} Anc_8.1...    32   3.2  
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    32   3.3  
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    32   3.3  
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    32   3.3  
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    32   3.4  
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    32   3.4  
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    32   3.5  
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    32   3.5  
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    32   3.5  
ZYRO0F14146g Chr6 (1162473..1163828) [1356 bp, 451 aa] {ON} simi...    32   3.5  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    32   3.5  
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      32   3.6  
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    32   3.7  
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    32   3.9  
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    32   4.1  
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    31   4.2  
Suva_2.329 Chr2 (578891..580228) [1338 bp, 445 aa] {ON} YDR165W ...    32   4.3  
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    32   4.4  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    32   4.4  
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    32   4.5  
SAKL0A04554g Chr1 complement(419835..421073) [1239 bp, 412 aa] {...    31   4.5  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    32   4.6  
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    32   5.0  
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    31   5.1  
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    31   5.3  
TPHA0F02850 Chr6 complement(633867..635480) [1614 bp, 537 aa] {O...    31   5.3  
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    31   5.6  
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    31   5.6  
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    31   6.3  
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    31   6.4  
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    31   6.5  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    31   6.6  
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    31   6.7  
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    31   6.8  
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    31   6.9  
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    31   7.2  
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    31   7.3  
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    31   7.3  
AFR608W Chr6 (1536859..1538580) [1722 bp, 573 aa] {ON} Unclear i...    31   7.4  
KAFR0C00600 Chr3 (118397..120082) [1686 bp, 561 aa] {ON} Anc_3.2...    31   7.5  
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    31   7.7  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    30   7.9  
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    31   8.0  
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    31   8.1  
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    31   8.1  
CAGL0E00979g Chr5 complement(89783..91048) [1266 bp, 421 aa] {ON...    30   8.3  
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    30   9.0  
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    30   9.5  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    30   9.8  

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/397 (100%), Positives = 397/397 (100%)

Query: 1   MMEYEEIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ 60
           MMEYEEIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ
Sbjct: 1   MMEYEEIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ 60

Query: 61  QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRA 120
           QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRA
Sbjct: 61  QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRA 120

Query: 121 RYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSAS 180
           RYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSAS
Sbjct: 121 RYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSAS 180

Query: 181 DDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS 240
           DDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS
Sbjct: 181 DDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS 240

Query: 241 AQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFS 300
           AQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFS
Sbjct: 241 AQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFS 300

Query: 301 SHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQV 360
           SHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQV
Sbjct: 301 SHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQV 360

Query: 361 PWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397
           PWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE
Sbjct: 361 PWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/393 (63%), Positives = 302/393 (76%), Gaps = 4/393 (1%)

Query: 1   MMEYEEIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ 60
           M +YE+   D   LTV++EYELW SNV +MY+FVSETKLTWPSL+IQWLPS D   P  +
Sbjct: 29  MSDYEDDNTDVQSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSP--E 85

Query: 61  QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPV-KSMIKVTKKFEHEDEVIR 119
           Q +I GTHT+G+E NYLK+A I+LP  + GL   D   E    S   +  KF H +EVIR
Sbjct: 86  QSLIFGTHTAGEEVNYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIR 145

Query: 120 ARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSA 179
           ARYMP N  IIATINGKG I I+DR+  +S+    TL++HK+NGYGLAFNP I GELLS 
Sbjct: 146 ARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSG 205

Query: 180 SDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSN 239
           SDDTTVALWDI +  +P SI+ +H DIVND KWHEF+ N+FGTVSEDKTLQVHDKR    
Sbjct: 206 SDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLE 265

Query: 240 SAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEF 299
             + LP   P N L+FSKHS+NL+AAAG D+++YLYD+R +S PLH M+GHQD+VT++EF
Sbjct: 266 PVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEF 325

Query: 300 SSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ 359
           S H DGI+CSSGSDRR  IWDLTQIGAEQ+Q+DADDG PELMMMHAGHRS +N+FSFNPQ
Sbjct: 326 SPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQ 385

Query: 360 VPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
           +PWL+AS EEDNV+Q WK+S KLV+   P  +D
Sbjct: 386 IPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/400 (61%), Positives = 313/400 (78%), Gaps = 13/400 (3%)

Query: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILG 66
           IE +   L++++EYELWK+NV LMYDFVSETKLTWPSL+IQWLP    N    +QEMILG
Sbjct: 3   IEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLP---GNSSSTKQEMILG 59

Query: 67  THTSGDENNYLKIAAIDLPYEVVGLP--------DEDNSSEPVKSMIKVTKKFEHEDEVI 118
           THTSG+++NYLKIA+I+LP +++G          +E      V+S IK+TKK +HE+E+ 
Sbjct: 60  THTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEIT 119

Query: 119 RARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLS 178
           RAR+MP++   IATING GK+F++DRSK K+E L    ++HKDNGYGL+FNP+ +GELLS
Sbjct: 120 RARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLS 179

Query: 179 ASDDTTVALWDINSTD-RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSL 237
            SDD T+ALW++  T+  P   V  H DIVND  WHEF+EN+FG+VSEDKTLQ+HDKR+ 
Sbjct: 180 CSDDGTIALWNVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT- 238

Query: 238 SNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSI 297
           +++   L +  P N L FSKHS+NL AAAGTD+ VYLYDLR  ++ LHTM+GH+D+VTS+
Sbjct: 239 NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSL 298

Query: 298 EFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFN 357
           EFS HKDGILCSSGSDRR+ +WDL QIG+EQAQEDA DGVPELMMMHAGH+SA+NDFSFN
Sbjct: 299 EFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFN 358

Query: 358 PQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397
             +PWL+AS EEDN+V VWK+SKKL S  + +  D++SLE
Sbjct: 359 WNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  488 bits (1257), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 235/375 (62%), Positives = 291/375 (77%), Gaps = 8/375 (2%)

Query: 11  ESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS 70
           E PLTVDQEYELWK+NV LMYDFVSET+LTWPSL+ QWLP  + +    +Q MILGTHTS
Sbjct: 8   EEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDT---RQYMILGTHTS 64

Query: 71  GDENNYLKIAAIDLPYEVV-GLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKI 129
           G+E +YLK+AA+DLP EVV G  ++DN     KS IK+ KKFEH+ E+ RARYMPK+  I
Sbjct: 65  GEEVDYLKVAALDLPDEVVTGEANDDNRR--TKSNIKIVKKFEHDGEINRARYMPKDSNI 122

Query: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189
           IATING+G + IYDRSKS+S+GL  TL YHK+NGYGL+FNP +  EL+S SDD T+ALWD
Sbjct: 123 IATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWD 182

Query: 190 INSTDR-PVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE 247
           I+S  + P S+  N H+DIVND  WH FDEN+FG+VSED TL++HDKRS S     +  +
Sbjct: 183 IDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK 242

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
              N LAFSKHS NL AAAG DT +YLYD R+ ++PLH MAGH+DA+T ++F   +DGIL
Sbjct: 243 AAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGIL 302

Query: 308 CSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASA 367
            S G+DRR+ +WDL +IGAEQ  ++ADDG PE++M+HAGHRSAINDF+ +P +PWL AS 
Sbjct: 303 VSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASV 362

Query: 368 EEDNVVQVWKISKKL 382
           EEDNVVQVWK SK L
Sbjct: 363 EEDNVVQVWKCSKNL 377

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  474 bits (1221), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 223/374 (59%), Positives = 284/374 (75%), Gaps = 5/374 (1%)

Query: 11  ESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS 70
           E PL++D+EY+LWKSNV LMYDFVSET LTWPSL+++WLP   ++    +QEMILGTHTS
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS---NRQEMILGTHTS 64

Query: 71  GDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKII 130
            +E NYLKIAAI LP EVV   +     E +KS +K+ KKFEHE+EV RARYMP++D +I
Sbjct: 65  DEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLI 124

Query: 131 ATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDI 190
           ATI+G G I++Y+R+     GL  T  +H +NGYGL+FNP  +G+LLS SDD+ + LWD+
Sbjct: 125 ATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV 184

Query: 191 NS-TDRPV-SIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
              +  P+ +    H+DIVND KWH FD+NIFG+VSED TLQ+HD+R    + + +  +K
Sbjct: 185 TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKK 244

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
           P N LAFS HS NL AAAGTD+ VYLYD RR S+PLH M GH+DAVTS+EF   +DG+L 
Sbjct: 245 PYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLI 304

Query: 309 SSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAE 368
           S+GSDRR  +WDL +IGAEQ  +DADDG PE+MM+HAGHRS+INDFS NP +PWL A+AE
Sbjct: 305 SAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAE 364

Query: 369 EDNVVQVWKISKKL 382
           E+N+VQVWK S KL
Sbjct: 365 EENIVQVWKPSSKL 378

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  474 bits (1220), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 221/375 (58%), Positives = 283/375 (75%), Gaps = 6/375 (1%)

Query: 14  LTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGDE 73
           L++D+EYELW+SNV LMYDFVSET+LTWPSLS++WLP   +     +QE+I+GTHTSG+E
Sbjct: 22  LSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSGEE 81

Query: 74  NNYLKIAAIDLPYEVV----GLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKI 129
           +NYLKIAAIDLP +++     L D+       KS IK+ KKF+HE+E+ RARYMP+N  +
Sbjct: 82  DNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFKHEEEITRARYMPQNSNL 141

Query: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189
           +ATING GK+F+YDRSK K  GL  T  YHK+NGYGL+FN    G+LLS SDD T+ALW+
Sbjct: 142 VATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWN 201

Query: 190 IN-STDRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE 247
           +N S   P+ +  + H+DIVND KW  FD N+FG+VSED TLQ+HD+R          V+
Sbjct: 202 VNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVD 261

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
            P N LAFSKHS+ L AAAGTD+ VYL+D R +S PLH+MAGH  AVT++EFS  +DGIL
Sbjct: 262 APFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGIL 321

Query: 308 CSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASA 367
            +SG DRR  IWD+  IG EQ  +DA+DG PE++M+HAGHRSAINDFS NP +PWL+AS+
Sbjct: 322 MTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASS 381

Query: 368 EEDNVVQVWKISKKL 382
           EE+N++QVWK S KL
Sbjct: 382 EEENIIQVWKCSHKL 396

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  473 bits (1218), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 235/396 (59%), Positives = 293/396 (73%), Gaps = 13/396 (3%)

Query: 11  ESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS 70
           E+ ++VD+EY+LWKSNV LMYDFVSETKL WPSL+IQWLPS D +    +QE+ILGTHTS
Sbjct: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS---NEQELILGTHTS 63

Query: 71  GDENNYLKIAAIDLPYEVVG-----LPDEDNSSEP---VKSMIKVTKKFEHEDEVIRARY 122
           G E NYLKIA++ LP EVV       P  D+S E     +S IK+ +KFEH DEV RARY
Sbjct: 64  GTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARY 123

Query: 123 MPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDD 182
            P N  +IATI+G GK+F+YDRSK     L    S+HK+NGYGL F+    GELLS SDD
Sbjct: 124 APFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDD 183

Query: 183 TTVALWDINS-TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSA 241
            ++A+WD+ S  + PV +  +H +IVN+ KWHE    +FG+VS+D TL +HDKR      
Sbjct: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243

Query: 242 QVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSS 301
           ++L  E P N LAFSKHS NL AAAGTD++V LYDLR+   P+H+M+GH D+VTS+EF+ 
Sbjct: 244 KILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAP 302

Query: 302 HKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVP 361
           HKDGILCS  SDRR+ IWDL QIGAEQ QEDADDGVPEL+MMHAGH+S +NDFS +P +P
Sbjct: 303 HKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIP 362

Query: 362 WLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397
           WL+AS EE+NVVQ+WK SKKL S  IP   +++SLE
Sbjct: 363 WLMASVEEENVVQIWKASKKLTSPYIPRDYNIRSLE 398

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  468 bits (1204), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 225/388 (57%), Positives = 295/388 (76%), Gaps = 20/388 (5%)

Query: 14  LTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPL-KQQEMILGTHTSGD 72
           LT+D+EY+LWKSNV LMYDFVSETKLTWP+L+++WLPS  ++ P+  +QE+ILGTHTSG+
Sbjct: 37  LTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE 96

Query: 73  ENNYLKIAAIDLPYEVVGLPDEDN-------------SSEPVKSMIKVTKKFEHEDEVIR 119
           E+NYLKIAAIDLP EVV  P  ++               +  +S IK+ KKF+HE+E+ R
Sbjct: 97  EDNYLKIAAIDLPDEVVQ-PSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEITR 155

Query: 120 ARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSA 179
           AR+MP+N  IIATING G +FIY++S  K   L  TL +HK+NGYGL+FNP  +G+LLS 
Sbjct: 156 ARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSG 215

Query: 180 SDDTTVALWDI--NST--DRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDK 234
           SDD T+ALWDI  NST   +P+ I  + H DIVND KW+EF+ N+F +VSED TLQ+HD+
Sbjct: 216 SDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275

Query: 235 RSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAV 294
           R  +     +    P N LAFSKHS+ L+AAAGTD+ VYLYD R LS PL++M GH+D++
Sbjct: 276 REQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSI 335

Query: 295 TSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDF 354
           T++EFS H DG+L SSG+DRR+ +WD+  IGAEQ  +DA+DG PE++M+HAGHRSA+NDF
Sbjct: 336 TNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDF 395

Query: 355 SFNPQVPWLIASAEEDNVVQVWKISKKL 382
           S NP +PWL+ASAEE+N++QVWK S KL
Sbjct: 396 SINPNIPWLMASAEEENIIQVWKCSHKL 423

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  460 bits (1184), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 222/390 (56%), Positives = 292/390 (74%), Gaps = 18/390 (4%)

Query: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSV--DANVPLKQQEMI 64
           +E  E PL+VD+EY+LWKSNV LMYDFVSET+LTWPSL++QWLP+   +      +QE+I
Sbjct: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60

Query: 65  LGTHTSGDENNYLKIAAIDLPYEVVGLPD-------EDNSSEPV-KSMIKVTKKFEHEDE 116
           +GTHTSG+E NYLK A I+LP E++   D       +D  S P  +S IK+T K++HE+E
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120

Query: 117 VIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGEL 176
           + RARYMP+N   +ATING+G +FIY    S+SEGL  TL +H++NGY L+F+P +EG L
Sbjct: 121 ITRARYMPQNPGTVATINGQGTVFIY----SRSEGLQSTLKFHEENGYALSFSPLVEGLL 176

Query: 177 LSASDDTTVALWDINS---TDRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232
           LS SDD TVALWD+N    + RP+    + H+DIVNDSKWH F++++FGTVSED  L+++
Sbjct: 177 LSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236

Query: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
           D R  + +       +P N LAFS HS NL+AAAGTD+ VYLYDLR + EPLH M+GH+D
Sbjct: 237 DLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHED 296

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN 352
           AVT++EFS H DG++ SSGSD RL +WDL QIGAEQ  +DA+DGVPEL+M+HAGH+SA+N
Sbjct: 297 AVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVN 356

Query: 353 DFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
           DF  N Q+PWL+AS EE+N++QVWK S  L
Sbjct: 357 DFDLNAQIPWLVASTEEENILQVWKCSHSL 386

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  460 bits (1184), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/390 (56%), Positives = 294/390 (75%), Gaps = 18/390 (4%)

Query: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSV--DANVPLKQQEMI 64
           +E+ E PL+VD+EY+LWKSNV LMYDFVSET+LTWPSL++QWLP+   + +    +QE+I
Sbjct: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60

Query: 65  LGTHTSGDENNYLKIAAIDLPYEVVGLPD-------EDNSSEPV-KSMIKVTKKFEHEDE 116
           +GTHTSG+E NYLK A I+LP E++   D       E  SS P  +S I++T K+EHE+E
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120

Query: 117 VIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGEL 176
           + RARYMP++  I+ATING+G +F+Y    S+SEGL  TL +HKDNGY L+F+  ++G L
Sbjct: 121 ITRARYMPQDPNIVATINGQGTVFLY----SRSEGLQSTLKFHKDNGYALSFSTLVKGRL 176

Query: 177 LSASDDTTVALWDINSTDRPVSIVMN----HTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232
           LS SDD TVALW++ S   P   V      H+DI+ND+KWH F++++FGTVSED  L+++
Sbjct: 177 LSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIN 236

Query: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
           D R+ + +   +   +P N LAFS HS NL+AAAG D+ VYLYDLR + EPLH M+GH+D
Sbjct: 237 DVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHED 296

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN 352
           AV ++EFS+H DG++ SSGSD RL +WDL QIGAEQ  +DA+DGVPEL+M+HAGHRS++N
Sbjct: 297 AVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVN 356

Query: 353 DFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
           DF  NPQ+PWL+ASAEE+N++QVWK S  L
Sbjct: 357 DFDLNPQIPWLVASAEEENILQVWKCSHSL 386

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 228/393 (58%), Positives = 287/393 (73%), Gaps = 17/393 (4%)

Query: 6   EIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPS------VDANVPLK 59
           E+E  E P T+++EY+LW SNV +MYDFVSET+LTWPSL++QWLP+      VD    L+
Sbjct: 3   EVEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLR 62

Query: 60  QQEMILGTHTSGDENNYLKIAAIDLPYEV------VGLPDEDNSSEPVKSMIKVTKKFEH 113
           Q E+++GT T+ +E NYLKIAAIDLP  V      V    ++N     +S IK+ +KF+H
Sbjct: 63  Q-ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKH 121

Query: 114 EDEVIRARYMPKNDKIIATINGKGKIFIYDRS-KSKSEGLCKTLSYHKDNGYGLAFNPQI 172
           E EV RARYMP++  IIAT+NG G ++I+DR+ K K  G   + SYHK+NGYGLAFNP +
Sbjct: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181

Query: 173 EGELLSASDDTTVALWDINST--DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQ 230
            G+LLSASDD TVALWD+ ST    P      HTDIVND KWHEF  ++FGTVSED TL 
Sbjct: 182 SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241

Query: 231 VHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGH 290
           +HD  S   + Q L V    N LAFSK S+NL+AAAGTD+ VYLYDLRRL +PLH+MAGH
Sbjct: 242 IHDTNS-DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGH 300

Query: 291 QDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSA 350
           +D+VTS+EFS H+DG+L SSGSDRR+ +WDL  IGAEQ  +DA DGVPEL MMH GHRS 
Sbjct: 301 EDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSP 360

Query: 351 INDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
           +N+FS N  VPWL+ S EE+NV+Q+WK + K+V
Sbjct: 361 VNEFSHNSNVPWLMCSVEEENVLQIWKPANKIV 393

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  457 bits (1177), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/378 (58%), Positives = 282/378 (74%), Gaps = 7/378 (1%)

Query: 8   EHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGT 67
           E  + PL++D+EYELW+SNV LMYDFVSET LTWP+L+++WLP    N    +QE+ILGT
Sbjct: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLP---GNSHSNRQELILGT 60

Query: 68  HTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKND 127
           HTS +E NYLKIAAIDLP E+V   ++       KS IK+ KKF+HE EV RARYMP++ 
Sbjct: 61  HTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDS 120

Query: 128 KIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVAL 187
            +IATING G +F+YDRSK   EGL  +L +H+DNGYGL+FNP  +G+LLS SDD+ +AL
Sbjct: 121 NLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIAL 180

Query: 188 WDI--NSTDRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
           WDI  NST +PVS   + H D VND KWHE + N FG+VSED TLQ+HD+R   +    +
Sbjct: 181 WDITTNST-KPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKI 239

Query: 245 PVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKD 304
                 N +AFSKHS NL AAAGTD+ +YLYD RR    LHTM+GH+  VT++EF + KD
Sbjct: 240 KTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKD 299

Query: 305 GILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
           GI+ SSG DRR+ +WDL +IGAEQ  +DADDG PE++M+HAGHRS +NDFS NP +PWL+
Sbjct: 300 GIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLM 359

Query: 365 ASAEEDNVVQVWKISKKL 382
           ASAEE+N+VQVWK S KL
Sbjct: 360 ASAEEENIVQVWKCSSKL 377

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  457 bits (1175), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 219/395 (55%), Positives = 291/395 (73%), Gaps = 28/395 (7%)

Query: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ------ 60
           +E  E PL+VD+EY+LWKSNV LMYDFVSET+LTWPSL++QWLP+     P++Q      
Sbjct: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPT-----PVQQPKGGFI 55

Query: 61  -QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSE--------PVKSMIKVTKKF 111
            QE+I+GTHTSG+E NYLK A I+LP EV+   +    +E        P +S I++T K+
Sbjct: 56  KQELIIGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKY 115

Query: 112 EHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQ 171
           EHE+E+ RARYMP++  ++ATING+G +F+Y    S+S+GL  TL +HKDNGY L+F+P 
Sbjct: 116 EHEEEITRARYMPQDPNMVATINGQGTVFLY----SRSDGLQSTLKFHKDNGYALSFSPL 171

Query: 172 IEGELLSASDDTTVALWDINSTDRPVSIVMN----HTDIVNDSKWHEFDENIFGTVSEDK 227
           I+G LLS SDD +VALWD++      + +      H+DIVNDSKWH F++++FGTVSED 
Sbjct: 172 IKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDS 231

Query: 228 TLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTM 287
            L+++D R+ + +       +P N LAFS HS N++AAAG D+ VYLYDLR + EPLH M
Sbjct: 232 LLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHM 291

Query: 288 AGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGH 347
           +GH+DAVT++EFS H DG++ SSGSD RL +WDL QIGAEQ  +DA+DGVPEL+M+HAGH
Sbjct: 292 SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH 351

Query: 348 RSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
           RSA+NDF  N QVPWLIAS EE+N++QVWK S  L
Sbjct: 352 RSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  457 bits (1175), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/390 (55%), Positives = 286/390 (73%), Gaps = 18/390 (4%)

Query: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPS--VDANVPLKQQEMI 64
           +E  E  L+VD+EY+LWKSNV LMYDFVSET+LTWPSLS+QWLP+   +A     +QE+I
Sbjct: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86

Query: 65  LGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSE--------PVKSMIKVTKKFEHEDE 116
           +GTHTSG+E NYLK A I++P E++   D    +E          KS I++T K+ HE+E
Sbjct: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146

Query: 117 VIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGEL 176
           + RARYMP+N   +AT+NG+G +F+Y RS     GL  TL +HKDNGY L+FN  +EG+L
Sbjct: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEGQL 202

Query: 177 LSASDDTTVALWDINSTDRPVSIVMN----HTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232
           LS SDD TVALW++ S    +S V      H+DIVND KWH F+E +FGTVSED  L+++
Sbjct: 203 LSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN 262

Query: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
           D R+ + +   +   +P N LAFS HS NL+AAAG D+ VYLYDLR + EPLH M+GH+D
Sbjct: 263 DVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHED 322

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN 352
           AVT+IEFS+H DG++ SSGSD RL +WDL QIGAEQ  +DA+DGVPEL+M+HAGHRS++N
Sbjct: 323 AVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVN 382

Query: 353 DFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
           DF  N Q+PWL+AS+EE+N++QVWK S  L
Sbjct: 383 DFDLNAQIPWLVASSEEENILQVWKCSHNL 412

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 228/394 (57%), Positives = 293/394 (74%), Gaps = 11/394 (2%)

Query: 11  ESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS 70
           E  L++D EY+LWKSNV LMYDFVSET+L WPSL+IQWLP  + +    +QE+++GTHTS
Sbjct: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDST---EQELLVGTHTS 63

Query: 71  GDENNYLKIAAIDLPYEVVG-----LPDEDNSS-EPVKSMIKVTKKFEHEDEVIRARYMP 124
             E NYLKIA I+LP E++      L +++N S E V S IK+ KKF+HE+EV RARY P
Sbjct: 64  DSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAP 123

Query: 125 KNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184
            +  +IATI+G G +F+YDR+K     L    +YHK+NGYGL F+    GEL+S SDD +
Sbjct: 124 FDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGS 183

Query: 185 VALWDINSTDR-PVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQV 243
           +A+WDI S    P S+   H+DIVN+ KWHE D NI+G+VSED  L +HDKRS     Q 
Sbjct: 184 IAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRS-EKPLQK 242

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHK 303
           L  ++P N +AFSKHS NL AAAGTD  VYL+D R+ +E LH+M+GHQ+AVTS+EF+ HK
Sbjct: 243 LLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHK 302

Query: 304 DGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWL 363
           DGILCS GSDRR+ +WDL QIG EQ +EDADDG PEL+MMHAGH+SAINDFSF+P VPWL
Sbjct: 303 DGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWL 362

Query: 364 IASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397
           +AS EE+N+VQ+WK S+KL +   P+  D++SLE
Sbjct: 363 MASVEEENIVQIWKPSRKLTNPYFPQGYDIRSLE 396

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  447 bits (1151), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/398 (55%), Positives = 289/398 (72%), Gaps = 9/398 (2%)

Query: 2   MEYEEIEHDES-PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ 60
           ++ +++  DE+ PL   +EY+LWKSNV +MYDFVSET+L WPSL++QWLP    N P+ +
Sbjct: 18  IDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPN-PVTR 76

Query: 61  QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPD-EDNSSEPVKSMIKVTKKFEHEDEVIR 119
           QE+ILGTHTS +E NYLKIA +DLP EV    +  ++  E V+S I+VT+KF+H+ EV R
Sbjct: 77  QELILGTHTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTR 136

Query: 120 ARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSA 179
           ARYMP++  I+ATI+G G ++IYDRS  +      TL YH DNGYGLAFNP I+G LLS 
Sbjct: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTA-SITLQYHTDNGYGLAFNPLIKGHLLSG 195

Query: 180 SDDTTVALWDINS-TDRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSL 237
           SDD+ VALWD+ S  + PV    N H+DIVND +WH F +++FGTVSED +LQ+HD R  
Sbjct: 196 SDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE- 254

Query: 238 SNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSI 297
           S     +   KP N L+FS HS+NL+A  G ++ VYLYD R + EPLH M+GH DAVTS+
Sbjct: 255 SKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSL 314

Query: 298 EFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFN 357
           +FSS  DGI+ S+G+D+R+ IWD+  IGAEQ  EDA+D   E+MM+HAGHRS INDF+ N
Sbjct: 315 DFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAIN 374

Query: 358 PQVPWLIASAEEDNVVQVWKISKKL--VSNIIPEYTDL 393
           P +PWL+ASAEE+N+VQ+WK S KL  +S   P   D+
Sbjct: 375 PSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDM 412

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  446 bits (1146), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/381 (57%), Positives = 280/381 (73%), Gaps = 9/381 (2%)

Query: 5   EEIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMI 64
           E++E  E PLTVDQEY+LWKSNV L+YDFVSET+LTWPSL++QWLP    +    +Q +I
Sbjct: 2   EKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTST---RQHLI 58

Query: 65  LGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMP 124
           LGT TSG E +YLKIAA+DLP E++     D   + VKS +KV KKF H+ E+ RARYMP
Sbjct: 59  LGTLTSGAETDYLKIAALDLPDEIIIGKKSD---KVVKSNLKVVKKFAHDGEINRARYMP 115

Query: 125 KNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184
           +N  IIAT+NG+G IFIYD S+ K   L  TL YHKDN YGLAFNP  EGEL+S SDD+T
Sbjct: 116 QNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDST 175

Query: 185 VALWDI--NSTDRPVS-IVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSA 241
           +ALWD   +   +P+     +H+DIVND +WH F+ N+FG+VSED TLQ+ DKR+   S 
Sbjct: 176 IALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSD 235

Query: 242 QVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSS 301
             +  +   N++AFS  S+NL AAAGT   +YLYD+R   + LH+M GH++ VTS+EFS+
Sbjct: 236 VKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSN 295

Query: 302 HKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVP 361
            KDGIL S  SDRR+ +WDL +IGAEQ  ++ADDG+PE+MM+HAG RSAIND S +P +P
Sbjct: 296 DKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIP 355

Query: 362 WLIASAEEDNVVQVWKISKKL 382
           WL AS EE+N+VQVWK S KL
Sbjct: 356 WLNASVEENNIVQVWKCSSKL 376

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  444 bits (1141), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/384 (55%), Positives = 280/384 (72%), Gaps = 20/384 (5%)

Query: 13  PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGD 72
           P+TVD+EYELWKSNV ++YDFVSET+LTWP+L+++WLP  +      +Q++ILGTHTSG+
Sbjct: 27  PMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGE 86

Query: 73  ENNYLKIAAIDLPYEVVGLPDEDNSSEP----------VKSMIKVTKKFEHEDEVIRARY 122
           E NYLKI A+DLP EV      +NS +           V S +K+ KKF H+ E+ RARY
Sbjct: 87  EQNYLKIGAVDLPVEVT-----ENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARY 141

Query: 123 MPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDD 182
           MP++D IIATING+GKIFIYDRSK+  E L  TL YH +NGYGLAFN   +  LLS SDD
Sbjct: 142 MPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDD 201

Query: 183 TTVALWDINSTDRPVSIVMN----HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLS 238
           + +ALWDI++ ++ +   +     HTDI+ND KWH  + +IFG+VSED T+++ DKRS S
Sbjct: 202 SNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRS-S 260

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
                +  +KP N LAFS  S NL AAAGTD  VYLYD+R +S PL+ M GH+DAVT+IE
Sbjct: 261 QIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIE 320

Query: 299 FSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358
           F  + DGIL SSGSDRR  +WDL +IGAEQ Q++ +DG PE++M+HAGH+++IND + NP
Sbjct: 321 FDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNP 380

Query: 359 QVPWLIASAEEDNVVQVWKISKKL 382
            + WL+ASAEEDN+VQ+WK S  +
Sbjct: 381 NINWLVASAEEDNIVQIWKCSSNI 404

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 284/387 (73%), Gaps = 13/387 (3%)

Query: 8   EHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGT 67
           + +E  L++D+EY+LWKSNV LMYDFVSETKLTWPSL+++WLP  D   PL QQEMI+GT
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPH-DPQAPLTQQEMIIGT 62

Query: 68  HTSGDENNYLKIAAIDLPYEVVGLPDEDNSSE-PVKSMIKVTKKFEHEDEVIRARYMPKN 126
           HTS  E NY+KIA+I+LP EV+   D  N S+ PVKS +++TKKF+ E E+ R+RYM ++
Sbjct: 63  HTSDQEPNYVKIASIELPNEVI---DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQD 119

Query: 127 DKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVA 186
             II+TI+G G + I+DR+ S S    KT SYHKDNGYGL+FNP  +G+LLSA+DD  +A
Sbjct: 120 PNIISTIDGNGTVSIFDRNSSDSP--VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177

Query: 187 LWDINSTDRPVSIVMNHTD--IVNDSKWHEFDENIFGTVSEDK-TLQVHDKRSLSNSAQV 243
           ++DIN+           TD  I+ND KWH FD  +FGTVSE+K TL ++D R+  +    
Sbjct: 178 MYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT-KDKVTS 236

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHK 303
           + +E+P N+LAFSKHSKNL +AAGTD  VYLYDLR   + LH+M+GH+  VT++EF    
Sbjct: 237 IEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSV 296

Query: 304 DGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWL 363
           DGIL SS  DRR+ IWDL +IG+EQ  EDA D  PELMM+HAGHRS++NDFS N  +PWL
Sbjct: 297 DGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWL 356

Query: 364 IASAEEDNVVQVWKISKKL--VSNIIP 388
           IAS EE+N++QVWK S +L  +SN  P
Sbjct: 357 IASTEEENIIQVWKSSSRLPRISNSKP 383

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  421 bits (1081), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 206/385 (53%), Positives = 286/385 (74%), Gaps = 11/385 (2%)

Query: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDA-NVPLKQQEMIL 65
           I+ +E PLT DQEYELWKSNV L+YDFVSETKL WPSL+++WLPS +  N+P  +Q ++L
Sbjct: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLL 72

Query: 66  GTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPK 125
           GTHTSG+E NYLKIA I LP +++    EDNS + VKS I++ KKF+HE EV RA YMP+
Sbjct: 73  GTHTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQ 132

Query: 126 NDKIIATINGKGKIFIYDRS--KSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDT 183
           +  IIATING G +FIYD S  +++S  +   LS+HK+NGYGLAFNP  +G+LLS+SDD 
Sbjct: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192

Query: 184 TVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQV 243
           +VA W+I  +  P+ + +  T I+ND +W++F++N+FG V+E   L + D R+ +N  ++
Sbjct: 193 SVAYWNIQKS-IPL-LTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKI 250

Query: 244 LP---VEKP--LNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
           +    ++ P   NA+AFS HS+ L+AA+G D+ +YLYD R L++PLH M GH+D+VTS++
Sbjct: 251 VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLD 310

Query: 299 FSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDG-VPELMMMHAGHRSAINDFSFN 357
           F +  DGI+ S GSD+R+ +WDL QIG EQ  ++ +DG VPEL+M+HAGHRS INDFS +
Sbjct: 311 FHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMS 370

Query: 358 PQVPWLIASAEEDNVVQVWKISKKL 382
             + WL AS EEDN+VQVWK++  L
Sbjct: 371 NNLNWLCASIEEDNIVQVWKMNNSL 395

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  146 bits (369), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 107/410 (26%), Positives = 189/410 (46%), Gaps = 59/410 (14%)

Query: 16  VDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG---- 71
           + + Y  WK N  L+YD+++     WPSLS Q+    D N       ++L + TSG    
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQ--DVNTKNDSHRILLSSFTSGLMPE 80

Query: 72  -DENNYLKIAAID-LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVI--------RAR 121
            +  N + I+ +  +P+  +   D D       + +K+  K  H ++ I        RAR
Sbjct: 81  QESINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRAR 140

Query: 122 YMPKNDKIIATINGKGKIFIYDRSKSKS------------------EGLCKTLSYHKDNG 163
           Y+P+N  IIA  +  G ++I++R+K  S                  E   +++  + +  
Sbjct: 141 YLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNEA 200

Query: 164 YGLAFNPQIEGELLSASDDTTVALWDI------NST-DRPVSIVMNHTDIVNDSKWHEFD 216
             + +N Q EG L ++  D  +  WD+      N+T   P   +M  T+  ND  W    
Sbjct: 201 LSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLH 260

Query: 217 ENIFGTVSEDKTLQVHDKRSLSNSAQVLPV--EKPLNALAFSKHSKNLIAAAGTDTRVYL 274
           +++     E   L ++D R       +     E  +NA  F+  +  ++A+A T   V++
Sbjct: 261 DSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNVHI 320

Query: 275 YDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDA 333
           +D+R+ +E + T+  H  ++++IE++ + D IL ++G D  L  +WD+T           
Sbjct: 321 WDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD---------- 369

Query: 334 DDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
                EL+  H GH   +ND S+N   PWL+ S   DN VQ+W+ +  LV
Sbjct: 370 ----SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNLV 415

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  146 bits (368), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 196/419 (46%), Gaps = 67/419 (15%)

Query: 16  VDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG---- 71
           + Q Y  WK N  L+YD+++     WPSL+ Q+ P +D +       ++L T TS     
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSN--DTHRLLLSTFTSSQIPD 70

Query: 72  DEN---------NYLKIAAID-LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRAR 121
           DE+         N+L  ++++    + +    ++    P K++I        E +  +AR
Sbjct: 71  DESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKAR 130

Query: 122 YMPKNDKIIATINGKGKIFIYDRSKSKSE------------------GLCKTLSYHKDNG 163
           YMP+N  II   +  G I+I+DR+K  S+                   L K   +  ++G
Sbjct: 131 YMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDG 190

Query: 164 --------YGLAFNPQIEGELLSASDDTTVALWDI----NSTDRPVSIVMNHTDI----V 207
                     +A+NPQ EG+LLS   +  + LWD     +S +R ++  +  T+      
Sbjct: 191 TKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGC 250

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKR--SLSNSAQVLPVEKPLNALAFSKHSKNLIAA 265
           N+  W     +IF T  E+  + V D R   + NS +       +N+  F+  +  L+A+
Sbjct: 251 NEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLAS 310

Query: 266 AGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQI 324
             ++  + L+D+R+L++P+  +  H  ++++IE+S   + ++ S G +  L  +WD++  
Sbjct: 311 GDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDISN- 368

Query: 325 GAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
                         E + +H GH   IND S++   PWL+ S   DN +Q+WK +K LV
Sbjct: 369 ------------EEEPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPAKHLV 415

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  145 bits (365), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/407 (26%), Positives = 186/407 (45%), Gaps = 55/407 (13%)

Query: 18  QEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGD--ENN 75
           + Y  WK N  L YD+++     WPSL+ Q  P +D  +   +  ++L + TS    E+ 
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLD--LATDEHRILLSSFTSSQVPEDE 80

Query: 76  YLKIAAID----LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIR--------ARYM 123
            L +A +     +P+  +   D +     V + +K+  K   ED  I+        ARY 
Sbjct: 81  SLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKARYC 140

Query: 124 PKNDKIIATINGKGKIFIYDRSKSK-------SEG---------LCKTLSYHKDNGYGLA 167
           P N  +I + +  G I+++DR+K         S G         L  +L  HK+    LA
Sbjct: 141 PSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLA 200

Query: 168 FNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIV-------NDSKWHEFDENIF 220
           +N Q +G L ++     V +WD+   D+    ++N   +        N+  W    +++ 
Sbjct: 201 WNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLL 260

Query: 221 GTVSEDKTLQVHDKRSL---SNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
              SED  + + D R+     +S         +N   F+ H   L+ +A +  R+ L+D+
Sbjct: 261 AYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWDI 320

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDG 336
           R  ++PL T+  H D+++ ++++  +  +L + G D  L  IWDL+Q   +         
Sbjct: 321 RNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ--------- 370

Query: 337 VPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
             EL+  H GH   +ND S++P   W++ S   DN +QVW+ S  LV
Sbjct: 371 --ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSLV 415

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  143 bits (361), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 110/408 (26%), Positives = 184/408 (45%), Gaps = 61/408 (14%)

Query: 18  QEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG----DE 73
           Q Y LWK N  L+YD+++     WPSLS Q+ P +D +       ++  + TS     DE
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSS--DTHRLLFTSFTSSQLPQDE 67

Query: 74  NNYLKIAAID----LPY---------EVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRA 120
           N  + IA+I     +P+         E+   PD      P    I++T  F H D   RA
Sbjct: 68  N--VTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPHGD-CNRA 124

Query: 121 RYMPKNDKIIATINGKGKIFIYDRSK------SKSEGLCKTLSYHKDNG------YGLAF 168
            Y+P+N  +I+T +  G ++I+DR+K      S   G  +      +NG        L +
Sbjct: 125 TYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDW 184

Query: 169 NPQIEGELLSASDDTTVALWDINSTDR--PV------SIVMNHTDIVNDSKWHEFDENIF 220
           N QIEG L S   +  + +WDI   ++  P+        +   +   ND  W    + + 
Sbjct: 185 NRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLL 244

Query: 221 GTVSEDKTLQVHDKRSLSNSAQVLPVEK---PLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
               ED  + + D R+  N AQ  P       +N   F+     L+A A  D  V L+D+
Sbjct: 245 SIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDI 304

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDG 336
           R+L  P+ T+   +  ++++E++     +L + G +  L  +W            +A +G
Sbjct: 305 RKLHNPIKTI-NCESPLSALEWNPQLPTVLATGGQEDGLVKLW------------NASNG 351

Query: 337 VPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVS 384
             +L+  H GH   +ND +++P   WL+ S   DN   +WK + +LV+
Sbjct: 352 --QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRLVT 397

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  143 bits (361), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 110/431 (25%), Positives = 198/431 (45%), Gaps = 69/431 (16%)

Query: 5   EEIEHDES--PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQE 62
           ++I H+ S  P+ + + Y  WK N  L+YD+++     WPSL+ Q+ P +D      +  
Sbjct: 6   KDITHEASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTS--DEHR 63

Query: 63  MILGTHTSG----DENNYL-KIAAI---------DLPYEVVGLPDEDNSSEPVKSMIKVT 108
           ++L + TS     DE  Y+ KI+ +         +   + +    E+++  P K ++   
Sbjct: 64  ILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDI 123

Query: 109 KKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHK-------- 160
             F    E  RARY+P+N  IIA  +  G I+I+DR+K  S  + ++   H         
Sbjct: 124 SIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGS 183

Query: 161 -----------------DNGYGLAFNPQIEGELLSASDDTTVALWDINS-------TDRP 196
                            +    LA+N Q E  LLS+  +  V +WDI          D P
Sbjct: 184 HGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLP 243

Query: 197 VSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQV--LPVEKPLNALA 254
           +  + +    VND  W    +++F   +E   + + D R+     Q      +  +N+  
Sbjct: 244 LVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCR 303

Query: 255 FSKHSKNLIAAAGTDTRVYLYDLRRLSE-PLHTMAGHQDAVTSIEFSSHKDGILCSSGSD 313
           F+  +  ++A+A ++ R+ L+D+R +++ P+ TM  H  +V+++E+S + D +L ++G +
Sbjct: 304 FNYKNSLILASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQE 362

Query: 314 RRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNV 372
             L  +WD +                E +  H GH   +ND S++   PWL+ S   DN 
Sbjct: 363 DGLVKLWDTS--------------CEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNS 408

Query: 373 VQVWKISKKLV 383
           V +WK +  LV
Sbjct: 409 VHIWKPAGNLV 419

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  142 bits (359), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 104/408 (25%), Positives = 184/408 (45%), Gaps = 55/408 (13%)

Query: 18  QEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGD--ENN 75
           Q Y  WK N  L+Y++++     WPSL+ Q  P +D  +   +  ++L + TS    E+ 
Sbjct: 23  QRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLD--LAGDEHRILLSSFTSSQLPEDE 80

Query: 76  YLKIAAID----LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIR--------ARYM 123
            + +A +     +P+  +   D D     + + +K+  K   ED  I+        ARY 
Sbjct: 81  AIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPAGDCNKARYC 140

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSE----------------GLCKTLSYHKDNGYGLA 167
           P N  +I++ +  G ++++DR+K  S                  L  +L   ++    LA
Sbjct: 141 PSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALNLA 200

Query: 168 FNPQIEGELLSASDDTTVALWDINSTDR-------PVSIVMNHTDIVNDSKWHEFDENIF 220
           +N Q +G L +      V +WD+   D+       P S ++      ND  W    +++ 
Sbjct: 201 WNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLIDPHSSLLADPQGSNDISWMVNHDSLL 260

Query: 221 GTVSEDKTLQVHDKRSLSNSAQVLPV---EKPLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
               E   L V D R      Q          +NA  F+ +   L+ +A +  R+ L+D+
Sbjct: 261 AYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGRINLWDI 320

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDG 336
           R  S P+ ++  H  +V++++++ H   IL ++G D  L  IWDL+Q   +         
Sbjct: 321 RDFSSPIRSL-DHHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQPVDQ--------- 370

Query: 337 VPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVS 384
             EL   H GH   +ND S++P  PW++ S   DN +Q+WK S+ L++
Sbjct: 371 --ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNLMT 416

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  142 bits (359), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 108/420 (25%), Positives = 197/420 (46%), Gaps = 71/420 (16%)

Query: 16  VDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG---- 71
           + + Y  WK N  L+YD+++     WPSL+ Q+ P +D    L +  ++L + TS     
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTT--LNEHRILLSSFTSSQKPE 76

Query: 72  DENNYL-KIAAI---------DLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRAR 121
           DE  Y+ +I+ +         +   + +    E+ ++ P K ++   + F    E  RAR
Sbjct: 77  DETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRAR 136

Query: 122 YMPKNDKIIATINGKGKIFIYDRSKSKSEGL----------CKTLSYHK----------- 160
           Y+P+N  IIA  +  G I+I+DR+K  S  +           K L  H            
Sbjct: 137 YLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTS 196

Query: 161 ----DNGYGLAFNPQIEGELLSASDDTTVALWDINS-------TDRPVSIVMNHTDIVND 209
               +    LA+N Q E  LLS+  +  + +WDI          D P+  + +    VND
Sbjct: 197 LVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVND 256

Query: 210 SKWHEFDENIFGTVSEDKTLQVHDKRS----LSNSAQVLPVEKPLNALAFSKHSKNLIAA 265
             W    +++F   +E   + + D R+    L ++ ++      +N+  F+  +  ++A+
Sbjct: 257 VTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHG--GGVNSCKFNYKNSLILAS 314

Query: 266 AGTDTRVYLYDLRRLSE-PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQ 323
           A ++ R+ L+D+R ++E P+ TM  H  +V+++E+S + D +L ++G +  L  +WD T+
Sbjct: 315 ADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTTR 373

Query: 324 IGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
                          E +  H GH   +ND S++   PWL+ S   DN V +WK ++ +V
Sbjct: 374 --------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWKPAENIV 419

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  142 bits (358), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/414 (27%), Positives = 194/414 (46%), Gaps = 61/414 (14%)

Query: 13  PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG- 71
           P  V   Y  WK N  L+YD+++     WPSL+ Q+ P +D      Q  ++L + TS  
Sbjct: 27  PEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTN--DQHRLLLSSFTSSQ 84

Query: 72  ---DENNYL-KIAAID-LPYEVVGLPDED-------NSSE-PVKSMIKVTKKFEHEDEVI 118
              DE+ Y+ +++ +  LP+  +   D D       NSS+ P K++IK         +  
Sbjct: 85  LPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGDCN 144

Query: 119 RARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCK-----------------TLSYHKD 161
            ARY+P+N  +IA  +  G I+++DR+K    GL +                 +L  H++
Sbjct: 145 GARYLPQNPDVIAAASSNGSIYVFDRTK---HGLTRQKLHDGGSMFELEFQSSSLEEHQE 201

Query: 162 NGYGLAFNPQIEGELLSASDDTTVALWDINSTDR--PVSIVMNHTD-----IVNDSKWHE 214
               LA+N Q EG L +      V +WD+    R  PV    ++T        ND  W  
Sbjct: 202 -VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMV 260

Query: 215 FDENIFGTVSEDKTLQVHDKRS----LSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
              +I     E  ++ V D R+    LS++       + +N+  F+ H+  L+ +  +  
Sbjct: 261 NHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTG 320

Query: 271 RVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIWDLTQIGAEQA 329
           RV L+D+R L  PL ++  H  +++  +++ +   IL ++  SD  + +WD+ Q   E  
Sbjct: 321 RVNLWDIRDLETPLKSL-DHGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE-- 377

Query: 330 QEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
                    EL+ +H GH   +ND S+N   PWL+ S   DN VQ+W+ ++ LV
Sbjct: 378 ---------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNLV 422

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  140 bits (353), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 106/421 (25%), Positives = 194/421 (46%), Gaps = 67/421 (15%)

Query: 13  PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG- 71
           P  + + Y  WK N  L+Y++++     WPSL+ Q+ P +D    L +  ++L + TS  
Sbjct: 16  PPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTT--LDEHRILLSSFTSSQ 73

Query: 72  ---DENNYL-KIAAI---------DLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVI 118
              DE+ Y+ KI+ +         +   + +    E+++  P K ++     F    E  
Sbjct: 74  KPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGECN 133

Query: 119 RARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHK------------------ 160
           RARY+P+N  IIA  +  G I+I+DR+K  S  + ++   H                   
Sbjct: 134 RARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVETM 193

Query: 161 -------DNGYGLAFNPQIEGELLSASDDTTVALWDINS-------TDRPVSIVMNHTDI 206
                  +    +A+N Q E  LLS+  +  V +WDI          D P+  + +    
Sbjct: 194 DASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGSG 253

Query: 207 VNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS--AQVLPVEKPLNALAFSKHSKNLIA 264
           VND  W    +++F   +E  T+ + D R+      +        +N+  F+  +  ++A
Sbjct: 254 VNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSLILA 313

Query: 265 AAGTDTRVYLYDLRRLSE-PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLT 322
           +A ++ ++ L+D+R +++ PL TM  H  +V+++E+S + D +L ++G +  L  +WD +
Sbjct: 314 SADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGLVKLWDTS 372

Query: 323 QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
           +               E +  H GH   +ND S++   PWL+ S   DN V +WK +  L
Sbjct: 373 R--------------EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAVNL 418

Query: 383 V 383
           V
Sbjct: 419 V 419

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  138 bits (348), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 111/421 (26%), Positives = 196/421 (46%), Gaps = 61/421 (14%)

Query: 8   EHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGT 67
           E    P  + Q Y  WK N  L+YD+++     WPSL+ Q+ P +D         +++ +
Sbjct: 9   EQSTIPNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTS--DTHRILISS 66

Query: 68  HTSGD--ENNYLKIAAID----LPYEVVGLPDED--------NSSEPVKSMIK-VTKKFE 112
            TS    E+  + I+ I     L +  V   D D        N   P K ++  +T KF 
Sbjct: 67  FTSSQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIKFP 126

Query: 113 HEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKT----------------- 155
           + D   RARY+P+N  +IA  +  G ++I+DR+K  S  + ++                 
Sbjct: 127 NGD-CNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETV 185

Query: 156 --LSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINS-------TDRPVSIVMNHTDI 206
             L  + +    LA+N Q EG L S      V +WDI          D+PV  +      
Sbjct: 186 EELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQFDALG 245

Query: 207 VNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK--PLNALAFSKHSKNLIA 264
           VND  W    +++F    E  TL + D+R     +++        +N+  F+  +  L+A
Sbjct: 246 VNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLA 305

Query: 265 AAGTDTRVYLYDLRRLSE-PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLT 322
           +A ++  V ++D+R L + P+ ++  H  ++++IE++ + D I+ ++G +  L  +WD++
Sbjct: 306 SADSEGLVNMWDIRNLDQYPIKSI-NHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDVS 364

Query: 323 QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
                    + D+   EL+ +H GH   +ND S++    WL+ S   DN +Q+WK +  L
Sbjct: 365 ---------NTDN---ELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

Query: 383 V 383
           V
Sbjct: 413 V 413

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  138 bits (347), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 117/431 (27%), Positives = 198/431 (45%), Gaps = 69/431 (16%)

Query: 1   MMEYEEIEHDES-PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLK 59
           +M+ +  E   + P      Y  WK N  L+Y++++     WPSL+ Q+ P  D N    
Sbjct: 5   IMDEQPFEQSSAIPKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFP--DVNTKND 62

Query: 60  QQEMILGTHTSG----DENNYL-KIAAI-----------DLPYEVVGLPDEDNSSEPVKS 103
              ++L + TS     DE+ Y+ +I+ +           DL  E+   PD  N   P K+
Sbjct: 63  SHRILLSSFTSSLVPEDESLYITRISTLKHLSWASLNNFDLD-EMEFKPDNSNIKLPPKN 121

Query: 104 MI-KVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSK------SKSEGLCKTL 156
           +  ++  +F + D   RARY+P+N  +IA  +  G ++I+DR+K      S+  G   T 
Sbjct: 122 LTTELVIRFPNGD-CNRARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGF--TQ 178

Query: 157 SYH--------------KDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIV-- 200
           SY               ++    + +N Q EG L+ A  D  V  WDI    R   ++  
Sbjct: 179 SYQAKLAVNNNSQSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKA 238

Query: 201 --MNHT---DIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQV-LPVEKP-LNAL 253
              N+       ND+ W     ++F   SED  L + D R  SN   +   V K  +NA 
Sbjct: 239 PEYNYKLDESGCNDAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINAC 298

Query: 254 AFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSD 313
            F+  +  L+A+  +   + L+D+R+   P++ +  H  ++++IE++ +   +L S+G D
Sbjct: 299 RFNPRNSLLLASGDSIGNICLWDIRKKETPINIL-DHGSSISTIEWNPNLSTVLASAGQD 357

Query: 314 RRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNV 372
             L  +WD               G  + + +H GH   +ND S+N   PWL+ S  +DN 
Sbjct: 358 DGLVKLWDA--------------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNS 403

Query: 373 VQVWKISKKLV 383
           +Q+WK +  LV
Sbjct: 404 IQIWKPAHNLV 414

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  138 bits (347), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 105/422 (24%), Positives = 194/422 (45%), Gaps = 69/422 (16%)

Query: 13  PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG- 71
           P+ + + Y  WK N  L+YD+++     WPSL+ Q+ P +D    L +  ++L + TS  
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTT--LDEHRILLSSFTSSQ 73

Query: 72  ---DENNYL-KIAAI---------DLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVI 118
              DE  Y+ KI+ +         +   + +    E+ +  P   ++     F    +  
Sbjct: 74  KPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDCN 133

Query: 119 RARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHK------------------ 160
           RARY+P+N  IIA  +  G I+I+DR+K  S  + ++ + H                   
Sbjct: 134 RARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAM 193

Query: 161 -------DNGYGLAFNPQIEGELLSASDDTTVALWDINS-------TDRPVSIVMNHTDI 206
                  +    LA+N Q E  LLS+  +  V +WDI          D P+  + +    
Sbjct: 194 DTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASG 253

Query: 207 VNDSKWHEFDENIFGTVSEDKTLQVHDKRS----LSNSAQVLPVEKPLNALAFSKHSKNL 262
           VND  W    +++F   +E   + + D R+    L ++ Q       +N+  F+  +  +
Sbjct: 254 VNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQ--NHTGGVNSCKFNYRNSLV 311

Query: 263 IAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIWDL 321
           +A+A ++ R+ L+D+R+++E   T   H  +++++E++ +   +L ++G  D  + +WD 
Sbjct: 312 LASADSNGRLNLWDIRKMNESPITTMEHGASISTLEWNPNFSTVLATAGQQDGLVKLWD- 370

Query: 322 TQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
                  A+E       E +  H GH   +ND S++   PWL+ S   DN V +WK ++ 
Sbjct: 371 ------TARE-------ETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAEN 417

Query: 382 LV 383
           LV
Sbjct: 418 LV 419

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  137 bits (346), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 107/408 (26%), Positives = 185/408 (45%), Gaps = 54/408 (13%)

Query: 16  VDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG---- 71
           + Q Y  WK N  L+YD+++     WPSL+ Q++P  D  VP  +  ++L + TS     
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMP--DLEVPTDKHRLLLSSFTSSQLPE 78

Query: 72  DENNYLKIAAI--DLPYEVVGLPDED--------NSSEPVKSMIKVTKKFEHEDEVIRAR 121
           DE  Y+   +    +P+  +   D D         +  P K++++  +      +  RA 
Sbjct: 79  DEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRAC 138

Query: 122 YMPKNDKIIATINGKGKIFIYDRSK---SKSEGLCKTLSYH-------------KDNGYG 165
           YMP+N  II  I   G + I+DR+K   ++ + L    SY                    
Sbjct: 139 YMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALS 198

Query: 166 LAFNPQIEGELLSASDDTTVALWDIN-------STDRPVSIVMNHTDIVNDSKWHEFDEN 218
           LA+N Q  G + S+  +  + +WDI        +   P   ++      ND  W     +
Sbjct: 199 LAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSS 258

Query: 219 IFGTVSEDKTLQVHDKRS--LSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD 276
           I     E  T+ + D R+       +  P    +NAL F+  +  L+ AA ++  + L+D
Sbjct: 259 ILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWD 318

Query: 277 LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIWDLTQIGAEQAQEDADD 335
            R  S+PL ++  H D+V++++++ +   I+ ++G  D  + IWD ++       ED+  
Sbjct: 319 CRAFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTSR-----EPEDS-- 370

Query: 336 GVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
               L+ +H GH   +ND ++N   PWL+ S   DN V VWK +  LV
Sbjct: 371 ----LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANLV 414

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  137 bits (344), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 106/405 (26%), Positives = 186/405 (45%), Gaps = 41/405 (10%)

Query: 16  VDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG---- 71
           V Q Y  WK N  L+YD+++     WPSLS Q+ P  D  +   +Q ++L + TS     
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFP--DRTLTNDKQRILLSSFTSQQLPQ 77

Query: 72  DENNYL-KIAAID-LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVI--------RAR 121
           DE+ Y+  I+ ++ + +  +   D D     + + +K+  K   E+  I        R R
Sbjct: 78  DESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNRCR 137

Query: 122 YMPKNDKIIATINGKGKIFIYDRSK--------SKSEGLCKTLSY-HKDNGYGLAFNPQI 172
           YMP+N  II T +  G ++I+DR+K         K E  C+      +D    LA+N Q+
Sbjct: 138 YMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNYQL 197

Query: 173 EGELLSASDDTTVALWDINSTDR-------PVSIVMNHTDIVNDSKWHEFDENIFGTVSE 225
           EG L +   +  V +WD+   D+       P    +   + VND  W     +I  +  E
Sbjct: 198 EGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGE 257

Query: 226 DKTLQVHDKR--SLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEP 283
              + + D R  +  ++         +NA+ F+  +  ++    +  ++ ++D+R   EP
Sbjct: 258 SNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDFKEP 317

Query: 284 LHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELM 341
           +     G QD +++I+++     IL ++     L  IWD     A   QED++     L+
Sbjct: 318 IKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD-----ASGEQEDSNAENNMLL 372

Query: 342 MMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNI 386
            +H GH   +ND S++   PW + S   DN + +WK +  LV  +
Sbjct: 373 FVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANLVEQL 417

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  136 bits (343), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/417 (27%), Positives = 185/417 (44%), Gaps = 66/417 (15%)

Query: 19  EYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG----DEN 74
            Y  WK N  L+YD+++     WPSL+ Q+ P VDAN       ++L ++TS     DEN
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANT--DTHRILLSSYTSCQLPEDEN 75

Query: 75  NYLK----IAAIDLPY-------EVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYM 123
            Y+     +A +D          E+   PD      P      V+  F   D   RARYM
Sbjct: 76  VYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFPRGD-CNRARYM 134

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYG------------------ 165
           P+N  +IA  +  G +++++R+K  +  + K  +   +  YG                  
Sbjct: 135 PQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARRTP 194

Query: 166 -------LAFNPQIEGELLSASDDTTVALWDI------NSTDRPVSIVMNHTDI--VNDS 210
                  LA+N   EG L  A     V +WD+      N+T        ++ D   VND 
Sbjct: 195 VDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVNDV 254

Query: 211 KWHEFDENIFGTVSE-DKTLQVHDKRSLSNSAQVLPVEKP--LNALAFSKHSKNLIAAAG 267
            W    ++I     E   +L + D R+ +  A++    K   +NA  F+  +  L+A+  
Sbjct: 255 SWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTD 314

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIWDLTQIGA 326
           +  R  L+D+R+LS        H  +V+++E++ H   +L ++G SD  + IWD T +  
Sbjct: 315 STGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWD-TSLEI 373

Query: 327 EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
           E           + + +H+GH   +ND +++   PWL+ S   DN V VWK +  LV
Sbjct: 374 ED----------KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANLV 420

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  135 bits (340), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 115/431 (26%), Positives = 192/431 (44%), Gaps = 66/431 (15%)

Query: 2   MEYEEIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQ 61
           +E E +     P  + Q Y  WK N  L+YD+++     WPSL+ Q+   +D        
Sbjct: 4   IEEEHVPQSSIPEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTS--DTH 61

Query: 62  EMILGTHTSG----DENNYL-KIAAID-LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHED 115
            ++L   TS     DE  Y+ K++ +  L +  +   D D      ++ IK+  K    D
Sbjct: 62  RILLSAFTSSQLPEDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTND 121

Query: 116 EVIR--------ARYMPKNDKIIATINGKGKIFIYDRSKSKSEGL--CKTLSYHKDNGY- 164
             IR        ARY+P+N  +IA  +  G I+I+DR+K  S  +   K L  ++   Y 
Sbjct: 122 ISIRFPDGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYC 181

Query: 165 ---------------GLAFNPQIEGELLSASDDTTVALWDINS-------TDRPVSIVMN 202
                           +++N Q EG L S      + LWD+          D P+  V  
Sbjct: 182 PPKGIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDF 241

Query: 203 HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPL-----NALAFSK 257
               VND  WH   ++I     E   + + D R      ++L   + +     N+  F+ 
Sbjct: 242 DALGVNDVNWHPSHDSILAASGESNIIGLFDNRL---GTEILRSNEKMHNGGINSCKFNS 298

Query: 258 HSKNLIAAAGTDTRVYLYDLRRL-SEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRL 316
           H  +L+ +  ++ R+ L+DLR+L  EP+ T+  H  +++++E++ + + I+ S+G D  L
Sbjct: 299 HCDSLLISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGL 357

Query: 317 F-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
             +WD++                EL+  H GH   +ND S+N    WL+ S   DN VQV
Sbjct: 358 VKLWDVS--------------TDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQV 403

Query: 376 WKISKKLVSNI 386
           WK +  LV  +
Sbjct: 404 WKPAHNLVEQV 414

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  134 bits (336), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 112/418 (26%), Positives = 192/418 (45%), Gaps = 65/418 (15%)

Query: 13  PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG- 71
           P  V   Y  WK N  L+YD+++     WPSL+ Q+ P +D +    Q  ++L + TS  
Sbjct: 18  PEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSS--DQHRLLLSSFTSSQ 75

Query: 72  ---DENNYL-KIAAID-LPY---------EVVGLPDEDNSSEPVKSMIKVTKKFEHEDEV 117
              DE+ Y+ KI+ +  L +         E+   PD      P     +V+ +F + D  
Sbjct: 76  LPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSIRFPNGD-C 134

Query: 118 IRARYMPKNDKIIATINGKGKIFIYD---------RSKSKSEGLCKTLSYHKD------- 161
            R+RY+P+N  +IA  +  G ++I++         RSKS  +   +  S   D       
Sbjct: 135 NRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNF 194

Query: 162 -NGYGLAFNPQIEGELLSASDDTTVALWDINSTDR-------PVSIVMNHTDIVNDSKWH 213
                L++N   EG L  +       +WD+    R       P   V   ++  ND  W 
Sbjct: 195 NEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWM 254

Query: 214 EFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPV-----EKPLNALAFSKHSKNLIAAAGT 268
              +++F    E   L + D R L+   +V  +     E  +N   F+  +  L+A+A T
Sbjct: 255 PMHDSMFIACGESNKLGLFDMR-LNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADT 313

Query: 269 DTRVYLYDLRRL-SEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGA 326
             R+ L+D+R+L  EP+ TM  H  ++++IE++ +   +  S+G +  L  +WD + +G 
Sbjct: 314 CGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDGLVKLWDAS-VGK 371

Query: 327 EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVS 384
           E             + +H GH   +ND S++   PWL+AS   DN +Q+W+ +K +VS
Sbjct: 372 E-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNIVS 416

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  132 bits (331), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 107/414 (25%), Positives = 193/414 (46%), Gaps = 63/414 (15%)

Query: 13  PLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGD 72
           P  + Q Y  WK N  L+Y++++     WPSL+ Q++P +D  +   +  ++L + TS  
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMD--IASDKHRILLSSFTSAQ 75

Query: 73  --ENNYLKIAAI-----------------DLPYEVVGLPDEDNSSEPVKSMIKVTKKFEH 113
             E+  + I+ I                 ++ ++V      DN  +  K++ +  K    
Sbjct: 76  LPEDEAIYISEISTMKHIAWSSLNNFHMEEMEFKV------DNQVKLSKNLTETIKIQFP 129

Query: 114 EDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEG---LCKTLSYHKD--------- 161
           E +  RARYMP+N  +IA+ +  G ++I+DR+K  S     L  T  Y  +         
Sbjct: 130 EGDCNRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCN 189

Query: 162 -NGYGLAFNPQIEGELLSASDDTTVALWDINSTDR--PVSIVMN-----HTDIVNDSKWH 213
                LA+N Q  G L ++  D  V +WDI   ++  P   V +       +  N+  W 
Sbjct: 190 YEASSLAWNYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSWM 249

Query: 214 EFDENIFGTVSEDKTLQVHDKRSLS--NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTR 271
               +I     E   L + D R+ +  ++ +       +NA+ F+  +  L+ +A ++  
Sbjct: 250 VHHSSILAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGT 309

Query: 272 VYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQ 330
           + + D+R+L  P+ T + H DAV++I+++     ++ S+G +  L  IWDL       AQ
Sbjct: 310 LNICDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL-------AQ 361

Query: 331 EDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVS 384
           ED       L+ +H GH   +ND ++N   PW++ S   DN V +WK +  +V+
Sbjct: 362 EDD-----PLVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANIVN 410

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  126 bits (317), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 111/422 (26%), Positives = 196/422 (46%), Gaps = 64/422 (15%)

Query: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILG 66
           IE    P  + + Y  WK N  L+Y +++     WPSL+ Q+ P +D         ++L 
Sbjct: 7   IEPSSIPDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTT--DTHRILLS 64

Query: 67  THTSGD--ENNYLKIAAID----LPYEVVGLPD-------EDNSSE-PVKSM-IKVTKKF 111
           T TS    E+  L IA +     L +  +   D        DNS++ P K++ + ++  F
Sbjct: 65  TFTSSQLPEDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPF 124

Query: 112 EHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGL--------CKTLSYHK--- 160
            + D   RARY+P+N  ++A  +  G I+I++R+K  S  L         +  S  K   
Sbjct: 125 PNGD-CNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDE 183

Query: 161 -----DNGYGLAFNPQIEGELLSASDDTTVALWDIN--STDRPVSIVMNHTDI------V 207
                +    +A+N Q  G L S+    ++ +WDI   S   P ++  N   I       
Sbjct: 184 NFTNSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDP-TLRENELTIPFDPEGC 242

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRS----LSNSAQVLPVEKPLNALAFSKHSKNLI 263
           N+  W    ++IF   SE   L + D R+    L  +  +      +N+  F+ ++  L+
Sbjct: 243 NEVTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLL 302

Query: 264 AAAGTDTRVYLYDLRRL-SEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDL 321
           A+A +  ++ ++D+R+L  EP+ +   H  +++++E++ + + IL ++G D  L  IWD 
Sbjct: 303 ASADSTGKINMWDIRKLDKEPIKSF-NHNSSISTLEWNPNLETILVTAGQDDGLVKIWD- 360

Query: 322 TQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
           T  G               + +H GH   +ND S++   PWL++S   DN + VWK +  
Sbjct: 361 TANGQN-------------IFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATN 407

Query: 382 LV 383
           LV
Sbjct: 408 LV 409

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  122 bits (307), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 95/408 (23%), Positives = 188/408 (46%), Gaps = 59/408 (14%)

Query: 18  QEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSG----DE 73
           Q Y  WK N  L+YD+++     WPSL+ ++ P +D         ++L + TS     DE
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTT--DSHRLLLSSFTSSQLPEDE 74

Query: 74  NNYL-KIAAI---------DLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYM 123
           + Y+ +I+ +         +   + +    E+++  P +++           +  RARY+
Sbjct: 75  SIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRARYL 134

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSY----------------HKDNGYGLA 167
           P+N  +I+  +  G I+I+DR+K  S     T S                   +    L 
Sbjct: 135 PQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSLD 194

Query: 168 FNPQIEGELLSASDDTTVALWDIN-------STDRPVSIVMNH-TDIVNDSKWHEFDENI 219
           +N + EG L S      + +WDI+       +   P+  + +      ND  W    +++
Sbjct: 195 WNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHDSL 254

Query: 220 FGTVSEDKTLQVHDKRSLSNSAQVLPV--EKPLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
                E  T+ ++D RS S  +++ P      +N+  F+ H+  L+A+A +   V+++D+
Sbjct: 255 LAACGESNTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHMWDI 314

Query: 278 RRLSE-PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADD 335
           R+L + P+ +++ H  ++++++++ +   I+  +G +  L  +WD            A +
Sbjct: 315 RKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD------------ASN 361

Query: 336 GVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLV 383
           G  +L+  H GH   +ND ++N   PWL+ S   DN + +W+ S  LV
Sbjct: 362 G--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHLV 407

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 129/311 (41%), Gaps = 55/311 (17%)

Query: 29  LMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGDENNYLKIAAIDLPYEV 88
           L +D ++E  +T+   +IQWLPS                H      N  KIA       +
Sbjct: 141 LTWDKIAECNVTYSISNIQWLPS----------------HV-----NPRKIATSSESLRI 179

Query: 89  VGLPDEDNS-SEPVK-SMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSK 146
               DE+N+  E +  S+ K  K+  H+ +              A     G   I   S 
Sbjct: 180 WSFNDEENTIQEQINLSLCKYNKQHHHQQQP-------------APSETPGGTVIDPLSN 226

Query: 147 SKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI 206
           S    L    S+H        +NP     L+S+S DTT  +WD+ S++   + ++ H   
Sbjct: 227 SVLGELPPITSFH--------WNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSE 278

Query: 207 VNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL-PVEKPLNA---------LAFS 256
           V D ++      +F +   D +++V D RSL++S  +  P    LN          L  S
Sbjct: 279 VYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPS 338

Query: 257 KHSKNLIAAAGTDT-RVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
            H  N++A    D+ ++ + D+R    PL  + GH  +V  I++   K  +L S G D +
Sbjct: 339 PHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQ 398

Query: 316 LFIWDLTQIGA 326
           +  WDL +  A
Sbjct: 399 VLYWDLNKCTA 409

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 69/190 (36%), Gaps = 24/190 (12%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKS----EGLCKTLSYHKDN 162
           T+   H+ EV   R++ ++ ++ A+  G G + ++D RS + S    E     L+     
Sbjct: 270 TQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQ 329

Query: 163 GYGLAFNPQIEGELLSAS---DDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENI 219
              L   P      + A+   D   + + D+ + + P+ I+  H+  VN  KWH    N+
Sbjct: 330 FALLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNV 389

Query: 220 F----------------GTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLI 263
                             T S D      D     +  Q  PV  P       + +K L 
Sbjct: 390 LLSGGDDCQVLYWDLNKCTASSDPVATTKDDDIAMDEEQGYPVTTPTEPQNTGRTAKTLP 449

Query: 264 AAAGTDTRVY 273
               T T  Y
Sbjct: 450 VRVDTPTLCY 459

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 120/280 (42%), Gaps = 45/280 (16%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNG-YGLAFNPQIEGELLSASDDTTVALWDINST 193
           G GK+ I D   +    L ++ S+   +G + LA+N   E + L A  D ++ L+DI   
Sbjct: 36  GNGKLIILDIMPNGQ--LVESNSFLTQDGLFDLAWNESHENQCLVAQGDGSLRLFDIKLK 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV-----------------HDKRS 236
           D P++I   H   V    W+   + +F + S D  +++                 +   +
Sbjct: 94  DYPIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTMSPNDTNAAST 153

Query: 237 LSNSAQVLPVEKPLN----------------ALAFSKHSKNLIAAAGTDTRVYLYDLRRL 280
           LS ++ V PV  P++                   FS H  NL+  +  ++ + LYDLR  
Sbjct: 154 LSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVP 213

Query: 281 SE--PLHTMAGHQ--DAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDG 336
           +   P H   GH   +A+T  +F+ ++  I+ + G D+ + +WDL       +Q      
Sbjct: 214 NNGLPQHQFLGHGGFEALT-CDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPIN 272

Query: 337 VPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
           + E+     GH  A+   +++P    ++ S   D   +VW
Sbjct: 273 INEIQ----GHELAVRKVTWSPHHSNMLLSTSYDMTCRVW 308

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 116/276 (42%), Gaps = 41/276 (14%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNG-YGLAFNPQIEGELLSASDDTTVALWDINST 193
           G GK+FI D        + +T S+   +G + +A+N   E  +L A  D ++ L+DI   
Sbjct: 36  GNGKLFIIDIDNQGR--MLETKSFVTQDGLFDVAWNELHENHVLVAQGDGSLRLFDIQLN 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNA- 252
           D PV+I   H   V    W+  ++ +F + S D T++V      S+   + P  KP+ A 
Sbjct: 94  DYPVAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWTPMRQSSLTTLTP--KPMTAH 151

Query: 253 -----------------------------LAFSKHSKNLIAAAGTDTRVYLYDLRRLSEP 283
                                          FS H  N++ +   ++ V ++DLR+ +  
Sbjct: 152 NSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANA 211

Query: 284 -LHTMAGHQDAVT-SIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELM 341
             ++   H    T + +F+ ++  I+ + G D  + +WDL  +    A       V E+ 
Sbjct: 212 NQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEI- 270

Query: 342 MMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
               GH  AI   S++P    ++ S   D   +VW+
Sbjct: 271 ---CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 89/209 (42%), Gaps = 23/209 (11%)

Query: 190 INSTDRPVSIVMNHT------DIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQV 243
           ++S D P+S    HT      + +  S++   D NI  + + +  + + D R  +N+ Q 
Sbjct: 155 LSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQY 214

Query: 244 -LPVEKPLNALA--FSKHSKNLIAAAGTDTRVYLYDLR---------RLSEPLHTMAGHQ 291
                  +  L   F+K+  ++IA  G D  V ++DLR         R    ++ + GH 
Sbjct: 215 SFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHD 274

Query: 292 DAVTSIEFSSHKDGILCSSGSDRRLFIW-DLTQIGAE-QAQEDADDGVPELMMMHAGHRS 349
            A+  + +S H   +L S+  D    +W DL+  G     + ++ D       + + H  
Sbjct: 275 LAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGRRPTGKTNSIDPTHGCRFIFSHHTE 334

Query: 350 AI--NDFSFNPQVPWLIASAEEDNVVQVW 376
            +   D+S   Q P  +AS   D  V +W
Sbjct: 335 FVFGADWSLWGQ-PGYVASTSWDGDVCIW 362

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 98/219 (44%), Gaps = 21/219 (9%)

Query: 168 FNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDK 227
           +NP     L+S+S DTT  +WD+ S +   + ++ H   V D ++      +F +   D 
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 277

Query: 228 TLQVHDKRSLSNSAQV-----------LP---VEKPLNALAFSKHSKNLIAAAGTD-TRV 272
           +++V D R L++S  +           LP   V   L  L  S    N+IA    D ++V
Sbjct: 278 SVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSSKV 337

Query: 273 YLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL-TQIGAEQAQE 331
            + D+R    PL T+  H   +  I++   +  +L S+  D ++  WDL T + +E  ++
Sbjct: 338 LILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSESTKD 397

Query: 332 DADDGVPE-----LMMMHAGHRSAINDFSFNPQVPWLIA 365
              D  P+       M +A     +N+  + PQ  W  A
Sbjct: 398 TTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 22/136 (16%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKSEGLCKTLSYHK--DNGY 164
           T+   H+ EV   R++ ++ ++ A+  G G + ++D R  + S     T+ Y     +G 
Sbjct: 248 TQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHS-----TIIYEPTIPDGA 302

Query: 165 GLAFNPQIEGELLS--------------ASDDTTVALWDINSTDRPVSIVMNHTDIVNDS 210
               +P +   LL               A D + V + D+ S   P+  +  HT  +N  
Sbjct: 303 PDLPSPTVPPALLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQI 362

Query: 211 KWHEFDENIFGTVSED 226
           KWH    N+  + S+D
Sbjct: 363 KWHPTRRNVLLSASDD 378

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 117 VIRARYMPKNDKIIATIN-GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGE 175
           ++R    P +  +IAT      K+ I D     S  L  TL  H      + ++P     
Sbjct: 314 LLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLL--TLEAHTAPINQIKWHPTRRNV 371

Query: 176 LLSASDDTTVALWDINS 192
           LLSASDD  V  WD+N+
Sbjct: 372 LLSASDDCQVLYWDLNT 388

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/126 (19%), Positives = 51/126 (40%), Gaps = 2/126 (1%)

Query: 217 ENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD 276
           E I  ++ +    Q    + L  +  VL    P+ +  ++    NL+ ++  DT   ++D
Sbjct: 180 EQINLSLCKHNKQQSEKGKELVGTNGVLGELPPITSFHWNPTDPNLLISSSIDTTCIVWD 239

Query: 277 LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA--QEDAD 334
           L+  +     +  H   V  + F +    +  S G D  + ++DL  +       +    
Sbjct: 240 LQSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPTIP 299

Query: 335 DGVPEL 340
           DG P+L
Sbjct: 300 DGAPDL 305

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 89/192 (46%), Gaps = 23/192 (11%)

Query: 168 FNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDK 227
           +NP     L+S+S DTT  +WD+ S++   + ++ H   V D K+      +F +   D 
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDG 289

Query: 228 TLQVHDKRSLSNSAQVLPVEKPLNA----------------LAFSKHSKNLIAAAGTDTR 271
           +++V D RSL++S  +       N                 L  S    N++A    D++
Sbjct: 290 SVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDSK 349

Query: 272 -VYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL------TQI 324
            + + D+R    P+ T+ GH  AV  I++   K  +L S G D ++  WDL      T +
Sbjct: 350 SILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWLSPTSL 409

Query: 325 GAEQAQEDADDG 336
            A + + +A+DG
Sbjct: 410 SANENKVNANDG 421

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 79/189 (41%), Gaps = 32/189 (16%)

Query: 212 WHEFDENIFGTVSEDKTLQVHDKRSLSN--SAQVLPVEKPLNALAFSKHSKNLIAAAGTD 269
           W+  D N+  + S D T  V D +S SN    Q++  +  +  + F  HS  L A+ G D
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQS-SNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGD 288

Query: 270 TRVYLYDLRRLSEPLHTMAGHQD---------------AVTSIEFSSHKDGILCSSGSDR 314
             V ++DLR L+        + D               A+  ++ S     ++ +   D 
Sbjct: 289 GSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDS 348

Query: 315 R-LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVV 373
           + + I D+   G+           P L +   GH +A+N   ++P+   ++ S  +D  V
Sbjct: 349 KSILILDMRNPGS-----------PVLTL--EGHSAAVNQIKWHPKKSNVLLSCGDDCQV 395

Query: 374 QVWKISKKL 382
             W +++ L
Sbjct: 396 LYWDLNEWL 404

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 51/133 (38%), Gaps = 14/133 (10%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-----------RSKSKSEGLCKTL 156
           T+   H+ EV   +++  + ++ A+  G G + ++D            S S   G     
Sbjct: 260 TQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLT 319

Query: 157 SYHKDNGYGLAFNPQIEGELLSAS---DDTTVALWDINSTDRPVSIVMNHTDIVNDSKWH 213
              K     L   P      + A+   D  ++ + D+ +   PV  +  H+  VN  KWH
Sbjct: 320 DNEKSPSALLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWH 379

Query: 214 EFDENIFGTVSED 226
               N+  +  +D
Sbjct: 380 PKKSNVLLSCGDD 392

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/91 (19%), Positives = 44/91 (48%)

Query: 235 RSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAV 294
           ++ ++S+ +L    P+ +  ++    NL+ ++  DT   ++DL+  +     +  H   V
Sbjct: 210 KNTTSSSDILGQFPPVTSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEV 269

Query: 295 TSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
             ++F +H   +  S G D  + ++DL  + 
Sbjct: 270 FDVKFLAHSTQLFASCGGDGSVRVFDLRSLA 300

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

Query: 117 VIRARYMPKNDKIIATINGKGK-IFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGE 175
           ++R +  P +  ++AT     K I I D     S  L  TL  H      + ++P+    
Sbjct: 328 LLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVL--TLEGHSAAVNQIKWHPKKSNV 385

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDI 206
           LLS  DD  V  WD+N    P S+  N   +
Sbjct: 386 LLSCGDDCQVLYWDLNEWLSPTSLSANENKV 416

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 115/273 (42%), Gaps = 35/273 (12%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD 194
           G GK+FI D +        K+    +D  + +A+N   E ++L A  D ++ L+D   TD
Sbjct: 36  GNGKLFIVDINNQGIMTEAKSF-LTQDGLFDVAWNELHENQVLVAQGDGSLRLFDTQLTD 94

Query: 195 RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLP----VEKPL 250
            P++I   H   V    W+  ++ +F + S D T++V       + A + P     + PL
Sbjct: 95  YPIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPMAAQNPL 154

Query: 251 ---------------------NAL---AFSKHSKNLIAAAGTDTRVYLYDLRR-LSEPLH 285
                                N +    FS H  N+I +   ++ V ++DLR+      +
Sbjct: 155 MPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGANQY 214

Query: 286 TMAGHQDAVT-SIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMH 344
           +   H    T + +F+ ++  I+ + G D  + +WDL  +    +       V E+    
Sbjct: 215 SFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEI---- 270

Query: 345 AGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
            GH  AI   S++P    ++ S   D   +VW+
Sbjct: 271 CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 108/235 (45%), Gaps = 33/235 (14%)

Query: 153 CKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW 212
           CKT   H    Y  +F+   E  LLSAS+D TV LW +   D+P+     H   V D ++
Sbjct: 567 CKTFIGHSGTVYSTSFSAGDE-YLLSASEDKTVRLWSVQD-DKPLVSYKGHEKPVWDVEF 624

Query: 213 HEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE------KPLNALAFSKHSKNLIAAA 266
                N+F T S D+T +      L +  +V P+         ++ ++F  + +  I   
Sbjct: 625 SPSCNNLFATASNDQTAR------LWSCDRVYPLRVMAGHLNDVDCVSFHSNGR-YIFTG 677

Query: 267 GTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIG 325
            +D  V ++D+    + +    GH   VTS+  S   DG   S+GSD  +  IWD   IG
Sbjct: 678 SSDKTVRMWDI-NTGDSVRLFMGHNSTVTSLSVSP--DGKWISTGSDDGIITIWD---IG 731

Query: 326 AEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISK 380
           + +          +L  M    +S+I+  S+NP+   L+ S   D  V+VW ++K
Sbjct: 732 SGR----------KLKNMRGHGKSSIHSLSYNPE-GTLLVSGGADQSVRVWDLNK 775

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 61/148 (41%), Gaps = 29/148 (19%)

Query: 246 VEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL-------------RRLSEPLHTMAGHQD 292
            +K + +L FS + K L A+   D+ + ++ L               +S    T  GH  
Sbjct: 517 TQKNMTSLEFSNNYK-LAASGFQDSYIKIWSLDGYPLSENDEMPNNPISSTCKTFIGHSG 575

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN 352
            V S  FS+  D  L S+  D+ + +W +        Q+D      + ++ + GH   + 
Sbjct: 576 TVYSTSFSAG-DEYLLSASEDKTVRLWSV--------QDD------KPLVSYKGHEKPVW 620

Query: 353 DFSFNPQVPWLIASAEEDNVVQVWKISK 380
           D  F+P    L A+A  D   ++W   +
Sbjct: 621 DVEFSPSCNNLFATASNDQTARLWSCDR 648

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 127/307 (41%), Gaps = 56/307 (18%)

Query: 29  LMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGDENNYLKIAAIDLPYEV 88
           L +D ++E  +T+    +QWLPS      L      L   T  DENN L         E 
Sbjct: 158 LTWDKITECNVTYSISKMQWLPSHPKPRKLATSSESLRIWTLNDENNTLN--------ET 209

Query: 89  VGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSK 148
           + L           S+ K  K+               N K +AT +G     + D   + 
Sbjct: 210 INL-----------SLCKYKKQHH------------MNIKAVATNSGNP---LSDAVPND 243

Query: 149 SEG-LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIV 207
             G      S+H        +NP     L+S+S DTT  +WD+ S++   + ++ H   V
Sbjct: 244 ILGEFPPITSFH--------WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIAHDSEV 295

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS-------AQVLP-----VEKPLNALAF 255
            D ++      +F +   D +++V D RSL++S       AQ+ P         L  L  
Sbjct: 296 FDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEP 355

Query: 256 SKHSKNLIAAAGTDT-RVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDR 314
           S H  N++A    D+ ++ + D+R    P+ T+ GH  ++  I++   +  IL S   D 
Sbjct: 356 SPHDPNIVATFAADSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDC 415

Query: 315 RLFIWDL 321
           ++  WDL
Sbjct: 416 QVLYWDL 422

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 28/185 (15%)

Query: 212 WHEFDENIFGTVSEDKTLQVHDKRSLSN--SAQVLPVEKPLNALAFSKHSKNLIAAAGTD 269
           W+  D N+  + S D T  + D  S SN    Q++  +  +  + F   S  L A+ G D
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLES-SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGD 314

Query: 270 TRVYLYDLRRLS------EPLHTM-----AGHQDAVTSIEFSSHKDGILCSSGSD-RRLF 317
             V ++DLR L+      EP   M     A   +A+  +E S H   I+ +  +D  ++ 
Sbjct: 315 GSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKII 374

Query: 318 IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           I D+            +   P L +   GH S++N   ++P    ++ S  +D  V  W 
Sbjct: 375 ILDM-----------RNPETPVLTLQ--GHSSSLNQIKWHPTERNILLSCADDCQVLYWD 421

Query: 378 ISKKL 382
           ++  L
Sbjct: 422 LNSSL 426

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 3/78 (3%)

Query: 117 VIRARYMPKNDKIIATING-KGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGE 175
           ++R    P +  I+AT      KI I D    ++  L  TL  H  +   + ++P     
Sbjct: 350 LLRLEPSPHDPNIVATFAADSNKIIILDMRNPETPVL--TLQGHSSSLNQIKWHPTERNI 407

Query: 176 LLSASDDTTVALWDINST 193
           LLS +DD  V  WD+NS+
Sbjct: 408 LLSCADDCQVLYWDLNSS 425

>KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa]
           {ON} Anc_8.316 YDR142C
          Length = 372

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 121/277 (43%), Gaps = 38/277 (13%)

Query: 135 GKGKIFIYD-RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           G GK+++ +  SK +       L+  +D  + +A+N   E ++L A  D ++ L+D    
Sbjct: 36  GNGKVYLLEIDSKGQIHETNSFLT--QDCLFDVAWNELHENQVLVAQGDGSLRLFDTTLK 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV--------------HDKRSLSN 239
           D P+ I   H   V    W+   +N F + S D T+++              H  + + N
Sbjct: 94  DYPIEIFNEHEREVFSCSWNLITKNTFTSSSWDGTVKIWSPLRKASLLTLVPHPLKVMKN 153

Query: 240 SAQV-LPV--EKPLNALA----------FSKHSKNLIAAAGTDTRVYLYDLRRLS----- 281
             QV +P+  +K   A++          FS H  NL+     ++   L+DLR+ S     
Sbjct: 154 FDQVDIPISNQKAHTAISKNKNCIYQAQFSPHDPNLVICCAGNSYTTLFDLRQPSTSNNQ 213

Query: 282 EPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAE-QAQEDADDGVPEL 340
           +   + +G +    + +F+ ++  I+ + G D  + IWDL  +  + QA    D+ +  +
Sbjct: 214 QNFFSHSGLE--ALTCDFNKYRPNIVATGGVDNTIRIWDLRMLSKQFQAGTQRDNSIMCV 271

Query: 341 MMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
             +  GH  A+   S++P     + S   D    VW+
Sbjct: 272 NEIKKGHELAVRKVSWSPHSSTTLLSTSYDMTCCVWQ 308

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 113/277 (40%), Gaps = 44/277 (15%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNG-YGLAFNPQIEGELLSASDDTTVALWDINST 193
           G GK+FI D        + ++ S+   +G + +A+N     ++L+A  D ++ L+DIN  
Sbjct: 36  GNGKLFILDIDPHGR--MVESNSFLTQDGLFDVAWNEGHANQVLAAQGDGSLRLFDINLP 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNAL 253
             P+SI   H   V    W+  ++  F + S D T+++       +   ++P+    + L
Sbjct: 94  QYPISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQESLTTLVPIPMERSPL 153

Query: 254 A-----------------------------FSKHSKNLIAAAGTDTRVYLYDLRRLSEPL 284
                                         FS H  NLI     ++ V L+DLR   +P 
Sbjct: 154 VEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLR---QPT 210

Query: 285 HT-----MAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPE 339
           +T     M+       + +F+ ++  I+ + G D+ + IWDL  +            + E
Sbjct: 211 NTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINE 270

Query: 340 LMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
           +     GH  AI   S++P    L+ S   D   +VW
Sbjct: 271 I----PGHELAIRKVSWSPHHSNLVLSTSYDMTCRVW 303

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 84/200 (42%), Gaps = 17/200 (8%)

Query: 198 SIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS-AQVLPVEKPLNALA-- 254
           SI+  + D +  +++   D N+    + +  + + D R  +N+  Q       L  L   
Sbjct: 170 SIISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCD 229

Query: 255 FSKHSKNLIAAAGTDTRVYLYDLR---RLSEPLHT------MAGHQDAVTSIEFSSHKDG 305
           F+K+  +++A  G D  V ++DLR   + S PL        + GH+ A+  + +S H   
Sbjct: 230 FNKYRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSN 289

Query: 306 ILCSSGSDRRLFIWD--LTQIGAEQAQEDADDGVPELMMMHAGHRSAI--NDFSFNPQVP 361
           ++ S+  D    +WD      G    + ++ D       +   H   +   D+S   Q P
Sbjct: 290 LVLSTSYDMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRFIFPHHTEFVFGADWSLWGQ-P 348

Query: 362 WLIASAEEDNVVQVWKISKK 381
             +AS   D  V +W  S +
Sbjct: 349 GYVASTAWDGNVCIWHTSAR 368

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 134/341 (39%), Gaps = 77/341 (22%)

Query: 29  LMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS--GDENNYLKIAAIDLPY 86
           L +D V+E  +T+P  +IQW PS+              TH       ++ L+I +     
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSM--------------THPRRFATCSDSLRIWSF---- 191

Query: 87  EVVGLPDEDNSSEPVK-SMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRS 145
                 +E N  E +  S+ K  K+ +               ++ A   G G I     +
Sbjct: 192 ----CEEERNLQEQINLSLCKYDKQQQGAS------------RVNAAAGGSGSI---RTN 232

Query: 146 KSKSEGLCKTL----SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVM 201
             + +GL   L    S+H        +NP     L+S+S DTT  +WD+ S++   + ++
Sbjct: 233 PQQQQGLIGELPPITSFH--------WNPVDPNLLISSSIDTTCIVWDLQSSNYVRTQLI 284

Query: 202 NHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS----------AQVLPVEK--- 248
            H   V D ++      +F +   D +++V D R L++S          A + P      
Sbjct: 285 AHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGS 344

Query: 249 ----------PLNALAFSKHSKNLIAAAGTDT-RVYLYDLRRLSEPLHTMAGHQDAVTSI 297
                     PL  L  S    N+IA    D+ RV + D+R    P+  + GH  AV  +
Sbjct: 345 SSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQM 404

Query: 298 EFSSHKDGILCSSGSDRRLFIWDLTQ-IGAEQAQEDADDGV 337
            +   K  +L S   D ++  WDL   I      +D D  V
Sbjct: 405 RWHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAV 445

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 123/277 (44%), Gaps = 42/277 (15%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLCK-TLSYHKDNGYGLAFNPQIEGELLSASDD 182
           P +   +A+ +  G I I+D        +C+ TLS H ++   + +  Q  G L S S D
Sbjct: 245 PGSKPRLASSSKDGTIKIWDSVNR----VCQYTLSGHTNSVSCVKWGGQ--GLLYSGSHD 298

Query: 183 TTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV------HDKRS 236
            TV +WD+NS  R ++I+ +H   VN             ++S D  L+V        K +
Sbjct: 299 RTVRVWDMNSQGRCINILKSHAHWVNHL-----------SLSTDYALRVGAFDHTGKKPA 347

Query: 237 LSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTS 296
            S  AQ   +E        +  S+ ++  A  D  ++L++  + ++P+  M GHQ  V  
Sbjct: 348 TSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNH 407

Query: 297 IEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFS 355
           + FS   DG  + S+  D  + +W            D  DG  + +    GH +++   +
Sbjct: 408 VAFS--PDGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVA 451

Query: 356 FNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
           ++     L+ S  +D  ++VW +  + +S  +P + D
Sbjct: 452 WSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHQD 487

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/250 (20%), Positives = 108/250 (43%), Gaps = 22/250 (8%)

Query: 84  LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD 143
           +PY          +S+PVK+ I +T        +I+  +    D+I      +    +  
Sbjct: 75  VPYTFSCTIQGKKASDPVKT-IDITDNLY--SSLIKPGFNSTEDQITLLYTPRAVFKVKP 131

Query: 144 RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNH 203
            ++S S      ++ H       AF P     +++ + D T  +WD + T  P+  +  H
Sbjct: 132 VTRSSS-----AIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMHTLKGH 185

Query: 204 TDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPV-EKPLNALAF------S 256
            + V    W   D  +  T S D T+++ + ++       L    K +  L++       
Sbjct: 186 FNWVLCVSWSP-DGEVIATGSMDNTIRLWNPKTGECLGDALRGHSKWITCLSWEPIHLVK 244

Query: 257 KHSKNLIAAAGTDTRVYLYD-LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
             SK  +A++  D  + ++D + R+ +  +T++GH ++V+ +++     G+L S   DR 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDSVNRVCQ--YTLSGHTNSVSCVKWGGQ--GLLYSGSHDRT 300

Query: 316 LFIWDLTQIG 325
           + +WD+   G
Sbjct: 301 VRVWDMNSQG 310

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 119/278 (42%), Gaps = 44/278 (15%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDT 183
           P N   IA+ +  G I ++D  + +      TLS H  +   + +  Q  G + + S D 
Sbjct: 272 PGNKPRIASASKDGTIKVWDTVRRQ---CILTLSGHTSSVSCIKWGGQ--GVIYTGSHDR 326

Query: 184 TVALWDINSTDRPVSIVMNHTDIVNDS--------KWHEFDENIFGTVSEDKTLQVHDKR 235
           T+  WD+N+  + ++I+ +H   VN          K   FD     T S   T +   KR
Sbjct: 327 TIRCWDMNAGGKCINILKSHAHWVNHLSLSTDYALKVGAFDH----TYSRPATAEEAQKR 382

Query: 236 SLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVT 295
           +L N  +V      L         + LIA A  D  +YL++  + ++PL  M GHQ  V 
Sbjct: 383 ALKNYEKVAKRNGVL---------EELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVN 433

Query: 296 SIEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDF 354
            + FS   DG  + S+  D  + +W+ +                + +    GH +++   
Sbjct: 434 HVAFS--PDGRYIVSASFDNSIKLWEGSS--------------GKFISTFRGHVASVYQV 477

Query: 355 SFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
           +++     L+ S  +D  ++VW +  + ++  +P + D
Sbjct: 478 AWSSDCR-LLVSCSKDTTLKVWDVRTRKLAVDLPGHND 514

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 77/165 (46%), Gaps = 12/165 (7%)

Query: 168 FNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDK 227
           F P     +++ S D    +WD + T  P+  +  HT+ V    W   D  +  T S D 
Sbjct: 178 FAPHTSSRMVTGSGDNNARIWDCD-TQTPIYTLKGHTNWVLCVAWSA-DGEVIATGSMDN 235

Query: 228 TLQVHDKRSLSNSAQVLPVE-KPLNALAF------SKHSKNLIAAAGTDTRVYLYDLRRL 280
           T+++ D ++  +    L    K + ++++      +  +K  IA+A  D  + ++D  R 
Sbjct: 236 TIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVR- 294

Query: 281 SEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
            + + T++GH  +V+ I++     G++ +   DR +  WD+   G
Sbjct: 295 RQCILTLSGHTSSVSCIKWGGQ--GVIYTGSHDRTIRCWDMNAGG 337

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 125/276 (45%), Gaps = 50/276 (18%)

Query: 130 IATINGKGKIFIYDRSKSKSEGLC-KTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           +A+ +  G I I+D ++     +C  TLS H ++   + +    EG L S S D TV +W
Sbjct: 253 LASASKDGTIKIWDTARR----VCLYTLSGHSNSVACVKWGG--EGLLYSGSHDKTVRVW 306

Query: 189 DINST--DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV--HDKRSLSNSAQVL 244
           D+NS    + +SI+ NH   VN             ++S D  L++   D   +  S    
Sbjct: 307 DMNSATVGKCISILKNHAHWVNHL-----------SLSTDYALRIGPFDHTGVKPST--- 352

Query: 245 PVEKPLNALA-FSKHSKN------LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSI 297
           P E    A A + K +K       L+  A  D  ++L++ ++L++PL  M GHQ  V  +
Sbjct: 353 PAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHV 412

Query: 298 EFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSF 356
            FS   DG  + S+  D  + +W            D  DG  + +    GH +++   ++
Sbjct: 413 AFS--PDGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAW 456

Query: 357 NPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
           +     L+ S  +D  ++VW +  + +S  +P + D
Sbjct: 457 SSDCR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHQD 491

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 82/169 (48%), Gaps = 20/169 (11%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD + T  P++ +  H++ V    W   D  +  T S D
Sbjct: 146 AFAPDTSSRMVTGAGDNTARIWDCD-TQTPLATLEGHSNWVLCVSWSP-DGEVIATGSMD 203

Query: 227 KTLQVHDKR-------SLSNSAQVLPVEKPLNALAFSK------HSKNLIAAAGTDTRVY 273
            T+++ +            +S+ +    K + +L++         +K  +A+A  D  + 
Sbjct: 204 STIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIK 263

Query: 274 LYDL-RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           ++D  RR+   L+T++GH ++V  +++    +G+L S   D+ + +WD+
Sbjct: 264 IWDTARRVC--LYTLSGHSNSVACVKWGG--EGLLYSGSHDKTVRVWDM 308

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 123/277 (44%), Gaps = 42/277 (15%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLCK-TLSYHKDNGYGLAFNPQIEGELLSASDD 182
           P +   +A+ +  G I I+D        +C+ T+S H ++   + +  Q  G L S S D
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSR----VCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHD 298

Query: 183 TTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV------HDKRS 236
            TV +WDINS  R ++I+ +H   VN             ++S D  L++        K S
Sbjct: 299 RTVRVWDINSQGRCINILKSHAHWVNHL-----------SLSTDYALRIGAFDHTGKKPS 347

Query: 237 LSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTS 296
               AQ   +E        + +S+ ++  A  D  ++L++  + ++P+  M GHQ  V  
Sbjct: 348 TPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNH 407

Query: 297 IEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFS 355
           + FS   DG  + S+  D  + +W            D  DG  + +    GH +++   +
Sbjct: 408 VAFS--PDGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVA 451

Query: 356 FNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
           ++     L+ S  +D  ++VW +  + +S  +P + D
Sbjct: 452 WSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 109/250 (43%), Gaps = 22/250 (8%)

Query: 84  LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD 143
           +PY          +S+PVK+ I +T        +I+  Y    D+I      +    +  
Sbjct: 75  VPYTFSCTIQGKKASDPVKT-IDITDNLY--SSLIKPGYNSTEDQITLLYTPRAVFKVKP 131

Query: 144 RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNH 203
            ++S S      ++ H       AF P     +++ + D T  +WD + T  P+  +  H
Sbjct: 132 VTRSSS-----AIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMHTLKGH 185

Query: 204 TDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE-KPLNALAF------S 256
            + V    W   D  +  T S D T+++ D +S       L    K + +L++       
Sbjct: 186 YNWVLCVSWSP-DGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVK 244

Query: 257 KHSKNLIAAAGTDTRVYLYD-LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
             SK  +A++  D  + ++D + R+ +  +TM+GH ++V+ +++     G+L S   DR 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQ--YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRT 300

Query: 316 LFIWDLTQIG 325
           + +WD+   G
Sbjct: 301 VRVWDINSQG 310

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 78/154 (50%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N   E  +++ASDD T+ LW+   + +P++ +  H  +VN   +   D     + S D +
Sbjct: 367 NGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNS 425

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL--RRLSEPLHT 286
           +++ D R     +        +  +A+S   + L+ +   DT + ++D+  R+LS  L  
Sbjct: 426 IKLWDGRDGKFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDL-- 482

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GH+D V ++++S   DG  +CS G D+ + +W
Sbjct: 483 -PGHKDEVYTVDWSV--DGKRVCSGGKDKMVRLW 513

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 92/383 (24%), Positives = 159/383 (41%), Gaps = 83/383 (21%)

Query: 30  MYDFVSETKLTWPSLSIQWLP----SVDANVPLKQQEMILGTHTSGD---ENNYLKIAAI 82
           +YD +    + WP L++  +P    S   N P   Q +++ T T      EN  + ++  
Sbjct: 121 VYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYP---QSLLMTTATQASRKKENELMVLSLS 177

Query: 83  DLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHE-----DEVIRARYMP----KNDKIIATI 133
            L   +V   DE NS E  +   +     E+E     D   R R  P      + + AT+
Sbjct: 178 QLAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTATM 237

Query: 134 NGKGKIFIYD---RSKS----------KSEGLCKTLSYHKD-NGYGLAFNPQIE-GELLS 178
           +  G+++I+D   +SK+           S+    T+  H +  GY L ++P I+ G LL+
Sbjct: 238 SENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGALLT 297

Query: 179 ASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLS 238
                 + L     T R            N SKW          V++ +   V + +S+ 
Sbjct: 298 GDCSGQIYL-----TQR------------NTSKW----------VTDKQPFTVGNNKSVE 330

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSI 297
           +             + +S+    + A+ G D  V ++D R +  +P  ++      V  I
Sbjct: 331 D-------------IQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVI 377

Query: 298 EFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSF 356
            ++  K G L +SG D   + +WDL Q       ++ ++  P  +  +  H+ AI   SF
Sbjct: 378 SWN-EKIGYLLASGDDNGSWGVWDLRQF----TPDNINNVQP--VAQYDFHKGAITSISF 430

Query: 357 NPQVPWLIASAEEDNVVQVWKIS 379
           NP    +IA A EDN V +W +S
Sbjct: 431 NPLEESIIAVASEDNTVTLWDLS 453

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 92/181 (50%), Gaps = 14/181 (7%)

Query: 158 YHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW--HEF 215
           Y ++N + L   P  +  L+++  D +V L D  +  + +S +  HT  +ND K    +F
Sbjct: 10  YFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNL-KTISSIQCHTTSINDMKVINSDF 68

Query: 216 DEN-IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGT-----D 269
           D   +F T +ED  ++V D R+ +N   V  ++    +  FS  S++ + A GT     D
Sbjct: 69  DTGAVFATAAEDG-VKVWDIRARNN---VASLQNDKASPFFSLDSRHNMLACGTELKDYD 124

Query: 270 TRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQ 328
             +++YD+R  ++P+ +    H D +T I+F      +L S  +D  + I+DLTQ   E 
Sbjct: 125 AELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDEED 184

Query: 329 A 329
           A
Sbjct: 185 A 185

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 123/277 (44%), Gaps = 42/277 (15%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLCK-TLSYHKDNGYGLAFNPQIEGELLSASDD 182
           P +   +A+ +  G I I+D        +C+ T+S H ++   + +  Q  G L S S D
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSR----VCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHD 298

Query: 183 TTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV------HDKRS 236
            TV +WDINS  R ++I+ +H   VN             ++S D  L+V        + S
Sbjct: 299 RTVRVWDINSQGRCINILKSHAHWVNHL-----------SLSTDYALRVGAFDHTGKRPS 347

Query: 237 LSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTS 296
               AQ   +E        + +S+ ++  A  D  ++L++  + ++P+  M GHQ  V  
Sbjct: 348 TPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKLVNH 407

Query: 297 IEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFS 355
           + FS   DG  + S+  D  + +W            D  DG  + +    GH +++   +
Sbjct: 408 VAFS--PDGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVA 451

Query: 356 FNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
           ++     L+ S  +D  ++VW +  + +S  +P + D
Sbjct: 452 WSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 109/250 (43%), Gaps = 22/250 (8%)

Query: 84  LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD 143
           +PY          +S+PVK+ I +T        +I+  Y    D+I      +    +  
Sbjct: 75  VPYTFSCTIQGKKASDPVKT-IDITDNLY--SSLIKPGYNSTEDQITLLYTPRAVFKVKP 131

Query: 144 RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNH 203
            ++S S      ++ H       AF P     +++ + D T  +WD + T  P+  +  H
Sbjct: 132 VTRSSS-----AIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMHTLKGH 185

Query: 204 TDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPV-EKPLNALAF------S 256
            + V    W   D  +  T S D T+++ D ++       L    K + +L++       
Sbjct: 186 YNWVLCVSWSP-DGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVK 244

Query: 257 KHSKNLIAAAGTDTRVYLYD-LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
             SK  +A++  D  + ++D + R+ +  +TM+GH ++V+ +++     G+L S   DR 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQ--YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRT 300

Query: 316 LFIWDLTQIG 325
           + +WD+   G
Sbjct: 301 VRVWDINSQG 310

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 78/154 (50%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N   E  +++ASDD T+ LW+   + +PV+ +  H  +VN   +   D     + S D +
Sbjct: 367 NGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKLVNHVAFSP-DGRYIVSASFDNS 425

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL--RRLSEPLHT 286
           +++ D R     +        +  +A+S   + L+ +   DT + ++D+  R+LS  L  
Sbjct: 426 IKLWDGRDGKFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDL-- 482

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GH+D V ++++S   DG  +CS G D+ + +W
Sbjct: 483 -PGHKDEVYTVDWSV--DGKRVCSGGKDKMVRLW 513

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 121/274 (44%), Gaps = 36/274 (13%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLCK-TLSYHKDNGYGLAFNPQIEGELLSASDD 182
           P     +AT +  G I I+D ++     +C  TLS H  +   + +  Q    L S S D
Sbjct: 242 PGERPRLATSSKDGTIKIWDTTRR----VCTMTLSGHTSSVSCVKWGGQ--NFLYSGSHD 295

Query: 183 TTVALWDINSTDRPVSIVMNHTDIVND---SKWHEFDENIFGTVSED-KTLQVHDKRSLS 238
            TV +WD+ ++ R ++I+ NH   VN    S  +      F    E   T ++   ++L 
Sbjct: 296 KTVRVWDMKNSGRCINILKNHAHWVNHLSLSTDYALRVGPFDYTGEQPATPEIAKAKALK 355

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
           N  +V        A    K ++ L+  A  D  ++L+D  R ++P+  M GHQ  V  + 
Sbjct: 356 NYEKV--------AKRNGKETE-LMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVA 406

Query: 299 FSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358
           FS     I+ S+  D  + +W            D+ DG  + +    GH +++   +++ 
Sbjct: 407 FSPDGRHIV-SASFDNSIKLW------------DSRDG--KFITTFRGHVASVYQVAWSS 451

Query: 359 QVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
               L+ S  +D  ++VW I  + +S  +P + D
Sbjct: 452 DCR-LLVSCSKDTTLKVWDIRTRKLSVDLPGHKD 484

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 74/166 (44%), Gaps = 12/166 (7%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD + T  P++ +  H + V    W   D  +  T S D
Sbjct: 147 AFAPHTSSRMVTGAGDNTARIWDCD-TQTPMATLTGHHNWVLCVSWSP-DGELIATGSMD 204

Query: 227 KTLQVHDKRSLSNSAQVLPVE-KPLNALAF------SKHSKNLIAAAGTDTRVYLYDLRR 279
            T+++ + ++       L    K + +L++      +   +  +A +  D  + ++D  R
Sbjct: 205 NTVRLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTR 264

Query: 280 LSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
               + T++GH  +V+ +++       L S   D+ + +WD+   G
Sbjct: 265 RVCTM-TLSGHTSSVSCVKWGGQN--FLYSGSHDKTVRVWDMKNSG 307

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 42/104 (40%), Gaps = 15/104 (14%)

Query: 274 LYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDA 333
           ++ ++ ++     +AGH   +    F+ H    + +   D    IW            D 
Sbjct: 123 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 170

Query: 334 DDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           D   P  M    GH + +   S++P    LIA+   DN V++W+
Sbjct: 171 DTQTP--MATLTGHHNWVLCVSWSPDGE-LIATGSMDNTVRLWE 211

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 123/277 (44%), Gaps = 40/277 (14%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYH--KDNGYGLAFNPQIEGELLSASDDTTVALWDINS 192
           G G +FI D      +G   +++    +D  Y +A+N   E ++L A  D ++ L+D + 
Sbjct: 37  GNGNLFILDIDP---QGRIHSMNSFMTQDCLYDVAWNELHENQVLVAQGDGSLRLFDTSL 93

Query: 193 TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV---HDKRSLSNSAQVLPVEKP 249
              P++I   H+  V    W+  ++  F + S D T+++   + K SL  + QV PV + 
Sbjct: 94  QKFPIAIFKEHSKEVLSCNWNLINKQTFVSSSWDGTVKIWTPNRKESL-RTLQVQPVMQS 152

Query: 250 L---NALA--------------------FSKHSKNLIAAAGTDTRVYLYDLRRL---SEP 283
               N +A                    FS H +NL+     ++ V L+DLR+    ++ 
Sbjct: 153 QLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQ 212

Query: 284 LHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWD---LTQIGAEQAQEDADDGVPEL 340
              +A +     + +F+ ++  ++ +SG D  + IWD   L  +G +   +  +     +
Sbjct: 213 QRFLAHNGSETLTCDFNKYRPTVVATSGVDSSIRIWDIRMLVNLGPQ--SQHINSSAACI 270

Query: 341 MMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
             +   H  A+   +++P  P ++ SA  D    VW+
Sbjct: 271 NEITRAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQ 307

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 90/201 (44%), Gaps = 31/201 (15%)

Query: 152 LCKTLSYHK-DNGYGLAFNPQIEGE----------------LLSASDDTTVALWDINSTD 194
           LCK    H   NG  +    QI GE                L+S+S DTT  +WD+ S++
Sbjct: 255 LCKYNKLHNITNGTSVTSTSQILGEFPPVTSFDWNQTDTNLLISSSIDTTCIVWDLQSSN 314

Query: 195 RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL-PVEKPLNAL 253
              + ++ H   V D ++      +F +   D +++V D RSL++S  +  P   P++  
Sbjct: 315 YVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNA 374

Query: 254 AFSKHSK------------NLIAAAGTDT-RVYLYDLRRLSEPLHTMAGHQDAVTSIEFS 300
             S+               N+IA   +++ ++ + D+R    P+  + GH+ A+  I++ 
Sbjct: 375 DLSQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLVLEGHKSAINQIKWH 434

Query: 301 SHKDGILCSSGSDRRLFIWDL 321
             K  IL S   D ++  WDL
Sbjct: 435 PTKRYILLSCSDDCQVLYWDL 455

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 82/180 (45%), Gaps = 7/180 (3%)

Query: 212 WHEFDENIFGTVSEDKTLQVHDKRSLSN--SAQVLPVEKPLNALAFSKHSKNLIAAAGTD 269
           W++ D N+  + S D T  V D +S SN    Q++  +  +  + F   S  L A+ G D
Sbjct: 288 WNQTDTNLLISSSIDTTCIVWDLQS-SNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGD 346

Query: 270 TRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC--SSGSDRRLFIWDLTQIGAE 327
             V ++DLR L+          + V++ + S  ++ +L    S +D  +    +++    
Sbjct: 347 GSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKI 406

Query: 328 QAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII 387
              +  +   P L++   GH+SAIN   ++P   +++ S  +D  V  W ++     N +
Sbjct: 407 LILDMRNSESPVLVL--EGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNSTFSGNTV 464

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 99  EPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIAT-INGKGKIFIYDRSKSKSEGLCKTLS 157
           EP  + +      + ++ ++R    P +  +IAT ++   KI I D   S+S  L   L 
Sbjct: 365 EPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVL--VLE 422

Query: 158 YHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
            HK     + ++P     LLS SDD  V  WD+NST
Sbjct: 423 GHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNST 458

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 60/130 (46%), Gaps = 11/130 (8%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKSEGLCKT---------LS 157
           T+   H+ EV   R++ K+ ++ A+  G G + ++D RS + S  + +          LS
Sbjct: 318 TQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLS 377

Query: 158 YHKDNGYGLAFNPQIEGELLS-ASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFD 216
             ++    L  +P     + +  S+   + + D+ +++ PV ++  H   +N  KWH   
Sbjct: 378 QQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLVLEGHKSAINQIKWHPTK 437

Query: 217 ENIFGTVSED 226
             I  + S+D
Sbjct: 438 RYILLSCSDD 447

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 84/178 (47%), Gaps = 6/178 (3%)

Query: 144 RSKSKSEGLCK--TLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVM 201
           R   +S GL    TL  H++      F+P  +  + SAS DTT  LWD+  T + + +  
Sbjct: 248 RYNGESNGLVNVATLGGHENRVVNTVFHPS-DKYVASASFDTTWRLWDVE-TAQELQLQE 305

Query: 202 NHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKN 261
            H+  V    +   D  +  +   D    V D RS  N   +    KP+  + +S +S  
Sbjct: 306 GHSKEVYSLSFQP-DGALICSGGLDSLAMVWDLRSGKNIVTLQGHAKPVYCVDWSSNSHQ 364

Query: 262 LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIW 319
           L A  G D  V ++DLR+L +P   +  H+  V+S+ F  ++  +L S G DR L ++
Sbjct: 365 L-ATGGGDGVVNVWDLRKLEQPATKLLAHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 51/125 (40%), Gaps = 23/125 (18%)

Query: 259 SKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLF 317
           S   +A+A  DT   L+D+    E L    GH   V S+ F    DG ++CS G D    
Sbjct: 277 SDKYVASASFDTTWRLWDVETAQE-LQLQEGHSKEVYSLSF--QPDGALICSGGLDSLAM 333

Query: 318 IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN--DFSFNPQVPWLIASAEEDNVVQV 375
           +WDL                 + ++   GH   +   D+S N      +A+   D VV V
Sbjct: 334 VWDLRS--------------GKNIVTLQGHAKPVYCVDWSSNSH---QLATGGGDGVVNV 376

Query: 376 WKISK 380
           W + K
Sbjct: 377 WDLRK 381

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 83/172 (48%), Gaps = 12/172 (6%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           ++H D    L+ N      L S S D TV LWD+N+     SI   H +  V+ S+WH  
Sbjct: 276 THHTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNGIAARSIASIHNNKNVSSSQWHST 335

Query: 216 DENIFGTVSEDKTLQVHDKRSLSNSA-----QVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
           D +I  T   D  + V D R   +SA      V+  E+ + ++ F+  S+N+I       
Sbjct: 336 DGSILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEE-IESVRFA--SENVIMCGTDSG 392

Query: 271 RVYLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IW 319
            VY +D+R    S+PL T+  H   ++S++ + H   +L +S    ++  +W
Sbjct: 393 NVYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQHVPNMLATSAMGEKVVKLW 444

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 285 HTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           H    H DAV S+  + H   +L S+ +D  + +WDL
Sbjct: 273 HVTTHHTDAVLSLSHNRHFRAVLASTSADHTVKLWDL 309

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 121/280 (43%), Gaps = 45/280 (16%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSY-HKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           G GK+FI D +      + ++ S+  KD  + +A+N   E ++L+A  D ++ L+DIN  
Sbjct: 37  GNGKLFILDITPQGK--IVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDINLQ 94

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD---KRSLSN----------- 239
             PV+I   H   V    W+  D+  F + S D T+++     K+SL             
Sbjct: 95  KYPVAIFQEHEREVFSCNWNLIDKQTFLSSSWDGTVKIWSPARKQSLRTLLPTPTNNTVL 154

Query: 240 -SAQVLPVEKPLNALA----------------FSKHSKNLIAAAGTDTRVYLYDLRRLSE 282
             + VL  + P++  A                +S H  NL+ +   ++ V ++D+R   +
Sbjct: 155 VDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDSNLVMSCSGNSYVSIFDIR---Q 211

Query: 283 PLHT-----MAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGV 337
           P++T     +A       + +F+ ++  I+ + G D+ + +WDL  +        +    
Sbjct: 212 PVNTEQQSFIAHRGLEALTCDFNKYRPHIVATGGVDKLIKVWDLRMVRQSLLHTRSS--- 268

Query: 338 PELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           P  +    GH  A+    ++P    ++ S   D   + W+
Sbjct: 269 PVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMTCRTWQ 308

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 111/282 (39%), Gaps = 43/282 (15%)

Query: 135 GKGKIFIYD---RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDIN 191
           G GK+FI D   R K K   +  T    +D  + L++N   E ++L A  D ++ L+D  
Sbjct: 37  GNGKLFILDIDERGKIKENNIFIT----QDCLFDLSWNELHENQVLVAQGDGSLRLFDTT 92

Query: 192 STDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV----------------HDKR 235
               P+ I   H   V    W+   +  F + S D  +++                 ++ 
Sbjct: 93  LQKYPIGIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVKMWSPLREQSLLTLLPKSSEQS 152

Query: 236 SLSNSAQVLPVEKPLN---------------ALAFSKHSKNLIAAAGTDTRVYLYDLRRL 280
           S  N  Q+  +   +N                  FS H  NLIA    ++ + L+D R  
Sbjct: 153 SKINHNQIAKIPPHVNNNQSTPILQNKDCVYQAQFSPHDNNLIACCSGNSYITLFDTREQ 212

Query: 281 SEPLH--TMAGHQDAVT-SIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGV 337
           +   +  +   H    T +++F+ ++  +L SSG+D  + IWD+  I    +        
Sbjct: 213 NNRFNNNSFIAHSGLETLTLDFNKYRPTVLASSGADNSIKIWDMRMIRNNNSNNTVMPTS 272

Query: 338 PELMM--MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
             + M  +   H  A+    ++P    L+ S   D   +VWK
Sbjct: 273 NPICMNEIRKAHDLAVRRVVWSPHQSNLLLSTSYDMTSKVWK 314

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 114/285 (40%), Gaps = 54/285 (18%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD 194
           G GK++I D S  + + + +     +D  + LA++   E + L A  D ++ L+D     
Sbjct: 36  GNGKLWILDISP-EGQMVTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSLRLFDTTLDK 94

Query: 195 RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD-----------KRSLSNSAQV 243
            PV++   H D V    W     N F +   D  ++V              R+ SN+A  
Sbjct: 95  YPVAVYQEHRDEVASCNWSLIGRNTFVSSGWDGLVKVWSVGRPNSVMTLKPRTRSNTAV- 153

Query: 244 LPVEKP-----------LNALAFSKHSKNLIAAAGTDTRVYLYDLRRL---SEPLHTMAG 289
             +++P           +    FS H  +L+     D+ V L+DLR       P H    
Sbjct: 154 --LDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMA 211

Query: 290 HQDAVT-SIEFSSHKDGILCSSGSDRRLFIWDLTQI----------------GAEQAQED 332
           H  + T S++F+ ++  ++ + G D ++ IWDL  +                GA+Q Q  
Sbjct: 212 HSGSETLSVDFNKYRTNVIATGGVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQVQCT 271

Query: 333 ADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
            +        +  GH  A+   +++P     + S   D    +W+
Sbjct: 272 NE--------IVGGHELAVRKVNWSPHSSNYLLSTSYDMTCCIWQ 308

>KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {ON}
           conserved hypothetical protein
          Length = 309

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 81/166 (48%), Gaps = 7/166 (4%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFD 216
           SYH  N    A +   +   ++ S DT +AL D+  T + +  +  H  +VN  +     
Sbjct: 54  SYHHGNAAITALDALGDRCAVTGSSDTRLALCDLE-TGQLLRGLAGHRRVVNQVR--ALG 110

Query: 217 ENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD 276
           E+ F +V +D  L+V D             E PL A+A    +++L+ A+G +  +  YD
Sbjct: 111 ESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLEPVIRAYD 170

Query: 277 LRRLSEPLHTM--AGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWD 320
           LRR ++   +   A H DAVTS++ S+   G LC+   D ++ + D
Sbjct: 171 LRRSADHAFSSWPAAHSDAVTSLDVSA--SGKLCTLAFDHQIHVSD 214

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 78/166 (46%), Gaps = 20/166 (12%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           ++S+S DTT  +WD+ S+    + ++ H   V D ++      +F +   D +++V D R
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR 318

Query: 236 SLSNS----------------AQVLPVEKPLNALAF---SKHSKNLIAAAGTDT-RVYLY 275
           SL++S                  + P  K  +AL     S +  N++A    D+ ++ + 
Sbjct: 319 SLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIIL 378

Query: 276 DLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           D+R    P+  + GH  +V  I++   K  +L S G D ++  WDL
Sbjct: 379 DMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 56/136 (41%), Gaps = 17/136 (12%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKSEGLCKTLSYHKDNGYGL 166
           T+   H+ EV   R++ K+ ++ A+  G G + ++D RS + S  + +  S         
Sbjct: 281 TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAG 340

Query: 167 AFNPQIEGE--LLS--------------ASDDTTVALWDINSTDRPVSIVMNHTDIVNDS 210
              P  +G   LL               A+D   + + D+ + + P+  +  H   VN  
Sbjct: 341 TITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGI 400

Query: 211 KWHEFDENIFGTVSED 226
           KWH    N+  +  +D
Sbjct: 401 KWHPTKRNVLLSCGDD 416

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 3/88 (3%)

Query: 107 VTKKFEHEDEVIRARYMPKNDKIIATING-KGKIFIYDRSKSKSEGLCKTLSYHKDNGYG 165
           +T   +  D ++R    P +  ++AT      KI I D    +S  L   L  H  +  G
Sbjct: 342 ITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPIL--NLQGHGSSVNG 399

Query: 166 LAFNPQIEGELLSASDDTTVALWDINST 193
           + ++P     LLS  DD  V  WD+NS+
Sbjct: 400 IKWHPTKRNVLLSCGDDCQVLYWDLNSS 427

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 99/220 (45%), Gaps = 34/220 (15%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW----HEFDEN---------IFGT 222
           LL+AS+D T+  W I    +P + V     IV  S++    HE D N         IF T
Sbjct: 452 LLTASNDLTIKKWKI---PKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFAT 508

Query: 223 VSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSE 282
            S DKT ++ D  +   +A +   ++ L  +AF ++ K LIA    D  + ++ L   S 
Sbjct: 509 ASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDK-LIATCSGDKTIKIWSLDTFS- 566

Query: 283 PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
            + T+ GH +AV    F  +K   L SSG+D  + IWD +     +  +  D+ +  L  
Sbjct: 567 VMKTLEGHTNAVQRCMF-INKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALTE 625

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
           ++ G                +I SA+ D V Q WK   +L
Sbjct: 626 INDGD---------------MIVSADADGVFQFWKDCTEL 650

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/126 (20%), Positives = 52/126 (41%), Gaps = 17/126 (13%)

Query: 259 SKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG---ILCSSGSDRR 315
           +  L+A  GTD  + + D+       H++ GH   +++++F    +    +LCS  ++  
Sbjct: 117 TSTLVALGGTDGSITVVDIEN-GFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGM 175

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
           + +WDL +       ++  + V  L +   G               W + S   DNV  +
Sbjct: 176 VKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDE-------------WQLISGGRDNVCTL 222

Query: 376 WKISKK 381
           W  + K
Sbjct: 223 WNFNLK 228

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 118/273 (43%), Gaps = 41/273 (15%)

Query: 126 NDKIIATI--NGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDT 183
           N+KIIA    NG  +++  +        + K  S H  +   + FN + +  L S  ++ 
Sbjct: 73  NNKIIAGALDNGSLELYSTNEVNDAISSMAK-FSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 184 TVALWDIN-STDRPVSIV-------MNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
            + +WD+N  T+ P +         M+  D VN   W++   ++F +        + D +
Sbjct: 132 EIFIWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 236 S------LSNSAQVLPVEKPLNALAF-SKHSKNLIAAAGTDT--RVYLYDLRRLSEPLHT 286
           +      L  ++    +++ L+ + +  K+S  +  A G+D    + ++DLR  + PL T
Sbjct: 192 AKKEVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQT 251

Query: 287 M-AGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHA 345
           +  GHQ  + S+++    + +L SSG D  + +W+                 PEL    +
Sbjct: 252 LNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN-----------------PELAEQLS 294

Query: 346 GHRSAIN---DFSFNPQVPWLIASAEEDNVVQV 375
              +  N      F P+ P L A A  DN ++V
Sbjct: 295 QFPTRGNWCFKTKFAPEAPDLFACASFDNKIEV 327

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 66/141 (46%), Gaps = 9/141 (6%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMA---GHQDAVTSIEFS 300
           L V+   N L +S H+  +IA A  +  + LY    +++ + +MA    H  +V +++F+
Sbjct: 59  LQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFN 117

Query: 301 SHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQV 360
           + +D +L S G++  +FIWD+      +  E   +  P            +N  ++N  +
Sbjct: 118 AKQDNVLASGGNNGEIFIWDM-----NKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSL 172

Query: 361 PWLIASAEEDNVVQVWKISKK 381
             + ASA   N   +W +  K
Sbjct: 173 AHVFASAGSSNFASIWDLKAK 193

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 122/270 (45%), Gaps = 35/270 (12%)

Query: 126 NDKIIATINGKGKIFIYDRSKSKSEGLCKTLSY--HKDNGYGLAFNPQIEGELLSASDDT 183
           N++IIA     G + +Y  +++ ++ +  T  +  H  +   + FN + +  L S  ++ 
Sbjct: 73  NNEIIAGALDNGTLELYSTNEA-NDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNG 131

Query: 184 TVALWDIN-STDRPVSIV-------MNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
            + +WD+N  T+ P +         M+  D VN   W++   ++F +        + D +
Sbjct: 132 EIFIWDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 236 S------LSNSAQVLPVEKPLNALAF-SKHSKNLIAAAGTDT--RVYLYDLRRLSEPLHT 286
           +      LS ++    +++ L+ + +  K+S  +  A G+D    + ++DLR  + P+ T
Sbjct: 192 AKKEVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQT 251

Query: 287 M-AGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHA 345
           +  GHQ  + S+++    + +L SSG D  + +W+      E A++         +    
Sbjct: 252 LNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWN-----PESAEQ---------LSQFP 297

Query: 346 GHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
              +      F P+ P L A A  DN ++V
Sbjct: 298 ARGNWCFKTKFAPEAPDLFACASFDNRIEV 327

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 62/146 (42%), Gaps = 16/146 (10%)

Query: 247 EKPLNALAFSK--------HSKNLIAAAGTDTRVYLYDLRRLSEPLHTMA---GHQDAVT 295
           EKPL +L            H+  +IA A  +  + LY     ++ + + A    H  +V 
Sbjct: 53  EKPLASLQVDSKFNDLDWSHNNEIIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVK 112

Query: 296 SIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFS 355
           +++F++ +D +L S G++  +FIWD+      +  E      P            +N  +
Sbjct: 113 TVKFNARQDNVLASGGNNGEIFIWDM-----NKCTESPSTYTPLTPGQSMSSVDEVNSLA 167

Query: 356 FNPQVPWLIASAEEDNVVQVWKISKK 381
           +N  +  + ASA   N   +W +  K
Sbjct: 168 WNQSLAHVFASAGSSNFASIWDLKAK 193

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 120/298 (40%), Gaps = 57/298 (19%)

Query: 117 VIRARYMPKNDKIIATINGKGKIFIYDRSKSK--SEGLCKTLSYHKDNGYGLA------- 167
           V R +++PK    +AT +   +I+    S  +  +  LCK   Y K +    A       
Sbjct: 111 VTRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNLSLCK---YSKQSNGSTASAALGSL 167

Query: 168 -------FNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIF 220
                  +N      ++S+S DTT  +WD+ S++   + ++ H   V D K+      +F
Sbjct: 168 PPVTSFDWNSVDTNLIISSSIDTTCTVWDLQSSNYVKTQLIAHDSEVYDVKFLTNSTQLF 227

Query: 221 GTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAF------------------------- 255
            +   D +++V D R L++S  +    +PL  L                           
Sbjct: 228 ASCGGDGSVRVFDLRCLAHSTIIY---EPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLR 284

Query: 256 ---SKHSKNLIAAAGTDTR-VYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG 311
              S    N++A    D+  V + D+R    P+ T+ GH  AV  + +   +  +L + G
Sbjct: 285 LEPSPFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCG 344

Query: 312 SDRRLFIWD----LTQIGAEQAQEDADDGVPELMMMHAGHRSA--INDFSFNPQVPWL 363
            D ++  WD    L   GA  ++ + ++ V  L      +  A  IN+ ++ PQ  W 
Sbjct: 345 DDCQVLYWDINSWLHHSGAATSKWNTNNVVHSLETPKFAYNDAAEINNIAWRPQGDWF 402

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 137/302 (45%), Gaps = 43/302 (14%)

Query: 98  SEPVKSMIKVTKKFEHED-EVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLC-KT 155
            EP++  +K       E   +++A   P+    +A+ +  G I I+D  +     +C  T
Sbjct: 222 GEPLRGHLKWITSLSWEPLHLVKAGEKPR----LASASKDGTIKIWDTVRR----VCVYT 273

Query: 156 LSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVND---SKW 212
           LS H ++   + +  Q  G L S S D TV +WD+N   + ++I+ NH   VN    S  
Sbjct: 274 LSGHTNSVSCVKWGGQ--GVLYSGSHDKTVRVWDMNLGGKCINILKNHAHWVNHLSLSTD 331

Query: 213 HEFDENIFG-TVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTR 271
           +      F  T ++  + +   +++L N  +V  V+K       +  ++ L+  A  D  
Sbjct: 332 YALRRGPFDHTGTKMASPEEAREKALKNYEKV--VKK-------NGTTEELMVTASDDFT 382

Query: 272 VYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQ 330
           ++L++  + ++PL  M GHQ  V  + FS   DG  + S+  D  + +W           
Sbjct: 383 MFLWNPLKSNKPLARMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKLW----------- 429

Query: 331 EDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEY 390
            D  DG  + +    GH S++   +++     L+ S  +D  ++VW +  + +S  +P +
Sbjct: 430 -DGRDG--KFLSTFRGHVSSVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

Query: 391 TD 392
            D
Sbjct: 486 QD 487

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 80/173 (46%), Gaps = 26/173 (15%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD + T  P++ +  H + V    W   D  I  T S D
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCD-TQTPMTTLTGHQNWVLCVSWSP-DGEIIATGSMD 207

Query: 227 KTLQVHDKRSLSNSAQVLPVEKPLNA------------LAFSKHS-KNLIAAAGTDTRVY 273
            T++      L  S +  P+ +PL              L   K   K  +A+A  D  + 
Sbjct: 208 NTIR------LWESDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGTIK 261

Query: 274 LYD-LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           ++D +RR+   ++T++GH ++V+ +++     G+L S   D+ + +WD+   G
Sbjct: 262 IWDTVRRVC--VYTLSGHTNSVSCVKWGGQ--GVLYSGSHDKTVRVWDMNLGG 310

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 79/154 (51%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N   E  +++ASDD T+ LW+   +++P++ +  H  +VN   +   D     + S D +
Sbjct: 367 NGTTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSP-DGRYIVSASFDNS 425

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL--RRLSEPLHT 286
           +++ D R     +        +  +A+S   + L+ +   DT + ++D+  R+LS  L  
Sbjct: 426 IKLWDGRDGKFLSTFRGHVSSVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDL-- 482

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GHQD V ++++S   DG  +CS G D+ + +W
Sbjct: 483 -PGHQDEVYTVDWSV--DGKRVCSGGKDKMIRLW 513

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 43/104 (41%), Gaps = 15/104 (14%)

Query: 274 LYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDA 333
           ++ ++ ++     +AGH   +    F+ H    + +   D    IW            D 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 334 DDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           D   P  M    GH++ +   S++P    +IA+   DN +++W+
Sbjct: 174 DTQTP--MTTLTGHQNWVLCVSWSPDGE-IIATGSMDNTIRLWE 214

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 131/298 (43%), Gaps = 30/298 (10%)

Query: 105 IKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIF---IYDRSKSKSEGLCKTLSYHKD 161
           +KV+    H  EV+ A      +  +  +  + K F    Y   K+  + +    ++   
Sbjct: 220 LKVSPFATHGQEVLTATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNV 279

Query: 162 NGYGLAFNPQIE-GELLSASDDTTVALWDINS----TDR-PVSIVMNHTDIVNDSKWHEF 215
            GYGL ++P I+ G LL+      + L   ++    TD+ P +   N +  V D +W   
Sbjct: 280 EGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQS--VEDIQWSPT 337

Query: 216 DENIFGTVSEDKTLQVHDKRSLSNSAQV--LPVEKPLNALAFSKHSKNLIAAAGTDTRVY 273
           +  +F T   D  +++ D RS  +   +        +N +++++    L+A+   +    
Sbjct: 338 ESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWG 397

Query: 274 LYDLRRLS-------EPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLT-QIG 325
           ++DLR+ S       +P+     H+  +TSI F+   D ++  +  D  + +WDL+ +  
Sbjct: 398 VWDLRQFSPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEAD 457

Query: 326 AEQAQEDADDG------VPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
            ++ Q+   +        P+L+ +H   +  + D  ++ Q+P  + S   D  + VWK
Sbjct: 458 DDEIQQQTKEYKELQKIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 109/235 (46%), Gaps = 24/235 (10%)

Query: 163 GYGLAFNPQIE-GELLSASDDTTVALWDINS----TDRPVSIVMNHTDIVNDSKWHEFDE 217
           GYGL ++P I+ G LL+      V L    S    TD+    V N+  I  D KW   + 
Sbjct: 287 GYGLDWSPLIKTGALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSI-EDIKWSPSEN 345

Query: 218 NIFGTVSEDKTLQVHDKRSLSN--SAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLY 275
            +F T   D  +++ D RS  +  +  V   +  +N +++++    L+A    +    ++
Sbjct: 346 TVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVW 405

Query: 276 DLRRLS------EPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLT------Q 323
           DLR+ S       P+     H+ A+TSI F+   + I+  +  D  + +WDL+      +
Sbjct: 406 DLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEE 465

Query: 324 IGAEQAQ-EDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           I  + A+ ++     P+L+ +H   +  + D  ++ Q+P  + S   D  + VWK
Sbjct: 466 IKQQAAEVKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 517

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 8/133 (6%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           K +  + +S     + A  G D  V ++D+R             D   ++   + K   L
Sbjct: 333 KSIEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYL 392

Query: 308 CSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIAS 366
            ++G D   + +WDL Q   +Q       GV  +   +  H+ AI   SFNP    +IA 
Sbjct: 393 LATGDDNGTWGVWDLRQFSNQQG------GVSPVAQ-YDFHKGAITSISFNPLDESIIAV 445

Query: 367 AEEDNVVQVWKIS 379
           A EDN V +W +S
Sbjct: 446 ASEDNTVTLWDLS 458

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 9/120 (7%)

Query: 121 RYMPKNDKIIATINGKGKIFIYD-RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSA 179
           ++ P  + + AT    G + I+D RSK     L   +S    N   +++N +I   L + 
Sbjct: 339 KWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNV--MSWNQKISYLLATG 396

Query: 180 SDDTTVALWDINSTDR------PVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD 233
            D+ T  +WD+           PV+    H   +    ++  DE+I    SED T+ + D
Sbjct: 397 DDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWD 456

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 129 IIATINGKGKIFIYD-RSKSKSEGLCKTLS---YHKDNGYGLAFNPQIEGELLSASDDTT 184
           ++AT +  G   ++D R  S  +G    ++   +HK     ++FNP  E  +  AS+D T
Sbjct: 392 LLATGDDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNT 451

Query: 185 VALWDIN 191
           V LWD++
Sbjct: 452 VTLWDLS 458

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 129/299 (43%), Gaps = 32/299 (10%)

Query: 105 IKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFI---YDRSKSKSEGLCKTLSYHKD 161
           IK++       EV+ A      +  I  +  + K F    Y   K+  + L    ++   
Sbjct: 226 IKISPFAAESPEVLAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNV 285

Query: 162 NGYGLAFNPQIE-GELLSASDDTTVALWDINS----TDRPVSIVMNHTDIVNDSKWHEFD 216
            GYGL ++P I+ G +L+      V L    +    TD+    V N+  I  D +W   +
Sbjct: 286 EGYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKSI-EDIQWSRAE 344

Query: 217 ENIFGTVSEDKTLQVHDKRSLSN--SAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYL 274
             +F T   D  +++ D RS  +  +  V+  +  +N +++++    L+A+        +
Sbjct: 345 MTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGTWGV 404

Query: 275 YDLRRLSE-------PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLT----- 322
           +DLR+ S        P+     H+ A+TSI F+   + I+  +  D  + +WDL+     
Sbjct: 405 WDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADD 464

Query: 323 ----QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
               Q  AE A+       P+L+ +H   +  + D  ++ Q+P  + S   D  + +WK
Sbjct: 465 EEIKQQTAETAE--LQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWK 518

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 62/135 (45%), Gaps = 11/135 (8%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDG 305
           K +  + +S+    + A  G D  + ++D R  +    L  M    D   ++   + K G
Sbjct: 333 KSIEDIQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDV--NVMSWNEKIG 390

Query: 306 ILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
            L +SG D   + +WDL Q  A+  ++         +  +  H++AI   SFNP    +I
Sbjct: 391 YLLASGDDSGTWGVWDLRQFSAQNTEKTTP------VAQYNFHKAAITSISFNPLDESII 444

Query: 365 ASAEEDNVVQVWKIS 379
           A A EDN V +W +S
Sbjct: 445 AVASEDNTVTLWDLS 459

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 126/292 (43%), Gaps = 38/292 (13%)

Query: 126 NDKIIATINGKGKIFIYDRSKS--KSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDT 183
           +DKIIA     G + ++  +    KSE        H+     + FN +    L S     
Sbjct: 73  DDKIIAGALDSGVVELFSSTGDSLKSEA---RFQQHQGAAKTVKFNSKQNNVLASGGSKG 129

Query: 184 TVALWDINSTDR------PVSIVMNHTDI--VNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
            + +WD+N+  +      P++  +  T I  V    W++   ++F +        + D +
Sbjct: 130 EIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLK 189

Query: 236 S------LSNSAQVLPVEKPLNALAF-SKHSKNLIAAAGTDTR--VYLYDLRRLSEPLHT 286
           +      LS ++    ++  L+ + +  K+S  +  A G+DT   + ++DLR  + PL  
Sbjct: 190 AKKEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQV 249

Query: 287 MA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHA 345
           ++ GH   + S+++ S  + +L SSG D  + +W+      E  QE         +    
Sbjct: 250 LSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN-----PESGQE---------LTQFP 295

Query: 346 GHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397
              +      F P+ P L ASA  DN +QV  + + LV+ +  E T+ K  E
Sbjct: 296 TRGNWCFKTKFAPEAPDLFASASFDNKIQVQTL-QNLVNTLDQEQTESKQKE 346

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 114/253 (45%), Gaps = 30/253 (11%)

Query: 153 CKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW 212
           C T+S+  DN + L   P     LLSA  +  V L D NS      I ++ T I   S  
Sbjct: 6   CDTISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSI---SAL 61

Query: 213 HEFDE-----NIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
              D      N F T SED ++++ D R    +  V  V+   N+   S  S++ + A G
Sbjct: 62  KVLDNDVDSGNTFVTASED-SVKIFDLRL---NQCVATVQNAKNSPFISLDSRHGMLACG 117

Query: 268 T-----DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           T     D  ++LYDL+++  P+ +    H D +T I+F +    +L S  +D  + ++DL
Sbjct: 118 TELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177

Query: 322 TQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
            Q    Q +E+A   V     +H+           +P+  W ++  E  ++ ++   S +
Sbjct: 178 KQ----QEEEEALHQVINFASIHSCGW-------LSPKRIWALSHMETFSIHELNDKSDE 226

Query: 382 LVSNIIPEYTDLK 394
           LV     E+ D++
Sbjct: 227 LVEPKPLEFGDIR 239

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 136/312 (43%), Gaps = 51/312 (16%)

Query: 94  EDNSSEPVKSMIK-----VTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSK 148
           E  S +PV   ++     +T        +++A   P+    +A+ +  G I I+D S+  
Sbjct: 214 EGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPR----LASASKDGTIKIWDTSRR- 268

Query: 149 SEGLC-KTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIV 207
              +C  TLS H ++   + +  Q  G L S S D TV  WD+NS  R ++++ +H   V
Sbjct: 269 ---VCLYTLSGHTNSVSCIKWGGQ--GILYSGSHDKTVRAWDMNSEGRCINVLKSHAHWV 323

Query: 208 NDSKWHEFDENIFGTVSEDKTLQV--HDKRSLSNSAQVLPVEKPL----NALAFSKHSKN 261
           N             ++S D  L+V   D   +  ++     +K L      +  +   + 
Sbjct: 324 NHL-----------SLSTDYALRVGPFDHTGVEPTSPEDARDKALKNYEKVVKKNGRVEE 372

Query: 262 LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIWD 320
           L+  A  D  ++L++  + ++PL  M GHQ  V  + FS   DG  + S+  D  + +W 
Sbjct: 373 LMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFS--PDGRYIVSASFDNSIKLW- 429

Query: 321 LTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISK 380
                      D  DG  + +    GH +++   +++     L+ S  +D  ++VW +  
Sbjct: 430 -----------DGRDG--KFISTFRGHVASVYQVAWSADCR-LLVSCSKDTTLKVWDVRT 475

Query: 381 KLVSNIIPEYTD 392
           + +S  +P + D
Sbjct: 476 RKLSVDLPGHKD 487

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 79/167 (47%), Gaps = 14/167 (8%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD + T  P + +  HT+ V    W    E +  T S D
Sbjct: 150 AFAPNSSSRMVTGAGDNTARIWDCD-TQTPKATLTGHTNWVLCVSWCPNGE-VIATGSMD 207

Query: 227 KTLQVHDKRSLSNSAQVLPVE-KPLNALAF------SKHSKNLIAAAGTDTRVYLYDL-R 278
            T+++ + +S       L    K + +LA+          +  +A+A  D  + ++D  R
Sbjct: 208 NTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDTSR 267

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           R+   L+T++GH ++V+ I++     GIL S   D+ +  WD+   G
Sbjct: 268 RVC--LYTLSGHTNSVSCIKWGGQ--GILYSGSHDKTVRAWDMNSEG 310

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 100/257 (38%), Gaps = 55/257 (21%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           +++T N K    I++ +++ S+ +   L  H      + FNP+    L + S DT V  W
Sbjct: 88  VVSTSNQKA--LIWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSVDTYVHAW 145

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  RP           +  KW+  D NI                             
Sbjct: 146 DMRSPHRPFYTTSAWRSGASQVKWNYKDSNILA--------------------------- 178

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                  S HS +          +Y++DLR  S PLH + GH  +V SI+F+  K   + 
Sbjct: 179 -------SAHSND----------IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIM 221

Query: 309 SSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ-----VPWL 363
           SS +D  +  WD+++ G++          P   +    +    N F   PQ       +L
Sbjct: 222 SSSNDGTVKFWDISK-GSDNCTSTVSTDFP---IWRGRYLPFGNGFCIMPQEGGGNAVYL 277

Query: 364 IASAEEDNVVQVWKISK 380
               E++N+ +  K++K
Sbjct: 278 STLKEQENLNESNKLTK 294

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 122/275 (44%), Gaps = 38/275 (13%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLC-KTLSYHKDNGYGLAFNPQIEGELLSASDD 182
           P +   +A+ +  G I I+D S+     +C  TLS H ++   + +  Q  G L S S D
Sbjct: 245 PGDKPRLASASKDGTIKIWDTSRR----VCIYTLSGHTNSVSCVKWGGQ--GLLYSGSHD 298

Query: 183 TTVALWDINSTDRPVSIVMNHTDIVND---SKWHEFDENIFG-TVSEDKTLQVHDKRSLS 238
            TV +WD+N   + ++I+ +H   VN    S  +      F  T ++  + +   K++L 
Sbjct: 299 KTVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALE 358

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
           N  ++            +  ++ LI  A  D  ++L+D  +  +PL  + GHQ  V  + 
Sbjct: 359 NYEKI---------AKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVA 409

Query: 299 FSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFN 357
           FS   DG  + S+  D  + +W            D  +G    +    GH +++   +++
Sbjct: 410 FSP--DGRFIVSASFDNSIKLW------------DGRNGT--FISTFRGHVASVYQVAWS 453

Query: 358 PQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
                L+ S  +D  ++VW +  + +S  +P + D
Sbjct: 454 SDCR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 81/154 (52%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N + E  +++ASDD T+ LWD   + +P++ +  H  +VN   +   D     + S D +
Sbjct: 367 NGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSP-DGRFIVSASFDNS 425

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL--RRLSEPLHT 286
           +++ D R+ +  +        +  +A+S   + L+ +   DT + ++D+  R+LS  L  
Sbjct: 426 IKLWDGRNGTFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTRKLSVDL-- 482

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GH+D V ++++S   DG  +CS G D+ + +W
Sbjct: 483 -PGHKDEVYTVDWSV--DGKRVCSGGKDKMVRLW 513

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 79/168 (47%), Gaps = 18/168 (10%)

Query: 168 FNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDK 227
           F P     +++ + D T  +WD + T  P++ +  H + V    W    E I  T S D 
Sbjct: 151 FAPHTSSRMVTGAGDNTARVWDCD-TQTPMATLSGHQNWVLCVAWSPDGETI-ATGSMDC 208

Query: 228 TLQVHDKRSLSNSAQVLP---------VEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL- 277
           T+++ D ++       L          V +PL+ +      K  +A+A  D  + ++D  
Sbjct: 209 TVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLV--KPGDKPRLASASKDGTIKIWDTS 266

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           RR+   ++T++GH ++V+ +++     G+L S   D+ + +WD+   G
Sbjct: 267 RRVC--IYTLSGHTNSVSCVKWGGQ--GLLYSGSHDKTVRVWDMNVGG 310

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 85/173 (49%), Gaps = 14/173 (8%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           ++H D    LA N Q    L S S D TV LWD+N+     S+   H++  V+ S+WH  
Sbjct: 287 THHTDAVLSLAHNRQFRTVLASTSADHTVKLWDLNNATAARSMANIHSNKNVSSSQWHMQ 346

Query: 216 DENIFGTVSEDKTLQVHDKRSLSNSAQ------VLPVEKPLNALAFSKHSKNLIAAAGTD 269
           + +I  T   D    + D R +S+ AQ      VLP E+ +    F+  S+N+I      
Sbjct: 347 NASILLTAGYDSRAALTDVR-ISDEAQMSKYWSVLPGEE-IETATFA--SENIILCGTDA 402

Query: 270 TRVYLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
             VY +D+R    S+P+ T+  H   ++S+  +    G++ +    ++++ +W
Sbjct: 403 GNVYSFDIRNNEGSKPVWTLKAHDAGISSLSCNRFISGMMATGAMGEKQVKLW 455

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 84/395 (21%), Positives = 153/395 (38%), Gaps = 107/395 (27%)

Query: 30  MYDFVSETKLTWPSLSIQWLP----SVDANVPLKQQEMILGTHTSGDENNYLKIAAIDLP 85
           +Y+ +    L WP L++  +P    S   N P   Q +++ T T   +    ++  + L 
Sbjct: 121 VYEMLHNVNLPWPCLTLDIIPDNLGSERRNYP---QSILMTTATQASKKKDNELMVLKLS 177

Query: 86  Y---------------------EVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMP 124
           +                     +  G P  +N S P++            D   R R  P
Sbjct: 178 HLTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLR------------DTTNRLRISP 225

Query: 125 ----KNDKIIATINGKGKIFIYDRS--------------KSKSEGLCKTLSYHKDNGYGL 166
               + + + +T++  G++FIYD +              K+    L    ++    GYGL
Sbjct: 226 YATVQQEILTSTMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGL 285

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
            ++P I+   L   D + +           V +   HT     SKW          V++ 
Sbjct: 286 DWSPLIKTGALLTGDCSGM-----------VYLTQRHT-----SKW----------VTDK 319

Query: 227 KTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLH 285
               V + +S+ +             + +S+    + A AG D  + ++D R +  +P+ 
Sbjct: 320 TPFTVGNNKSIED-------------IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVI 366

Query: 286 TMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMH 344
           +       V  I ++  K G L +SG D+  + IWDL Q        +++  +P  +  +
Sbjct: 367 STVVSNTDVNVISWN-EKMGYLLASGDDKGTWGIWDLRQFSP-----NSEKALP--VAQY 418

Query: 345 AGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKIS 379
             H+ AI   SFNP    ++A A EDN V +W +S
Sbjct: 419 DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 453

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 77/166 (46%), Gaps = 20/166 (12%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           ++S+S DTT  +WD+ S+    + ++ H   V D ++      +F +   D +++V D R
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR 318

Query: 236 SLSNSAQVL----------------PVEKPLNALAF---SKHSKNLIAA-AGTDTRVYLY 275
           SL++S  +                 P  K  +AL     S +  N++A  A    ++ + 
Sbjct: 319 SLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIIL 378

Query: 276 DLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           D+R    P+  + GH  +V  I++   K  +L S G D ++  WDL
Sbjct: 379 DMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/138 (19%), Positives = 56/138 (40%), Gaps = 21/138 (15%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKI------------FIYDRSKSKSEGLCKT 155
           T+   H+ EV   R++ K+ ++ A+  G G +             IY+   S + GL   
Sbjct: 281 TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPASSAPGLNAD 340

Query: 156 LSYHKDNGYGL-------AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVN 208
            +     G           ++P +      A++   + + D+ + + P+  +  H+  VN
Sbjct: 341 TTTPASKGSDALLRLEPSPYDPNVLATF--AAESNKIIILDMRNPESPILNLEGHSSSVN 398

Query: 209 DSKWHEFDENIFGTVSED 226
           + KWH    N+  +  +D
Sbjct: 399 EIKWHPTKRNVLLSCGDD 416

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 79/184 (42%), Gaps = 17/184 (9%)

Query: 212 WHEFDENIFGTVSEDKTLQVHD-KRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
           W+  D N+  + S D T  V D + S     Q++  +  +  + F   S  L A+ G D 
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 271 RVYLYDLRRLS------EPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQI 324
            V ++DLR L+      EP  + A   +A T+   S   D +L    S      +D   +
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSP-----YDPNVL 365

Query: 325 GAEQAQEDA----DDGVPELMMMH-AGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKIS 379
               A+ +     D   PE  +++  GH S++N+  ++P    ++ S  +D  V  W ++
Sbjct: 366 ATFAAESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDLN 425

Query: 380 KKLV 383
              +
Sbjct: 426 NSFM 429

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 3/98 (3%)

Query: 97  SSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKG-KIFIYDRSKSKSEGLCKT 155
           SS P  +    T   +  D ++R    P +  ++AT   +  KI I D    +S  L   
Sbjct: 332 SSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPIL--N 389

Query: 156 LSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           L  H  +   + ++P     LLS  DD  V  WD+N++
Sbjct: 390 LEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDLNNS 427

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 89/381 (23%), Positives = 153/381 (40%), Gaps = 81/381 (21%)

Query: 30  MYDFVSETKLTWPSLSIQWLP----SVDANVPLKQQEMILGTHTSGD---ENNYLKIAAI 82
           +Y+ +    + WP L++  +P    S   N P   Q ++L T T      EN  + +A  
Sbjct: 116 VYEMLHNVNMPWPCLTLDVIPDTLGSERRNYP---QSILLATATQSSRKRENELMVLALS 172

Query: 83  DLPYEVVGLPDE---------------DNSSEPVK---SMIKVTKKFEHEDEVIRARYMP 124
           +L   ++   +E               +N + P+K   + +KV+       EV+ A    
Sbjct: 173 NLTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTATMSE 232

Query: 125 KNDKIIATINGKGKIFI---YDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIE-GELLSAS 180
             D  I  +  + K F    Y  SKS    +    S+    GYGL ++P I+ G LLS  
Sbjct: 233 NGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLSG- 291

Query: 181 DDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS 240
            D +  ++              HT     S+W          V++ +   V + +S+ + 
Sbjct: 292 -DCSGQIY----------FTQRHT-----SRW----------VTDKQPFTVSNNKSIED- 324

Query: 241 AQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIEF 299
                       + +S+    + A AG D  + ++D R +  +P  ++      V  I +
Sbjct: 325 ------------IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 372

Query: 300 SSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358
           S  K G L +SG D   + +WDL Q        +AD   P  +  +  H+ AI   +FNP
Sbjct: 373 SD-KIGYLLASGDDNGTWGVWDLRQF----TPSNADTVQP--VAQYDFHKGAITSIAFNP 425

Query: 359 QVPWLIASAEEDNVVQVWKIS 379
               ++A   EDN V +W +S
Sbjct: 426 LDESIVAVGSEDNTVTLWDLS 446

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 81/203 (39%), Gaps = 48/203 (23%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           I++T N K    I++ +K  S  +   L  H      + FN Q    L + S DT V  W
Sbjct: 86  IVSTSNQKA--IIWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAW 143

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  RP     +     +  KW+  D NI                             
Sbjct: 144 DMRSPHRPFYTTSSWRSSASQVKWNFKDSNI----------------------------- 174

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                        L ++ G D  V+++DLR  S PLH + GH   V SI+FS  ++  + 
Sbjct: 175 -------------LASSHGND--VFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIM 219

Query: 309 SSGSDRRLFIWDLTQIGAEQAQE 331
           SS +D  +  WDL++   E+ Q+
Sbjct: 220 SSSNDGTVKFWDLSK--EEKCQQ 240

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 62/135 (45%), Gaps = 16/135 (11%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           + +  + F+    +++A    DT V+ +D+R    P +T +  + + + ++++     IL
Sbjct: 116 RAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSNIL 175

Query: 308 CSS-GSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIAS 366
            SS G+D  +FIWDL              G   L  +  GH S +N   F+      I S
Sbjct: 176 ASSHGND--VFIWDLRH------------GSTPLHKL-TGHNSGVNSIDFSRFEENKIMS 220

Query: 367 AEEDNVVQVWKISKK 381
           +  D  V+ W +SK+
Sbjct: 221 SSNDGTVKFWDLSKE 235

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 21/140 (15%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEP---LHTMAGHQDAVTSIEFS 300
           L VE   NA++ +   ++++ A      +Y+ DL     P   LH     Q  V  +++S
Sbjct: 22  LKVEGGFNAVSINPSGRDVVLAGRQG--LYIIDLDDPFRPPRWLHHKMPWQ--VADVQWS 77

Query: 301 SH--KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358
            H  K   + S+ S+++  IW+L +  +   +            +H GH  AI D +FN 
Sbjct: 78  PHPAKPHWIVST-SNQKAIIWNLNKPSSNAIE----------YALH-GHSRAITDINFNS 125

Query: 359 QVPWLIASAEEDNVVQVWKI 378
           Q P ++A+   D  V  W +
Sbjct: 126 QHPDILATCSIDTYVHAWDM 145

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 74/147 (50%), Gaps = 4/147 (2%)

Query: 179 ASDDTTVALWDI--NSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS 236
           ++ +    LW++  NS+D    ++  H+  + D  +H     I  T S D  +   D RS
Sbjct: 87  STSNQKALLWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRS 146

Query: 237 LSNSAQVLPV-EKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVT 295
              +     V     + + ++  + N++A+A ++  VY++DLR+   PLH + GH ++V 
Sbjct: 147 PRRAYYSASVWSAGASQVKWNYKNSNVMASAHSND-VYIWDLRKGCTPLHVLQGHVNSVN 205

Query: 296 SIEFSSHKDGILCSSGSDRRLFIWDLT 322
           SI+FS   +  + SS +D  +  WD +
Sbjct: 206 SIDFSKFDETEIMSSSNDGTVKFWDYS 232

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 69/140 (49%), Gaps = 21/140 (15%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEP--LHTMAGHQDAVTSIEFS 300
           L V+   NA++ S   ++++ A+     +Y+ DL    S P  LH +   +  V  +++S
Sbjct: 21  LRVDGGFNAVSISPSGRDVVLASRQG--LYVIDLDDPFSAPRWLHHITSWE--VADVQWS 76

Query: 301 SH--KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358
            H  K   + S+ S+++  +W+L++        ++ D +  ++    GH  AI D +F+P
Sbjct: 77  PHPSKPSWVIST-SNQKALLWNLSR--------NSSDAIEHVLH---GHSRAITDINFHP 124

Query: 359 QVPWLIASAEEDNVVQVWKI 378
             P ++A+   D  V  W +
Sbjct: 125 THPEILATCSIDAYVHAWDM 144

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/118 (19%), Positives = 51/118 (43%), Gaps = 14/118 (11%)

Query: 262 LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           ++A    D  V+ +D+R      ++ +      + ++++     ++ S+ S+  ++IWDL
Sbjct: 129 ILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVKWNYKNSNVMASAHSND-VYIWDL 187

Query: 322 TQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKIS 379
            +            G   L ++  GH +++N   F+      I S+  D  V+ W  S
Sbjct: 188 RK------------GCTPLHVLQ-GHVNSVNSIDFSKFDETEIMSSSNDGTVKFWDYS 232

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 124/273 (45%), Gaps = 35/273 (12%)

Query: 134 NGKGKIFIYDRSKS--KSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASD-DTTVALWDI 190
           NG  ++F +D      KS G     + HK +   L FN +    L+S SD +  + +WD+
Sbjct: 83  NGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDL 142

Query: 191 NSTDR-PVS--IVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS------LSNSA 241
           N+ D+ P++  + M  T+ +    W++   ++F   S    + + D ++      L+ + 
Sbjct: 143 NNLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYTN 202

Query: 242 QVLPVEKPLNALAFSKHSKNLIAAAGTDT------RVYLYDLRRLSEPLHTMA--GHQDA 293
            V  V+   + + +   +   IA A  +        ++++DLR    PL  ++  GH + 
Sbjct: 203 PVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSNG 262

Query: 294 VTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIND 353
           + S+++ S  + +L SSG D  + +W            + ++G  E +  +   R+    
Sbjct: 263 ILSLDWCSTDENLLLSSGRDNSVMLW------------NPENG--ESLTKYPSRRNWCFK 308

Query: 354 FSFNPQVPWLIASAEEDNVVQVWKISKKLVSNI 386
             F P  P + A+A  D  ++V  + + LV+N+
Sbjct: 309 TKFAPAFPDVFATASFDGKIEVQTL-QDLVNNL 340

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 121/270 (44%), Gaps = 40/270 (14%)

Query: 130 IATINGKGKIFIYDRSKSKSEGLC-KTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           +A+ +  G I ++D +      +C  TLS H  +   + +  Q    L + S D T+ +W
Sbjct: 250 LASASKDGTIKVWDTTGR----VCLYTLSGHTSSVSCVRWGGQ--NMLYTGSHDKTIRVW 303

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD------KRSLSNSAQ 242
           D+NS  R ++I+ +H   VN             ++S D  L++        K +++  A+
Sbjct: 304 DMNSNGRCINILKSHAHWVNHL-----------SLSTDYALRIGPFDHSGAKPAIAEEAR 352

Query: 243 VLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSH 302
              ++     +  + H++ L+  A  D  ++L++  + ++PL  M GHQ  V  + FS  
Sbjct: 353 DKALKNYEKIVKKNGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSPD 412

Query: 303 KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPW 362
              I+ S+  D  + +W            D  DG  + +    GH +++   +++     
Sbjct: 413 GRHIV-SASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR- 456

Query: 363 LIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
           L+ S  +D  ++VW +  K +S  +P + D
Sbjct: 457 LLVSCSKDTTLKVWDVRTKKLSVDLPGHQD 486

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 79/154 (51%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N   E  +++ASDD T+ LW+   + +P++ +  H  +VN   +     +I  + S D +
Sbjct: 366 NGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSPDGRHIV-SASFDNS 424

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR--RLSEPLHT 286
           +++ D R     +        +  +A+S   + L+ +   DT + ++D+R  +LS  L  
Sbjct: 425 IKLWDGRDGKFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTKKLSVDL-- 481

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GHQD V ++++S   DG  +CS G D+ + +W
Sbjct: 482 -PGHQDEVFTVDWSV--DGKRVCSGGKDKMVRLW 512

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 77/170 (45%), Gaps = 20/170 (11%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  LWD + T  P++ +  H++ V    W   D  +  T S D
Sbjct: 149 AFAPNSSSRMVTGAGDNTARLWDCD-TQTPMATLSGHSNWVLCVAWSP-DAEVIATGSMD 206

Query: 227 KTLQVHDK----------RSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD 276
            T+++ +           R  S     L  E PL+ +   +  K  +A+A  D  + ++D
Sbjct: 207 NTIRLWNGINGKPIGDSLRGHSKWITSLAWE-PLHLVKVGQ--KPRLASASKDGTIKVWD 263

Query: 277 LR-RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
              R+   L+T++GH  +V+ + +      +L +   D+ + +WD+   G
Sbjct: 264 TTGRVC--LYTLSGHTSSVSCVRWGGQN--MLYTGSHDKTIRVWDMNSNG 309

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 112/274 (40%), Gaps = 37/274 (13%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSY-HKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           G G++FI D +   +  + ++ S+  KD  + +A+N   E ++L+A  D ++ L+DI   
Sbjct: 36  GNGRLFIMDLTAQGT--MVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDITLQ 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLP-------- 245
             P+++   H   V    W+   ++ F + S D T++V       +   +LP        
Sbjct: 94  QYPIALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKVWTPARPQSMLTLLPAPANRSVM 153

Query: 246 VEKPLNALA---------------------FSKHSKNLIAAAGTDTRVYLYDLRR--LSE 282
           VE     L                      FS H  NL+ +   ++ V L+DLR+   S 
Sbjct: 154 VEPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASN 213

Query: 283 PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
               +A       S +F+ ++  ++ + G D+ + +WDL  +   +         P  + 
Sbjct: 214 QQRFIAHSGLEALSCDFNKYRPHVIATGGVDKMVKVWDLRMV---RQTLTTSRTAPVSIN 270

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
              GH  A+    ++P    ++ S   D   + W
Sbjct: 271 EMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAW 304

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 67/163 (41%), Gaps = 20/163 (12%)

Query: 91  LPDEDNSS---EPVKSMIKVTKKFEHEDE------VIRARYMPKNDKIIATINGKGKIFI 141
           LP   N S   EP    + ++ + +H+D       + +A++ P +  ++ + +G   + +
Sbjct: 144 LPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHDPNLVMSCSGNSYVSL 203

Query: 142 YDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDIN------STDR 195
           +D  +  +    + +++         FN      + +   D  V +WD+       +T R
Sbjct: 204 FDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVIATGGVDKMVKVWDLRMVRQTLTTSR 263

Query: 196 --PVSI--VMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV-HD 233
             PVSI  +  H+  V    W     NI  + S D T +  HD
Sbjct: 264 TAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAWHD 306

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 81/202 (40%), Gaps = 46/202 (22%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           I++T N K    I++ +KS S  +   L  H      + FNPQ    L + S DT V  W
Sbjct: 84  IVSTSNQKA--IIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAW 141

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  RP     +     +  KW+  D N+                             
Sbjct: 142 DMRSPHRPFYSTSSWRSAASQVKWNYKDPNV----------------------------- 172

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                        L ++ G D  V+++DLR+ S PL ++ GH  +V SI+F+  K   L 
Sbjct: 173 -------------LASSHGND--VFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTELM 217

Query: 309 SSGSDRRLFIWDLTQIGAEQAQ 330
           SS +D  +  WD ++   E  +
Sbjct: 218 SSSNDGTVKFWDYSKSTTESKR 239

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 62/134 (46%), Gaps = 16/134 (11%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           + +  + F+    +++A    DT V+ +D+R    P ++ +  + A + ++++     +L
Sbjct: 114 RAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVL 173

Query: 308 CSS-GSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIAS 366
            SS G+D  +F+WDL +            G   L  +  GH S++N   FN      + S
Sbjct: 174 ASSHGND--VFVWDLRK------------GSTPLCSL-KGHVSSVNSIDFNRFKSTELMS 218

Query: 367 AEEDNVVQVWKISK 380
           +  D  V+ W  SK
Sbjct: 219 SSNDGTVKFWDYSK 232

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 19/139 (13%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEP---LHTMAGHQDAVTSIEFS 300
           L V+   NA++ +   ++++ A+     +Y+ DL     P   LH +   Q  V  +++S
Sbjct: 20  LKVDGGFNAVSINPSGRDVVLASRQG--LYIIDLDDPFTPPRWLHHITPWQ--VADVQWS 75

Query: 301 SH-KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ 359
            H        S S+++  IW+L +  +   +           ++H GH  AI D +FNPQ
Sbjct: 76  PHPAKPYWIVSTSNQKAIIWNLAKSSSNAIE----------FVLH-GHSRAITDINFNPQ 124

Query: 360 VPWLIASAEEDNVVQVWKI 378
            P ++A+   D  V  W +
Sbjct: 125 HPDVLATCSVDTYVHAWDM 143

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 125 KNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184
           K+  ++A+ +G   +F++D  K  S  LC +L  H  +   + FN     EL+S+S+D T
Sbjct: 168 KDPNVLASSHG-NDVFVWDLRKG-STPLC-SLKGHVSSVNSIDFNRFKSTELMSSSNDGT 224

Query: 185 VALWD 189
           V  WD
Sbjct: 225 VKFWD 229

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 115/281 (40%), Gaps = 48/281 (17%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSY-HKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           G G++ I D + +    L +T S+  +D  + +A+N Q E +++ A  D ++ L+DI+  
Sbjct: 36  GNGRLSILDIAPNGQ--LIETKSFLTQDCLFDIAWNEQHEKQVVVAQGDGSLRLFDIDLA 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD---KRSL------------- 237
             P++I   H   V    W+  ++ +F + S D T+++     K SL             
Sbjct: 94  KYPIAIFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKESLLTLRPTPKWKKHL 153

Query: 238 ----------SNSAQVLPVEK-----------PLNALAFSKHSKNLIAAAGTDTRVYLYD 276
                      N+ Q+ P  K            +    FS H  NL+     D+   ++D
Sbjct: 154 DSMEPIIPKRRNNIQIQPSHKINMPNNNNNKDCIYQSQFSPHDPNLLICCSGDSYTTIFD 213

Query: 277 LRRLSEPLHTMAGHQDA-VTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADD 335
           LR           H    V S +F+ ++  +L ++G D  + IWD   + A     DA  
Sbjct: 214 LRDPYNTQRNFLSHAGMEVLSADFNKYRPNVLATAGVDNSIRIWDFRMLVA----RDAAI 269

Query: 336 GVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
            + E++     H  A+    ++P    ++ S   D   ++W
Sbjct: 270 CINEIV---NAHDLAVRKVVWSPHHSDILLSTSYDMSCKIW 307

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 75/188 (39%), Gaps = 18/188 (9%)

Query: 205 DIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALA--FSKHSKNL 262
           D +  S++   D N+    S D    + D R   N+ +       +  L+  F+K+  N+
Sbjct: 185 DCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNFLSHAGMEVLSADFNKYRPNV 244

Query: 263 IAAAGTDTRVYLYDLRRLSEPLHTMA------GHQDAVTSIEFSSHKDGILCSSGSDRRL 316
           +A AG D  + ++D R L      +        H  AV  + +S H   IL S+  D   
Sbjct: 245 LATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLSTSYDMSC 304

Query: 317 FIW-DLT-------QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAE 368
            IW DL+       + G   + +   +G   +M  H        D+S   Q P  +AS  
Sbjct: 305 KIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGA-DWSMWGQ-PGYVASTG 362

Query: 369 EDNVVQVW 376
            D  V +W
Sbjct: 363 WDGNVFIW 370

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 123/275 (44%), Gaps = 38/275 (13%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLCK-TLSYHKDNGYGLAFNPQIEGELLSASDD 182
           P +   +A+ +  G I I+D        +C+ T+S H ++   + +  Q  G L S S D
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSR----VCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHD 298

Query: 183 TTVALWDINSTDRPVSIVMNHTDIVND---SKWHEFDENIFGTVSEDKTL-QVHDKRSLS 238
            TV +WD+NS  R ++I+ +H   VN    S  +      F    +  T  +   K++L+
Sbjct: 299 RTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGQKPTSPEDAQKKALA 358

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
           N  ++            + +S+ ++  A  D  ++L++  + ++P+  M GHQ  V  + 
Sbjct: 359 NYEKI---------CKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVA 409

Query: 299 FSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFN 357
           FS   DG  + S+  D  + +W            D  DG  + +    GH +++   +++
Sbjct: 410 FS--PDGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWS 453

Query: 358 PQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
                L+ S  +D  ++VW +    +S  +P + D
Sbjct: 454 SDCR-LLVSCSKDTTLKVWDVRTGKLSVDLPGHQD 487

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/250 (21%), Positives = 109/250 (43%), Gaps = 22/250 (8%)

Query: 84  LPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD 143
           +PY          +S+PVK+ I +T        +I+  +    D+I      +    +  
Sbjct: 75  VPYTFSCTIQGKKASDPVKT-IDITDNLY--SSLIKPGHNSTEDQITLLYTPRAVFKVKP 131

Query: 144 RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNH 203
            ++S S      ++ H       AF P     +++ + D T  +WD + T  P+  +  H
Sbjct: 132 VTRSSS-----AIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMHTLKGH 185

Query: 204 TDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPV-EKPLNALAF------S 256
            + V    W   D  +  T S D T+++ D ++       L    K + +L++       
Sbjct: 186 FNWVLCVAWSP-DGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVK 244

Query: 257 KHSKNLIAAAGTDTRVYLYD-LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
             SK  +A++  D  + ++D + R+ +  +TM+GH ++V+ +++     G+L S   DR 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQ--YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRT 300

Query: 316 LFIWDLTQIG 325
           + +WD+   G
Sbjct: 301 VRVWDMNSQG 310

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 78/154 (50%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N   E  +++ASDD T+ LW+   + +P++ +  H  +VN   +   D     + S D +
Sbjct: 367 NGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNS 425

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR--RLSEPLHT 286
           +++ D R     +        +  +A+S   + L+ +   DT + ++D+R  +LS  L  
Sbjct: 426 IKLWDGRDGKFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTGKLSVDL-- 482

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GHQD V ++++S   DG  +CS G D+ + +W
Sbjct: 483 -PGHQDEVYTVDWSV--DGKRVCSGGRDKMVRLW 513

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 83/172 (48%), Gaps = 13/172 (7%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSI-VMNHTDIVNDSKWHEF 215
           ++H D    LA N      L S S D+TV LWD+NS     S+  ++H   V+ S+WH+ 
Sbjct: 290 THHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAARSLNQVHHGSRVSSSQWHQT 349

Query: 216 DENIFGTVSEDKTL-----QVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
           D +I  T   D  +     ++ D++++S    V+  E+   A   + ++      AGTD 
Sbjct: 350 DGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEEIETASFINDYT----VLAGTDN 405

Query: 271 -RVYLYDLRRL-SEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IW 319
             VY +D+R + S+PL T+  H   +  +    +  G+L +     ++  +W
Sbjct: 406 GNVYSFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 122/292 (41%), Gaps = 38/292 (13%)

Query: 126 NDKIIATI--NGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDT 183
           ++KIIA    NG  ++F Y+    KSE        HK       FN +    L +     
Sbjct: 73  DNKIIAGALDNGSVELFSYNADSLKSEA---KFQRHKTTAKVARFNAKQFNVLATGGTKG 129

Query: 184 TVALWDINS--------TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
            + +WD+N         T       M   + +    W++   ++F +        + D +
Sbjct: 130 EIFIWDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLK 189

Query: 236 S------LSNSAQVLPVEKPLNALAF-SKHSKNLIAAAGTDT--RVYLYDLRRLSEPLHT 286
           +      LS ++    ++ PL+ + +  K+S  +  A G+D    + ++DLR  + PL  
Sbjct: 190 AKKEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQV 249

Query: 287 MA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHA 345
           ++ GH   V S+++ +  + +L SSG D  + +W+      ++ QE         +    
Sbjct: 250 LSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWN-----PQEGQE---------LTQFP 295

Query: 346 GHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397
              + +    F  Q P + ASA  DN VQV  + + LV+ +  E T  K  E
Sbjct: 296 TRSNWVFKTKFASQAPDIFASASFDNKVQVQTL-QNLVNTLDQEQTASKQRE 346

>ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 371

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/278 (20%), Positives = 106/278 (38%), Gaps = 40/278 (14%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYH----KDNGYGLAFNPQIEGELLSASDDTTVALWDI 190
           G GK+FI D          + L ++    +D  + +A+N   E ++L A  D T+ L+D 
Sbjct: 36  GNGKLFILDIDPQG-----RILEFNSFLTQDCLFDVAWNEAHENQVLVAQGDGTLRLFDT 90

Query: 191 NSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPL 250
                P++I   H   V    W+   +  F + S D  +++   +   +   V+P    +
Sbjct: 91  KLKQYPIAIFNEHQKEVFSCNWNLVGKQNFVSSSWDGAVKIWSPQRKESLLTVVPRPMDV 150

Query: 251 NALA----------------------------FSKHSKNLIAAAGTDTRVYLYDLRRLSE 282
           + +A                            FS H  NL+     ++ V L+D R+   
Sbjct: 151 STMACAGPQVPMSNQKGHADIAKNKNCIYQALFSPHDPNLVMCCSGNSYVTLFDSRQPPT 210

Query: 283 PLHT---MAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPE 339
           P +    +A       + +F+ ++   L + G D  + IWDL  +G   A          
Sbjct: 211 PANQKSFLAHSGLEALTCDFNKYRPHSLVTGGVDNCIRIWDLRMVGPSAASRANASPAVC 270

Query: 340 LMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
              +  GH  A+   S++P    ++ S   D    +W+
Sbjct: 271 TNEIVGGHELAVRKVSWSPHHSNILLSTSYDMTCCIWQ 308

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 82/172 (47%), Gaps = 12/172 (6%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           ++H D    LA N Q    L S S D TV LWD+N+     S++  H++  V+ S+WH  
Sbjct: 285 THHTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTATAARSLINIHSNTNVSASQWHPS 344

Query: 216 DENIFGTVSEDKTLQVHDKR-----SLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
           + ++  T   D    + D R      +S    V   E+ +  + F+   +N+      + 
Sbjct: 345 NGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEE-IECVRFA--DENIFICGTDNG 401

Query: 271 RVYLYDLRRLSE--PLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
            VY +D+R  +E  P+ T+  H   V+S+E + H   +L +S   ++ + +W
Sbjct: 402 NVYSFDIRNGAESKPVWTLKAHDAGVSSVEINRHIPNMLLTSAMGEKPVKLW 453

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/333 (23%), Positives = 136/333 (40%), Gaps = 70/333 (21%)

Query: 25  SNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTSGDENNYLKIAAIDL 84
           SN  L ++ V+E  +T+P  +IQWLPSV                      N  K+A    
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPSVP---------------------NPRKLATSSE 228

Query: 85  PYEVVGLPDE--DNSSEPVKSMIKVTKKFEHEDEVIR------ARYMPKNDKIIATINGK 136
              +  L D   DNSS    ++   ++   ++  +         +Y  ++  I  + N  
Sbjct: 229 CLRIWSLDDNSMDNSSVFNNNISNNSRHNTYKKSLTEQVNLSLCKYNEQHQIINNSTNS- 287

Query: 137 GKIFIYDRSKSKSEG-LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR 195
               + ++S ++  G L    S+H        +N      L+S+S DTT  +WD+ S++ 
Sbjct: 288 ----VSNKSNARLLGQLPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDLQSSNY 335

Query: 196 PVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPL----- 250
             + ++ H   V D K+      +F +   D +++V D R+L +S  +      L     
Sbjct: 336 VKTQLIAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNNT 395

Query: 251 --------------NALAF-------SKHSKNLIAAAGTDTR-VYLYDLRRLSEPLHTMA 288
                         N+L+        S    NLIA  G D + + + D+R    P+  ++
Sbjct: 396 FNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLVLS 455

Query: 289 GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           GH  +V  I++   K  +L S G D ++  WDL
Sbjct: 456 GHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 108/249 (43%), Gaps = 33/249 (13%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H  IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D      D     + S DKTL++ D  +     + +  +  + ++A  + + ++I +  
Sbjct: 69  QDCS-LTADGAYALSASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAIDRKA-SMIISGS 126

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-----ILCSSGSDRRLFIWDLT 322
            D  V ++ +R   + L TM GH D V+ +  +  +D       + S+G D+ +  W++ 
Sbjct: 127 RDRTVKVWTIR--GQCLATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNVN 184

Query: 323 QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
           Q      Q +AD           GH + +N  + +P    L+ASA +D  + +W ++ K 
Sbjct: 185 QF-----QIEAD---------FIGHNNYVNTITASPDGS-LVASAGKDGEIMLWNLADK- 228

Query: 383 VSNIIPEYT 391
               +P YT
Sbjct: 229 ----VPMYT 233

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 118/269 (43%), Gaps = 33/269 (12%)

Query: 126 NDKIIATINGKGKIFIYDRSKSKSE-GLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184
           N+KIIA     G + +Y  +++ +        S H  +   + FN + +  L S  ++  
Sbjct: 73  NNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGE 132

Query: 185 VALWDIN-STDRPVSIV-------MNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS 236
           + +WD+N  T+ P +         M+  D V    W++   ++F +        + D ++
Sbjct: 133 IFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKA 192

Query: 237 ------LSNSAQVLPVEKPLNALAF-SKHSKNLIAAAGTDT--RVYLYDLRRLSEPLHTM 287
                 LS ++    +++ L+ + +  K+S  +  A G+D    + ++DLR  + PL T+
Sbjct: 193 KKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTL 252

Query: 288 -AGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAG 346
             GHQ  + S+++    + +L SSG D  + +W+      E A++         +     
Sbjct: 253 NQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN-----PESAEQ---------LSQFPA 298

Query: 347 HRSAINDFSFNPQVPWLIASAEEDNVVQV 375
             +      F P+ P L A A  DN ++V
Sbjct: 299 RGNWCFKTKFAPEAPDLFACASFDNKIEV 327

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 57/127 (44%), Gaps = 8/127 (6%)

Query: 258 HSKNLIAAAGTDTRVYLYDLRRLSEPLHTMA---GHQDAVTSIEFSSHKDGILCSSGSDR 314
           H+  +IA A  +  + LY     +  +++MA    H  +V +++F++ +D +L S G++ 
Sbjct: 72  HNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 315 RLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQ 374
            +FIWD+      +  E   +  P            +   ++N  +  + ASA   N   
Sbjct: 132 EIFIWDM-----NKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFAS 186

Query: 375 VWKISKK 381
           +W +  K
Sbjct: 187 IWDLKAK 193

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 107/288 (37%), Gaps = 73/288 (25%)

Query: 101 VKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCK----TL 156
           +KS+ K++K   H   V   ++  K D ++ + + +G+IFI+D +K  S G         
Sbjct: 94  LKSVAKISK---HTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVA 150

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDIN--------STDRPVSIVMNHTDIVN 208
               D  Y LA+N  +     SA      ++WD+         S   P +   NH  +V 
Sbjct: 151 MTPIDEVYSLAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVV- 209

Query: 209 DSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGT 268
             +WH                                   P N+   +  + N       
Sbjct: 210 --EWH-----------------------------------PSNSTKIATATGN-----DN 227

Query: 269 DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAE 327
           D  + ++DLR    PL  M+ GH   + S+++    + +L SSG D    +W+      +
Sbjct: 228 DPVILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWN-----PQ 282

Query: 328 QAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
            AQ+         +       +      F P+ P L ASA  DN +QV
Sbjct: 283 TAQK---------LSQFPTRGNWCFKTKFAPEAPDLFASASLDNKIQV 321

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 7/86 (8%)

Query: 246 VEKPLNALAFSKHSKNL-------IAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
           VEKP  ++  S    +L       I A   D  +  +   +  + +  ++ H   V +++
Sbjct: 52  VEKPQGSITASAKFNDLDWSPDNSILAGALDNGIVEFFSPKELKSVAKISKHTTPVNTLK 111

Query: 299 FSSHKDGILCSSGSDRRLFIWDLTQI 324
           F++ +D +LCS  S   +FIWD+ +I
Sbjct: 112 FNAKQDNVLCSGDSRGEIFIWDINKI 137

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 85/196 (43%), Gaps = 29/196 (14%)

Query: 197 VSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQV--------LPVEK 248
           V+ +  HT  VN  K++   +N+  +      + + D   +++S  V         P+++
Sbjct: 97  VAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVAMTPIDE 156

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLH-----TMAGHQDAVTSIEF-SSH 302
            + +LA+++   ++ A+AG+     ++DL+   E LH        G ++ ++ +E+  S+
Sbjct: 157 -VYSLAWNQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVVEWHPSN 215

Query: 303 KDGILCSSGSDRR--LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQV 360
              I  ++G+D    + +WDL    A             L  M  GH   I    +  Q 
Sbjct: 216 STKIATATGNDNDPVILVWDLRNAKAP------------LQAMSQGHSKGILSLDWCKQD 263

Query: 361 PWLIASAEEDNVVQVW 376
             L+ S+  DN   +W
Sbjct: 264 ENLLLSSGRDNTCALW 279

>Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON}
           YDR142C (REAL)
          Length = 376

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 126/280 (45%), Gaps = 40/280 (14%)

Query: 135 GKGKIFIYDRSKS-KSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           G GK++I + S+S + E     L+  +D  + +A+N   E ++L A  D T+ L+D +  
Sbjct: 36  GNGKLYILEISRSGRIEEKNSFLT--QDCLFDVAWNESHENQVLVAQGDGTLRLFDTSLK 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD---KRSL-SNSAQVLPVEK- 248
           + P++I   H   V    W+  +   F + S D ++++     K+SL S + + L + K 
Sbjct: 94  EYPIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMSLTPRPLEITKM 153

Query: 249 --PLNAL--------------------AFSKHSKNLIAAAGTDTRVYLYDLR---RLSEP 283
             PLNA+                     FS H +NLI +   ++   L+D+R     S+ 
Sbjct: 154 VDPLNAILLNKKKFAGISKNRNCVYQAQFSPHDQNLIISCSGNSYASLFDIRLPPSKSQS 213

Query: 284 LHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGA------EQAQEDADDGV 337
              +    +A+T  +F+ ++  ++ + G D  + IWD+  + A      ++   +     
Sbjct: 214 NFLVHSGLEALT-CDFNKYRPYVVATGGVDNAIRIWDIRMLNAIGSTAIDRTTHNKSHNS 272

Query: 338 PELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
             +  +   H  A+   +++P    ++ SA  D   ++WK
Sbjct: 273 ACINEIPNAHELAVRKVAWSPHHSNILMSASYDMTCRIWK 312

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 77/162 (47%), Gaps = 18/162 (11%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           L+S+S DTT  +WD+ S +   + ++ H   V D ++     ++F +   D +++V D R
Sbjct: 262 LVSSSIDTTCIVWDLQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVRVFDLR 321

Query: 236 SLSNSAQVLPVEKPL------------NALAFSKHS---KNLIAAAGTDTR-VYLYDLRR 279
           SL++S  V   E P             NAL   + S    N+IA    D++ + + D+R 
Sbjct: 322 SLAHSTIVY--EPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILDMRN 379

Query: 280 LSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
              P  T+ GH   V  I++   K  +L S   D ++  WDL
Sbjct: 380 PESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 25/137 (18%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKSEGLCKTLSYHKDNGYGL 166
           T+   H+ EV   R++ ++  + A+  G G + ++D RS + S     T+ Y    G G 
Sbjct: 284 TQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVRVFDLRSLAHS-----TIVYEPPAGEGT 338

Query: 167 A-----------------FNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVND 209
                              +P I   L++ S D  + + D+ + + P   +  H+ +VN 
Sbjct: 339 VNDVTAQNNALLRLEPSLMDPNIIATLVADSKD--ILILDMRNPESPALTLKGHSSLVNQ 396

Query: 210 SKWHEFDENIFGTVSED 226
            KWH    N+  + S+D
Sbjct: 397 IKWHPTKRNVLLSCSDD 413

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 79/185 (42%), Gaps = 27/185 (14%)

Query: 212 WHEFDENIFGTVSEDKTLQVHDKRSLSN-SAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
           W+  D N+  + S D T  V D +S +    Q++  +  +  + F   S +L A+ G D 
Sbjct: 254 WNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDG 313

Query: 271 RVYLYDLRRLS------EP------LHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR-LF 317
            V ++DLR L+      EP      ++ +    +A+  +E S     I+ +  +D + + 
Sbjct: 314 SVRVFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDIL 373

Query: 318 IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           I D+    +           P L +   GH S +N   ++P    ++ S  +D  V  W 
Sbjct: 374 ILDMRNPES-----------PALTL--KGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWD 420

Query: 378 ISKKL 382
           ++  L
Sbjct: 421 LNTAL 425

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 39/95 (41%), Gaps = 3/95 (3%)

Query: 99  EPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGK-IFIYDRSKSKSEGLCKTLS 157
           EP      V       + ++R      +  IIAT+    K I I D    +S  L  TL 
Sbjct: 331 EPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILDMRNPESPAL--TLK 388

Query: 158 YHKDNGYGLAFNPQIEGELLSASDDTTVALWDINS 192
            H      + ++P     LLS SDD  V  WD+N+
Sbjct: 389 GHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDLNT 423

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 34/77 (44%)

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
           P+ +  ++    NL+ ++  DT   ++DL+  +     +  H   V  + F S    +  
Sbjct: 248 PVTSFDWNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFA 307

Query: 309 SSGSDRRLFIWDLTQIG 325
           S G D  + ++DL  + 
Sbjct: 308 SCGGDGSVRVFDLRSLA 324

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 119/298 (39%), Gaps = 48/298 (16%)

Query: 120 ARYMPKNDKIIATING-------KGKIFIYD-RSKSKSEGLCKTLSYHKDNGYGLAFNPQ 171
            +Y P  D  +A ++G        GK+FI D   + K       L+  +D  + +A+N  
Sbjct: 14  VQYSPFFDNRLAVVSGSNFGLVGNGKLFILDIDPQGKIHESNSFLT--QDCLFDVAWNEL 71

Query: 172 IEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV 231
            E ++L A  D ++ L+D      P++I   H   V    W+  ++N F + S D T+++
Sbjct: 72  HENQVLVAQGDGSLRLFDTKLAQYPIAIFKEHQKEVFSCNWNLLNKNTFVSSSWDGTVKI 131

Query: 232 HD---KRSL-------------------------SNSAQVLPVEKPLNALAFSKHSKNLI 263
                K SL                          N A +   +  +    FS H  NL+
Sbjct: 132 WSPTRKDSLLTLTPQPLKTVNRVDHSMNIPMSNQRNHADITRNKNCIYQAQFSPHDPNLV 191

Query: 264 AAAGTDTRVYLYDLRRLSEPLH--TMAGHQ--DAVTSIEFSSHKDGILCSSGSDRRLFIW 319
                ++ + ++DLR+   P +     GH   +A+T  +F+ ++   + + G D  + IW
Sbjct: 192 MCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALT-CDFNKYRPHTIATGGVDNVIRIW 250

Query: 320 DLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           DL       +       V E++    GH  A+    ++P    +  S   D    VW+
Sbjct: 251 DLRMTSKNNSSPSI--CVNEVV---GGHELAVRKVCWSPHHSNIFLSTSYDMTCCVWQ 303

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 101/266 (37%), Gaps = 56/266 (21%)

Query: 94  EDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLC 153
           E NS      +  V     HE++V+ A+             G G + ++D   ++     
Sbjct: 53  ESNSFLTQDCLFDVAWNELHENQVLVAQ-------------GDGSLRLFDTKLAQYP--I 97

Query: 154 KTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD-----------------INSTDRP 196
                H+   +   +N   +   +S+S D TV +W                  +N  D  
Sbjct: 98  AIFKEHQKEVFSCNWNLLNKNTFVSSSWDGTVKIWSPTRKDSLLTLTPQPLKTVNRVDHS 157

Query: 197 VSIVM----NHTDIVND------SKWHEFDENIFGTVSEDKTLQVHDKR---SLSNSAQV 243
           ++I M    NH DI  +      +++   D N+    S +  + + D R   S +N    
Sbjct: 158 MNIPMSNQRNHADITRNKNCIYQAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRNF 217

Query: 244 LPVEKPLNALA--FSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHT--------MAGHQDA 293
           L     L AL   F+K+  + IA  G D  + ++DLR  S+   +        + GH+ A
Sbjct: 218 LG-HSGLEALTCDFNKYRPHTIATGGVDNVIRIWDLRMTSKNNSSPSICVNEVVGGHELA 276

Query: 294 VTSIEFSSHKDGILCSSGSDRRLFIW 319
           V  + +S H   I  S+  D    +W
Sbjct: 277 VRKVCWSPHHSNIFLSTSYDMTCCVW 302

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 121/284 (42%), Gaps = 65/284 (22%)

Query: 166 LAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVMNH-TDIVNDSKWHEFDENIFGTV 223
           + F+P  +G+ L + ++D  + +WD+ +T R V  +  H  DI +   +   D+ + G  
Sbjct: 476 VCFSP--DGKFLATGAEDKLIRIWDL-ATRRIVMTLQGHEQDIYSLDYFPSGDKLVSG-- 530

Query: 224 SEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD------L 277
           S D+T+++ D R+    +  L +E  +  +A S     LIAA   D  V ++D      +
Sbjct: 531 SGDRTVRIWDLRT-GQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLV 589

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDLTQIGAEQAQEDADDG 336
            RL        GH+D+V S+ F+    G++  SGS DR + +W+L       A+  A+  
Sbjct: 590 ERLDSENELGTGHKDSVYSVVFTRDGHGVV--SGSLDRSVKLWNLRSANGGTAEGKANTA 647

Query: 337 VPEL----------------------------------------MMMHAGHRSAI----- 351
             E+                                        ++M  GHR+++     
Sbjct: 648 ASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAV 707

Query: 352 -NDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLK 394
            ND    P+   + A+   D   ++WK SK+  SN  P+  ++K
Sbjct: 708 ANDHPLGPEY-GVFATGSGDCKARIWKYSKQ-TSNAEPKLREVK 749

>Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON}
           YDR142C (REAL)
          Length = 377

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 121/284 (42%), Gaps = 47/284 (16%)

Query: 135 GKGKIFIYDRSK-SKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           G GK++I + ++  K E     L+  +D  + +A+N   E ++L A  D T+ L+D    
Sbjct: 36  GNGKLYILEINRDGKIEERNSFLT--QDCLFDVAWNESHENQVLVAQGDGTLRLFDTTLK 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV----HDKRSLSNSAQVLPVEK- 248
           + P++I   H   V    W+  +   F + S D ++++      +  +S + + L + K 
Sbjct: 94  EYPIAIFKEHEREVFSCNWNLVNRQTFLSSSWDGSIKIWSPLRSQSLMSLTPRPLEITKM 153

Query: 249 --PLNAL---------------------AFSKHSKNLIAAAGTDTRVYLYDLR---RLSE 282
             PLNA+                      FS H +NL+ +   ++   L+D+R     S+
Sbjct: 154 VDPLNAILSNKKKNFTGISQNKNCVYQAQFSPHDQNLVISCSGNSYASLFDIRLPPSRSQ 213

Query: 283 PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
               +    +A+T  +F+ ++  ++ + G D  + IWD+  +   +    A  G P    
Sbjct: 214 TNFLVHSGLEALT-CDFNKYRPYVIATGGVDNAIRIWDIRML---KTSGSATTGRPTHTS 269

Query: 343 MH---------AGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
            H           H  AI   +++P    ++ SA  D   +VWK
Sbjct: 270 SHNSACINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRVWK 313

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 108/260 (41%), Gaps = 40/260 (15%)

Query: 125 KNDKIIATINGKGKIFIYD---RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASD 181
           K + + AT++  G+++I+D   +SK+ S    K     K   + +  +  +EG  L  S 
Sbjct: 224 KEEVLAATMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSP 283

Query: 182 DTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSA 241
            T             +     HT     SKW          +++ +   V + +S+ +  
Sbjct: 284 LTKTGALLTGDCSGQIYFTQRHT-----SKW----------ITDKQPFTVANNQSIED-- 326

Query: 242 QVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIEFS 300
                      + +S+    + A+AG D  + ++D R +  +P  ++      V  I +S
Sbjct: 327 -----------IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWS 375

Query: 301 SHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ 359
             K G L +SG D   + +WDL Q   E A      G  + +  +  H+ AI   SFNP 
Sbjct: 376 -EKLGYLLASGDDNGTWGVWDLRQFSPENA------GSVQPVAQYDFHKGAITSISFNPL 428

Query: 360 VPWLIASAEEDNVVQVWKIS 379
              +IA   EDN V +W +S
Sbjct: 429 DESIIAVGSEDNTVTLWDLS 448

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 106/282 (37%), Gaps = 70/282 (24%)

Query: 107 VTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCK----TLSYHKDN 162
           + K  +H   V   R+  K   ++ +   KG+I+I+D +K ++ G       T     D 
Sbjct: 97  IAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDE 156

Query: 163 GYGLAFNPQIEGELLSASDDTTVA-LWDINSTDRPVSIVMNHTDIVNDSK-------WHE 214
            Y LA+N Q +G + +++  +  A +WD+ +      I ++HT  +   K       WH 
Sbjct: 157 IYSLAWN-QNQGHVFASAGSSGFASIWDLKAKKE--VIHLSHTSSITGQKNQLSIVEWHP 213

Query: 215 FDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYL 274
            +     T S                                         + +D  + +
Sbjct: 214 NNSTRIATAS----------------------------------------GSDSDPSILV 233

Query: 275 YDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDA 333
           +DLR  + PL T++ GH   V S+++    + +L SSG D    +W+      E  Q   
Sbjct: 234 WDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSCVLWN-----PESGQN-- 286

Query: 334 DDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
                  +       +      F PQ P L ASA  DN ++V
Sbjct: 287 -------LTQFPTRGNWCFKTKFAPQAPDLFASASFDNKIEV 321

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 107/260 (41%), Gaps = 54/260 (20%)

Query: 117 VIRARYMPK--NDKIIATINGKGKIFIYDRSKSKSE-----GLCKTLSYHKDNG--YGLA 167
           V   ++MP     + IAT +   +I+  +  ++K E      LCK    H +N    GL+
Sbjct: 159 VSNIQWMPSAFRSRKIATASDSLRIWSLNTEENKLEEQLNLSLCKFHKQHPNNKAFVGLS 218

Query: 168 --------FNPQIEGE----------------LLSASDDTTVALWDINSTDRPVSIVMNH 203
                    NP + GE                L+S+S DTT  +WD+ S++   + ++ H
Sbjct: 219 QIPTKTSDVNPSVLGEFPPITSFHWNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLIAH 278

Query: 204 TDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL--PVEKP------------ 249
              V D ++      +F +   D +++V D R L++S  +   P  +P            
Sbjct: 279 DSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDST 338

Query: 250 ------LNALAFSKHSKNLIAA-AGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSH 302
                 L  L  S H  N++A  A     + + D+R    PL  + GH  ++  I++   
Sbjct: 339 DENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPT 398

Query: 303 KDGILCSSGSDRRLFIWDLT 322
           K   L S   D ++  WD++
Sbjct: 399 KKNTLISCSDDCQVLFWDIS 418

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 112 EHEDEVIRARYMPKNDKIIATIN-GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNP 170
           E+   ++R    P +  ++AT      +I I D     S  +   L+ H  +   + ++P
Sbjct: 340 ENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLV--VLNGHSASINQIKWHP 397

Query: 171 QIEGELLSASDDTTVALWDINS 192
             +  L+S SDD  V  WDI+S
Sbjct: 398 TKKNTLISCSDDCQVLFWDISS 419

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 113/267 (42%), Gaps = 61/267 (22%)

Query: 166 LAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVS 224
           + F+P  +G+ L + ++D  + +WD+ +    +++  +  DI +   +   D+ + G  S
Sbjct: 358 VCFSP--DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSG--S 413

Query: 225 EDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD------LR 278
            D+T+++ D R+    +  L +E  +  +A S      IAA   D  V ++D      + 
Sbjct: 414 GDRTVRIWDLRT-GQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVE 472

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDLTQIGAEQAQE------ 331
           RL        GH+D+V S+ F+    G++  SGS DR + +WDL  +  +++        
Sbjct: 473 RLDSENELSTGHKDSVYSVVFTRDGQGVI--SGSLDRSVKLWDLRGLNGQKSHATCEVTY 530

Query: 332 -------------------------------DADDGVPELMMMHAGHRSA------INDF 354
                                          D   G P LM+   GHR++      +N F
Sbjct: 531 TGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ--GHRNSVISVAVVNGF 588

Query: 355 SFNPQVPWLIASAEEDNVVQVWKISKK 381
              P V  + A+   D   ++WK +KK
Sbjct: 589 PLGPDV-GVFATGSGDCKARIWKYTKK 614

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 79/168 (47%), Gaps = 6/168 (3%)

Query: 143 DRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMN 202
           D  +S ++GL KT  +H D  +    + + +   ++A  +  + LWD +S  RP + +  
Sbjct: 157 DEEQSSTDGLIKT--FHGDYAFLGIDHHRSKPYFVTAGAE--INLWD-SSRSRPTANLSW 211

Query: 203 HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNL 262
             D V+  K+++ + +IF +   D ++ ++D R+ S   Q        NAL ++      
Sbjct: 212 GADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNS-PTQKFTQRMRTNALCWNPMEAYN 270

Query: 263 IAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSS 310
              A  D   Y YD+R LS  LH    H  AV  ++FS   D I+  S
Sbjct: 271 FVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 318

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 79/182 (43%), Gaps = 23/182 (12%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVND---SKWH-- 213
           H+D  Y +A N     +L SAS D  V  W++ ST   +     H  +V+    +  H  
Sbjct: 66  HRDGVYTIAKNYHALNKLASASADGVVKYWNM-STREEICSFKAHYGLVHGLCVTPQHLS 124

Query: 214 -EFDENIFGTVSEDKTLQV------------HDKRSLSNSAQVLPVEKPLNALAFSKH-S 259
              +EN   +  +DKT+++            +D+   S    +         L    H S
Sbjct: 125 ANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAFLGIDHHRS 184

Query: 260 KNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIW 319
           K     AG +  + L+D  R S P   ++   D V++++F+ ++  I  S+GSD  + ++
Sbjct: 185 KPYFVTAGAE--INLWDSSR-SRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLY 241

Query: 320 DL 321
           DL
Sbjct: 242 DL 243

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 81/202 (40%), Gaps = 46/202 (22%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           I++T N K    I++ +KS S  +   L  H      + FNPQ    L + S DT V  W
Sbjct: 85  IVSTSNQKA--IIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAW 142

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  RP     +     +  KW+  D N+                             
Sbjct: 143 DMRSPHRPFYSTSSWRSAASQVKWNYKDPNV----------------------------- 173

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                        L ++ G D  ++++DLR+ S PL ++ GH  +V SI+F+  K   + 
Sbjct: 174 -------------LASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIM 218

Query: 309 SSGSDRRLFIWDLTQIGAEQAQ 330
           SS +D  +  WD ++   E  +
Sbjct: 219 SSSNDGTVKFWDYSKSTTESKR 240

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 19/139 (13%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEP---LHTMAGHQDAVTSIEFS 300
           L V+   NA++ +   ++++ A+     +Y+ DL     P   LH +   Q  V  +++S
Sbjct: 21  LKVDGGFNAVSINPSGRDIVLASRQG--LYIIDLDDPFTPPRWLHHITPWQ--VADVQWS 76

Query: 301 SH-KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ 359
            H        S S+++  IW+L +  +   +           ++H GH  AI D +FNPQ
Sbjct: 77  PHPAKPYWIVSTSNQKAIIWNLAKSSSNAIE----------FVLH-GHSRAITDINFNPQ 125

Query: 360 VPWLIASAEEDNVVQVWKI 378
            P ++A+   D  V  W +
Sbjct: 126 HPDVLATCSVDTYVHAWDM 144

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 125 KNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184
           K+  ++A+ +G   IF++D  K  S  LC +L  H  +   + FN     E++S+S+D T
Sbjct: 169 KDPNVLASSHG-NDIFVWDLRKG-STPLC-SLKGHVSSVNSIDFNRFKYSEIMSSSNDGT 225

Query: 185 VALWD 189
           V  WD
Sbjct: 226 VKFWD 230

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 82/182 (45%), Gaps = 9/182 (4%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHT-DIVNDSKWHEF 215
           ++H D    LA N      L S S D TV LWD+N      S+   H+   V+ S+WH  
Sbjct: 268 THHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSATAVSSSQWHPS 327

Query: 216 DENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNA--LAFSKHSKNLIAAAGTDT-RV 272
           D +I  T   D  + + D R ++N A +    K +    +  +      +  AGTD+  V
Sbjct: 328 DGSILLTAGYDSRVALSDVR-IANDAGMSKYWKVMKGEEIESATFVSETVFLAGTDSGNV 386

Query: 273 YLYDLRRL--SEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQA 329
           Y +DLR    S PL T+  H   ++S+  S     +L +S    ++  +W     GA  A
Sbjct: 387 YSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGA-SA 445

Query: 330 QE 331
           QE
Sbjct: 446 QE 447

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 285 HTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           H    H DAV S+  + H   +L S+ +D  + +WDL
Sbjct: 265 HVATHHTDAVLSLAHNRHFRAVLASTSADHTVKLWDL 301

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 89/176 (50%), Gaps = 16/176 (9%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDIN--STDRPVSIVMNHTDIVNDSKWHE 214
           ++H D    L+ N Q    L S S D T+ LWD+N  +  R ++ + N T  V+ S+WH 
Sbjct: 307 THHTDAVLSLSHNKQYRVVLASTSADQTIKLWDLNQGTAVRSIASIHNGT-TVSSSQWHP 365

Query: 215 FDENIFGTVSEDKTLQVHDKRSLSNSAQV-----LPVEKPLNALAFSKHSKNLIAAAGTD 269
            D +I  T + D  + + D R +SN +++     +   + +  ++F   ++ L   AGTD
Sbjct: 366 SDGSIILTGAYDSRVALSDVR-ISNDSEMSKYWSVMTGEEVECVSFVNDNEFL---AGTD 421

Query: 270 T-RVYLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF-IWDL 321
           +  +Y +DLR    S PL T+  H   ++S+  +S    ++ SS    ++  +W +
Sbjct: 422 SGNIYSFDLRNGEKSSPLWTLKAHDSGISSMNVNSFIPNMMVSSAMGEKVIKLWKI 477

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 83/173 (47%), Gaps = 14/173 (8%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           ++H D    LA N      L S S D TV LWD+N+     S+   H+   V+ S+WH+ 
Sbjct: 285 THHTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAARSLASIHSGKNVSSSEWHKT 344

Query: 216 DENIFGTVSEDKTLQVHDKR-----SLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
           + ++  T   D  + + D R      LS    VLP E+    +  S  +   I  +GTD+
Sbjct: 345 NGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEE----VESSTFADENIILSGTDS 400

Query: 271 -RVYLYDLRR--LSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
             VY +D+R    S+P+ T+  H   ++ +  + +  G++ +S   D+ + +W
Sbjct: 401 GNVYAFDIRNNSGSKPVWTLNAHDAGISCLCANDYIPGMMTTSAMGDKTVKLW 453

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 23/45 (51%)

Query: 285 HTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA 329
           H    H DA+ S+  + H   +L S+ +D  + +WDL    A ++
Sbjct: 282 HITTHHTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAARS 326

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 94/241 (39%), Gaps = 66/241 (27%)

Query: 147 SKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI 206
           S+   + KTL  H D  Y + F+P     LLS S D T  LW   STD    +V      
Sbjct: 747 SQINSIFKTLVGHSDAVYSVNFSP-CNRFLLSGSGDKTARLW---STDTYKGLV------ 796

Query: 207 VNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAA 266
               K HE                                 KP+  + FS    NL A A
Sbjct: 797 --SYKGHE---------------------------------KPIWDVNFSPTGNNLFATA 821

Query: 267 GTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIWDLTQIG 325
            +D    ++   R+  P+  +AGH   V  + F  H +G    +G SD+   +WDL+   
Sbjct: 822 SSDNTARVWSCDRVY-PVRILAGHLSDVDCVSF--HPNGQYVFTGSSDKTSRMWDLS--- 875

Query: 326 AEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKI--SKKLV 383
                  + D V     +  GH SA+   + +P   WL ++A ED  + VW I   KKL 
Sbjct: 876 -------SGDSV----RLFIGHSSAVTATAVSPDGRWL-STANEDGTITVWDIGSGKKLK 923

Query: 384 S 384
           S
Sbjct: 924 S 924

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 119/258 (46%), Gaps = 22/258 (8%)

Query: 70  SGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKI 129
           +G +++Y+KI ++    E   + + + +   + S+ K      H D V    + P N  +
Sbjct: 722 TGFQDSYIKIWSL----EGTSINENEQNYSQINSIFKTL--VGHSDAVYSVNFSPCNRFL 775

Query: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189
           ++   G G       S    +GL  +   H+   + + F+P       +AS D T  +W 
Sbjct: 776 LS---GSGDKTARLWSTDTYKGLV-SYKGHEKPIWDVNFSPTGNNLFATASSDNTARVW- 830

Query: 190 INSTDR--PVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE 247
             S DR  PV I+  H   V+   +H   + +F T S DKT ++ D  S  +    +   
Sbjct: 831 --SCDRVYPVRILAGHLSDVDCVSFHPNGQYVF-TGSSDKTSRMWDLSSGDSVRLFIGHS 887

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGH-QDAVTSIEFSSHKDG- 305
             + A A S   +  ++ A  D  + ++D+    + L +M GH ++++ S+ +  +K G 
Sbjct: 888 SAVTATAVSPDGR-WLSTANEDGTITVWDIGS-GKKLKSMRGHGKNSIYSLSY--NKTGN 943

Query: 306 ILCSSGSDRRLFIWDLTQ 323
           IL SSG+D  + +WD+ +
Sbjct: 944 ILVSSGADNSVRVWDIKK 961

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 64/148 (43%), Gaps = 30/148 (20%)

Query: 246 VEKPLNALAFSKHSKNLIAAAG-TDTRVYLYDLR------------RLSEPLHTMAGHQD 292
            EK +++L FS  S   +AA G  D+ + ++ L             +++    T+ GH D
Sbjct: 704 TEKNMSSLDFS--SDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSD 761

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN 352
           AV S+ FS     +L  SG D+   +W            D   G    ++ + GH   I 
Sbjct: 762 AVYSVNFSPCNRFLLSGSG-DKTARLWST----------DTYKG----LVSYKGHEKPIW 806

Query: 353 DFSFNPQVPWLIASAEEDNVVQVWKISK 380
           D +F+P    L A+A  DN  +VW   +
Sbjct: 807 DVNFSPTGNNLFATASSDNTARVWSCDR 834

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 115/282 (40%), Gaps = 63/282 (22%)

Query: 105 IKVTKKFE-HEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNG 163
           I  T KF  H   V   ++  K D ++A+    G+IFI+D +K      C          
Sbjct: 98  IVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNK------CTESPS----- 146

Query: 164 YGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTV 223
              ++ P   G+ +S+ D+                        VN   W++   ++F + 
Sbjct: 147 ---SYTPLTPGQSMSSVDE------------------------VNSLAWNQSLAHVFASA 179

Query: 224 SEDKTLQVHDKRS------LSNSAQVLPVEKPLNALAF-SKHSKNLIAAAGTDT--RVYL 274
                  + D ++      LS ++    +++ L+ + +  K+S  +  A G+D    + +
Sbjct: 180 GSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILV 239

Query: 275 YDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDA 333
           +DLR  + PL T++ GHQ  + S+++    + +L SSG D  + +W+      E A+E  
Sbjct: 240 WDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN-----PESAEE-- 292

Query: 334 DDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
                  +       +      F P+ P L A A  DN ++V
Sbjct: 293 -------LSQFPSRGNWCFKTKFAPEAPDLFACASFDNRIEV 327

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 62/141 (43%), Gaps = 9/141 (6%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMA---GHQDAVTSIEFS 300
           L V+   N L +S H+   IA A  +  + LY +    + + + A    H  +V +++F+
Sbjct: 59  LQVDSKFNDLDWS-HNNKTIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFN 117

Query: 301 SHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQV 360
           S +D +L S G++  +FIWD+      +  E      P            +N  ++N  +
Sbjct: 118 SKQDNVLASGGNNGEIFIWDM-----NKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSL 172

Query: 361 PWLIASAEEDNVVQVWKISKK 381
             + ASA   N   +W +  K
Sbjct: 173 AHVFASAGSSNFASIWDLKAK 193

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 94/228 (41%), Gaps = 36/228 (15%)

Query: 169 NPQIEGELLSASDDTTVALWDI-NSTDRPVSIVM--NHTDIVNDSKWHEFDENIFGTVSE 225
           N  I G L    D+ T+ L+ I ++ D  VS     NH+  V   K++   +N+  +   
Sbjct: 74  NKTIAGAL----DNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGN 129

Query: 226 DKTLQVHDKRSLSNS---------AQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD 276
           +  + + D    + S          Q +     +N+LA+++   ++ A+AG+     ++D
Sbjct: 130 NGEIFIWDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWD 189

Query: 277 LRRLSEPLH-----TMAGHQDAVTSIEF---SSHKDGILCSSGSDRRLFIWDLTQIGAEQ 328
           L+   E +H       +G +  ++ +E+   +S +      S +D  + +WDL       
Sbjct: 190 LKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTP- 248

Query: 329 AQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
                      L  +  GH+  I    +  Q   L+ S+  DN V +W
Sbjct: 249 -----------LQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLW 285

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 122/297 (41%), Gaps = 43/297 (14%)

Query: 120 ARYMPKNDKIIAT-------INGKGKIFIY--DRSKSKSEGLCKTLSYHKDNGYGLAFNP 170
            +Y P  D I+A        + G GK+FI   D +    E   K     KD  +  A+N 
Sbjct: 14  VQYSPYYDNILAVNTGSNFGLVGNGKLFILEIDNNGVVKE---KNSFLTKDCLFDSAWNE 70

Query: 171 QIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQ 230
               +++ A  D ++ L+D      P+++   H+  V    W+   ++ F + S D  ++
Sbjct: 71  LKPNQVVVAQGDGSLRLFDTTLQKFPIAMFHEHSKEVYSCNWNLVSKSNFVSSSWDGQVK 130

Query: 231 V---HDKRSL-SNSAQVLPVEKPLNAL------------------------AFSKHSKNL 262
           +   + K SL + S   + V + L+ L                         FS H  NL
Sbjct: 131 IWSPNRKASLITFSPHPIDVSRALDNLPEVSQRDKLSPNQVAQNRNCIYQATFSPHDDNL 190

Query: 263 IAAAGTDTRVYLYDLRR--LSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWD 320
           I     ++ V L+DLR+   +   + +A       S +F+ ++  I+ +SG D  + IWD
Sbjct: 191 ILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKYRPNIIATSGVDNSIGIWD 250

Query: 321 LTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           +  +     Q+    G     +++A H  A+    ++P    ++ S   D   ++WK
Sbjct: 251 IRMLPNSSNQQGFQTGTLVNEIVNA-HDLAVKKVCWSPHHSDILLSTSYDMSCKIWK 306

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 34/194 (17%), Positives = 78/194 (40%), Gaps = 29/194 (14%)

Query: 112 EHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQ 171
           ++ + + +A + P +D +I    G   + ++D  ++        +++         FN  
Sbjct: 173 QNRNCIYQATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKY 232

Query: 172 IEGELLSASDDTTVALWDI----NSTDRP-------VSIVMNHTDI-VNDSKWHEFDENI 219
               + ++  D ++ +WDI    NS+++        V+ ++N  D+ V    W     +I
Sbjct: 233 RPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDI 292

Query: 220 FGTVSEDKTLQVHDKRSLSNSAQVLPVEKPL--NALA--FSKHSK-------------NL 262
             + S D + ++    S+ N+         L  N L   F  H++               
Sbjct: 293 LLSTSYDMSCKIWKDVSVQNNVPTGKTNGSLLSNGLLSNFKHHTEFVFGADWSLWGIPGY 352

Query: 263 IAAAGTDTRVYLYD 276
           +A AG D+ V++++
Sbjct: 353 VATAGWDSNVFIWN 366

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 103/216 (47%), Gaps = 21/216 (9%)

Query: 126 NDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYG---LAFNPQIEGELLSASDD 182
           N  I   ++  GKI ++ + ++ ++   K+L   K +      L FNP+ +  L SA ++
Sbjct: 76  NKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNN 135

Query: 183 TTVALWDIN----STDRPVS---IVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQ----V 231
             + +WDIN    STD   S   I M+  D +    W++   ++F +  +  T      +
Sbjct: 136 GEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASIWDL 195

Query: 232 HDKRSLSNSAQVLPVE--KPLNALA--FSKHSKNLIAAAGTDTR--VYLYDLRRLSEPLH 285
             K+ + +     P    KP  A+     K +  +  A+G+D+   + ++DLR  + P+ 
Sbjct: 196 KAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSNMPMT 255

Query: 286 TMAG-HQDAVTSIEFSSHKDGILCSSGSDRRLFIWD 320
           T+ G H   + S+++ +  + +L SSG D  + +WD
Sbjct: 256 TLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 48/114 (42%), Gaps = 14/114 (12%)

Query: 269 DTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQ 328
           DT++ L  L +  +       H  AV ++ F+  +  +L S+G++  + IWD   I    
Sbjct: 98  DTKISLKSLGKFKK-------HTTAVNTLRFNPKQQNVLASAGNNGEILIWD---INKTL 147

Query: 329 AQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNV-VQVWKISKK 381
           +  D     P + M     +  I   S+N  +  + ASA +      +W +  K
Sbjct: 148 SSTDYSPSAPGIAM---STQDEIKSVSWNKSLAHVFASAGDTTTYASIWDLKAK 198

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 347 HRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVS 384
           H +A+N   FNP+   ++ASA  +  + +W I+K L S
Sbjct: 112 HTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKTLSS 149

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 77/176 (43%), Gaps = 30/176 (17%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           ++S+S DTT  +WD+ +T+   + ++ H   V D K+      +F +   D +++V D R
Sbjct: 181 IISSSIDTTCTVWDLQATNYVKTQLIAHDSEVFDVKFLTQSTQLFASCGGDGSVRVFDLR 240

Query: 236 SLSNSAQVL-PVEKP----------------------------LNALAFSKHSKNLIAAA 266
           SL++S  +  P  +P                            L  L  S    N++A  
Sbjct: 241 SLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNSASSGSNALLRLEPSPFDPNVVATF 300

Query: 267 GTDTR-VYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
             D+  V + D+R     + T+ GH  AV  I++   +  +L + G D +  +WDL
Sbjct: 301 AHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHNVLLTCGDDCQALLWDL 356

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 36/77 (46%)

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
           P+++  ++    NLI ++  DT   ++DL+  +     +  H   V  ++F +    +  
Sbjct: 167 PVSSFHWNAVDPNLIISSSIDTTCTVWDLQATNYVKTQLIAHDSEVFDVKFLTQSTQLFA 226

Query: 309 SSGSDRRLFIWDLTQIG 325
           S G D  + ++DL  + 
Sbjct: 227 SCGGDGSVRVFDLRSLA 243

>SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]
           {ON} similar to uniprot|Q04660 Saccharomyces cerevisiae
           YMR049C ERB1 Protein required for maturation of the 25S
           and 5.8S ribosomal RNAs homologous to mammalian Bop1
          Length = 809

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 102/232 (43%), Gaps = 31/232 (13%)

Query: 153 CKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW 212
            K LS+H+   Y +   P+        S +T+V +  + S     S       I+ D+K+
Sbjct: 599 VKKLSWHRKGDYFVTVQPE--------SGNTSVLIHQL-SKHMSQSPFKKSKGIIMDAKF 649

Query: 213 HEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRV 272
           H F   +F  V   + ++++D        +++P  + L+ +       NLIA++  D RV
Sbjct: 650 HPFKPQLF--VCSQRYVRIYDLSQQILVKKLMPGARWLSKIDIHPRGDNLIASS-FDKRV 706

Query: 273 YLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQED 332
             +DL   S P  T+  H+ AV S++F   K  + CS+  D  + ++  T          
Sbjct: 707 LWHDLDLSSTPYKTLRYHEKAVRSVDFHK-KLPLFCSAADDGTIHVFHATVY-------- 757

Query: 333 ADDGVPELMMMH----AGHRS----AINDFSFNPQVPWLIASAEEDNVVQVW 376
            DD +   M++      GH+      + D  ++P+  WL  SA  DN  ++W
Sbjct: 758 -DDMMKNPMLVPLKKLTGHKVINSLGVLDTIWHPREAWLF-SAGADNTARLW 807

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKI 378
           ++AGH+  I   S +P   WL A+  +D  V++W+I
Sbjct: 439 IYAGHKGKIRTLSIDPSGLWL-ATGSDDGTVRIWEI 473

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 80/177 (45%), Gaps = 33/177 (18%)

Query: 147 SKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI 206
           SK +    T   H D    L+F+      L+S S D T+  WD+NS     +I +N    
Sbjct: 539 SKEDACVYTFDAHVDEITALSFSGD---NLISGSQDRTIRQWDLNSGKCVQTIDINFASR 595

Query: 207 VNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKP-LNALAFSKHSKNLIAA 265
           VN S          GT+S              +S  ++P E+P + AL     +   +A 
Sbjct: 596 VNSS--------TSGTLSS------------RSSTLLVPNEQPVIGALQCYDAA---LAT 632

Query: 266 AGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDL 321
              D  V L+DLR   + + T+ GH DA+TS++F    D I   +GS DR + IWDL
Sbjct: 633 GTKDGLVRLWDLRS-GQVVRTLQGHTDAITSLQF----DSINLITGSIDRSIRIWDL 684

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/382 (22%), Positives = 151/382 (39%), Gaps = 82/382 (21%)

Query: 30  MYDFVSETKLTWPSLSIQWLP----SVDANVPLKQQEMILGTHTSGD---ENNYLKIAAI 82
           +Y+ +    + WP L++  +P    S   N P   Q ++L T T      EN  + +A  
Sbjct: 117 VYEMLHNVNMPWPCLTLDVIPDTLGSERRNYP---QSILLTTATQSSRKKENELMVLALS 173

Query: 83  DLPYEVVGL----------------PDEDNSSEPVK---SMIKVTKKFEHEDEVIRARYM 123
           +L   ++                  P  +N + P++   + +KV+       EV+ A   
Sbjct: 174 NLAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMS 233

Query: 124 PKNDKIIATINGKGKIFI---YDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIE-GELLSA 179
              D  I  +  + K F    Y   KS    +    ++    GYGL ++P I+ G LLS 
Sbjct: 234 ENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSG 293

Query: 180 SDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSN 239
             D +  ++              HT     S+W          V++ +   V + +S+ +
Sbjct: 294 --DCSGQIY----------FTQRHT-----SRW----------VTDKQPFTVSNNKSIED 326

Query: 240 SAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIE 298
                        + +S+    + A AG D  + ++D R +  +P  ++      V  I 
Sbjct: 327 -------------IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 373

Query: 299 FSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFN 357
           +S  K G L +SG D   + +WDL Q     A     D V + +  +  H+ AI   +FN
Sbjct: 374 WSD-KIGYLLASGDDNGTWGVWDLRQFTPSNA-----DAV-QPVAQYDFHKGAITSIAFN 426

Query: 358 PQVPWLIASAEEDNVVQVWKIS 379
           P    ++A   EDN V +W +S
Sbjct: 427 PLDESIVAVGSEDNTVTLWDLS 448

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 72/137 (52%), Gaps = 3/137 (2%)

Query: 185 VALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
           + LWD+N   +P+S +    D V+  ++++ +E+I  +   D ++ ++D R+ S + +V+
Sbjct: 198 IQLWDVNRK-KPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQKVV 256

Query: 245 PVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKD 304
              +  NAL ++       A A  D   Y YD+R +S  LH    H  AV  ++FS   +
Sbjct: 257 QRMR-TNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGE 315

Query: 305 GILCSSGSDRRLFIWDL 321
            I+  S  D+ + I++L
Sbjct: 316 EIVTGS-YDKTIRIFNL 331

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 63/122 (51%), Gaps = 25/122 (20%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV--HD 233
           +LS  DD T+ LW +NS D   + + + T IV+D+     D  +  T   +   Q   H 
Sbjct: 132 MLSCGDDKTIKLWSVNSDD--FNSIKDDTKIVSDTG----DGALLKTFYGEHAFQSIDHH 185

Query: 234 KRS---LSNSAQV----LPVEKPLNALA----------FSKHSKNLIAAAGTDTRVYLYD 276
           +R+   ++  AQ+    +  +KPL+ L+          F+++ ++++A+ G+D  + LYD
Sbjct: 186 RRNPNFVTGGAQIQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYD 245

Query: 277 LR 278
           LR
Sbjct: 246 LR 247

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 107/260 (41%), Gaps = 25/260 (9%)

Query: 133 INGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINS 192
           + G  +I ++D ++ K       LS+  DN   + FN   E  L S   D ++ L+D+  
Sbjct: 192 VTGGAQIQLWDVNRKKP---LSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLR- 247

Query: 193 TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE-KPLN 251
           T+ P   V+      N   W+  +   F   +ED     +D R++S +  V       + 
Sbjct: 248 TNSPTQKVVQRMR-TNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVM 306

Query: 252 ALAFSKHSKNLIAAAGTDTRVYLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDGILCS 309
            + FS   + ++  +  D  + +++L+     E  HT       V  ++F+   D     
Sbjct: 307 DVDFSPTGEEIVTGS-YDKTIRIFNLKHGHSREVYHTK--RMQHVFQVKFTM--DSKYIV 361

Query: 310 SGSDR------RLFIWDLTQIGA--EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVP 361
           SGSD       R   W+ + +    E+ + + D+ + E       H   I   S +  VP
Sbjct: 362 SGSDDGNVRLWRAKAWERSHVKTTKEKNKLEYDEKLKERFK----HMPEIRRISKHRHVP 417

Query: 362 WLIASAEEDNVVQVWKISKK 381
            +I  A+E   +++  + ++
Sbjct: 418 KVIKKAQEIKNIEIASLKRR 437

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 80/202 (39%), Gaps = 46/202 (22%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           I++T N K    I++ +KS +  +   L  H      + FNPQ    L + S DT V  W
Sbjct: 85  IVSTSNQKA--IIWNLAKSSANAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAW 142

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  RP     +     +  KW+  D N+                             
Sbjct: 143 DMRSPHRPFYSTSSWRSAASQVKWNYKDPNV----------------------------- 173

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                        L ++ G D  ++++DLR+ S PL ++ GH  +V SI+F+  K   + 
Sbjct: 174 -------------LASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIM 218

Query: 309 SSGSDRRLFIWDLTQIGAEQAQ 330
           SS +D  +  WD +    E  +
Sbjct: 219 SSSNDGTVKFWDYSTSTTESKR 240

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 61/133 (45%), Gaps = 16/133 (12%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           + +  + F+    +++A    DT V+ +D+R    P ++ +  + A + ++++     +L
Sbjct: 115 RAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVL 174

Query: 308 CSS-GSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIAS 366
            SS G+D  +F+WDL +            G   L  +  GH S++N   FN      I S
Sbjct: 175 ASSHGND--IFVWDLRK------------GSTPLCSL-KGHVSSVNSIDFNRFKSTEIMS 219

Query: 367 AEEDNVVQVWKIS 379
           +  D  V+ W  S
Sbjct: 220 SSNDGTVKFWDYS 232

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 19/139 (13%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEP---LHTMAGHQDAVTSIEFS 300
           L V+   NA++ +   ++++ A+     +Y+ DL     P   LH +   Q  V  +++S
Sbjct: 21  LKVDGGFNAVSINPSGRDVVLASRQG--LYIIDLDDPFTPPRWLHHITPWQ--VADVQWS 76

Query: 301 SH-KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ 359
            H        S S+++  IW+L +  A   +           ++H GH  AI D +FNPQ
Sbjct: 77  PHPAKPYWIVSTSNQKAIIWNLAKSSANAIE----------FVLH-GHSRAITDINFNPQ 125

Query: 360 VPWLIASAEEDNVVQVWKI 378
            P ++A+   D  V  W +
Sbjct: 126 HPDVLATCSVDTYVHAWDM 144

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 125 KNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184
           K+  ++A+ +G   IF++D  K  S  LC +L  H  +   + FN     E++S+S+D T
Sbjct: 169 KDPNVLASSHG-NDIFVWDLRKG-STPLC-SLKGHVSSVNSIDFNRFKSTEIMSSSNDGT 225

Query: 185 VALWDINST 193
           V  WD +++
Sbjct: 226 VKFWDYSTS 234

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 83/380 (21%), Positives = 150/380 (39%), Gaps = 80/380 (21%)

Query: 30  MYDFVSETKLTWPSLSIQWLP----SVDANVPLKQQEMILGTHTSGDENNYLKIAAIDLP 85
           +Y+ +    + WP LS+  +P    S   N P   Q +++ T T   +    ++  + L 
Sbjct: 121 VYEMLHNVNMPWPCLSLDIIPDTLGSERRNYP---QSILMTTATQASKKKENELMVLSLS 177

Query: 86  YEVVGLPDEDNSSEPVKSMIKVTKKFEHE-----DEVIRARYMP----KNDKIIATINGK 136
                L  ++   E  +    V    E+E     D   R +  P      + + AT++  
Sbjct: 178 NLTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSEN 237

Query: 137 GKIFIYD-------------RSKSKSEGLCKTLSYHKD-NGYGLAFNPQIE-GELLSASD 181
           G+++I+D             +   +S+    T+  H +  GYGL ++P I+ G LLS   
Sbjct: 238 GEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDC 297

Query: 182 DTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSA 241
              + L               HT     SKW          V++ +   V + +S+ +  
Sbjct: 298 SGQIYL------------TQRHT-----SKW----------VTDKQAYSVGNNKSIED-- 328

Query: 242 QVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIEFS 300
                      + +SK    + A AG D  + ++D R +  +P  ++      V  I ++
Sbjct: 329 -----------IQWSKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWN 377

Query: 301 SHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ 359
             K G L +SG D   + +WDL Q   + A         + +  +  H+ AI   +FNP 
Sbjct: 378 -EKIGYLLASGDDNGSWGVWDLRQFTPDNAAN------IQPVAQYNFHKGAITSIAFNPL 430

Query: 360 VPWLIASAEEDNVVQVWKIS 379
              ++A   EDN V +W +S
Sbjct: 431 EESIVAVGSEDNTVTLWDLS 450

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 109/244 (44%), Gaps = 36/244 (14%)

Query: 145 SKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHT 204
           SKSK      TL  H    Y ++F+P     L+SAS+D TV LW +++    VS    H 
Sbjct: 512 SKSKEASNTTTLIGHSGPVYSVSFSPD-NRYLVSASEDKTVRLWSLDTFTCLVSY-KGHN 569

Query: 205 DIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE------KPLNALAFSKH 258
             V D K+     + F TVS D+T +      L +   + P+         ++ +AF  +
Sbjct: 570 HPVWDVKFSPLG-HYFATVSHDQTAR------LWSCDHIYPLRIFAGHLNDVDCVAFHPN 622

Query: 259 SKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLF 317
              ++  + +D    ++D++   + +    GH  +V S+  S   DG   ++GS D  + 
Sbjct: 623 GTYVLTGS-SDKTCRMWDIQ-TGDSVRLFLGHTASVVSVAVS--PDGRWLTTGSEDGVII 678

Query: 318 IWDLTQIGAEQAQEDADDGVPELMMMHAGH-RSAINDFSFNPQVPWLIASAEEDNVVQVW 376
           +WD+              G  + +    GH +SA+N  SFN +   L+ S   D  V+VW
Sbjct: 679 VWDI--------------GTGKRIKQMRGHGKSAVNSLSFNKEGNILV-SGGADQSVRVW 723

Query: 377 KISK 380
            + K
Sbjct: 724 DLKK 727

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 284 LHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
           ++T       +TS++FS  +D  L ++G  D  + IW L     E               
Sbjct: 465 MYTFHNTNRDMTSLQFS--EDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTT 522

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKI 378
           +  GH   +   SF+P   +L+ SA ED  V++W +
Sbjct: 523 L-IGHSGPVYSVSFSPDNRYLV-SASEDKTVRLWSL 556

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/381 (20%), Positives = 144/381 (37%), Gaps = 80/381 (20%)

Query: 30  MYDFVSETKLTWPSLSIQWLP----SVDANVPLKQQEMILGTHTSGD---ENNYLKIAAI 82
           +Y+ +    + WP L++  +P    +   N P   Q +++ T T      EN  + +   
Sbjct: 120 VYEMLHNVNMPWPCLTLDIIPDGLGTERRNYP---QSILMATATQASKKKENELMVLKLS 176

Query: 83  DLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIR--------ARYMPKNDKIIATIN 134
            L   +V    ++   +            E+E+  +R        + +    + + AT++
Sbjct: 177 QLNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATMS 236

Query: 135 GKGKIFIYDRS--------------KSKSEGLCKTLSYHKDNGYGLAFNPQIE-GELLSA 179
             G+++I+D                KS  + L    ++    GYGL ++P I+ G LL+ 
Sbjct: 237 ENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLTG 296

Query: 180 SDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSN 239
                V L               HT     SKW                  V DK+  + 
Sbjct: 297 DCSGQVYL------------TQRHT-----SKW------------------VTDKQPFTF 321

Query: 240 SAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIE 298
           S       K +  + +S+    + A +G D  + ++D R +  +P  +       V  I 
Sbjct: 322 SNN-----KSIEDIQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVIS 376

Query: 299 FSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358
           ++     +L S   D R  +WDL Q+    ++        + +  +  H+ AI   SFNP
Sbjct: 377 WNEKIGYLLASGDDDGRWGVWDLRQLSPNNSEN------VQPVAQYDFHKGAITSISFNP 430

Query: 359 QVPWLIASAEEDNVVQVWKIS 379
               +IA A EDN V +W +S
Sbjct: 431 LDESIIAVASEDNTVTLWDLS 451

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/381 (22%), Positives = 150/381 (39%), Gaps = 81/381 (21%)

Query: 30  MYDFVSETKLTWPSLSIQWLP----SVDANVPLKQQEMILGTHTSGD---ENNYLKIAAI 82
           +Y+ +    + WP L++  +P    S   N P   Q ++L T T      EN  + +A  
Sbjct: 116 VYEMLHNVNMPWPCLTLDVIPDTLGSERRNYP---QSILLTTATQSSRKKENELMVLALS 172

Query: 83  DLPYEVVGLPDEDNSSEPVKSMIKVTKKFEH---EDEVIRARYMP----KNDKIIATING 135
           +L   ++   +E+   E     I    + E+    D   R +  P      + + AT++ 
Sbjct: 173 NLTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 232

Query: 136 KGKIFIYDRS--------------KSKSEGLCKTLSYHKDNGYGLAFNPQIE-GELLSAS 180
            G ++IYD +              KS    +    ++    GYGL ++P I+ G LLS  
Sbjct: 233 NGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLLSGD 292

Query: 181 DDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNS 240
                           V     HT     S+W          V++ +   V + +S+ + 
Sbjct: 293 ------------CSGQVYFTQRHT-----SRW----------VTDKQPFTVSNNKSIED- 324

Query: 241 AQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIEF 299
                       + +S+    + A AG D  + ++D R +  +P  ++      V  I +
Sbjct: 325 ------------IQWSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 372

Query: 300 SSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358
           S  K G L +SG D   + +WDL Q     A     D V + +  +  H+ AI   +FNP
Sbjct: 373 SD-KIGYLLASGDDNGTWGVWDLRQFTPSNA-----DSV-QPVAQYDFHKGAITSIAFNP 425

Query: 359 QVPWLIASAEEDNVVQVWKIS 379
               ++A   EDN V +W +S
Sbjct: 426 LDESIVAVGSEDNTVTLWDLS 446

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 116/268 (43%), Gaps = 64/268 (23%)

Query: 129 IIATINGKGKIFIYD---RSKSKSEGLCK----------TLSYHKD-NGYGLAFNPQIE- 173
           + AT++  G+++I+D   +SK+ S    K          T+  H +  GY L ++P I+ 
Sbjct: 229 LTATMSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQT 288

Query: 174 GELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD 233
           G LL+   D +  ++              HT     SKW          V++ +   V +
Sbjct: 289 GALLTG--DCSGQIY----------FTQRHT-----SKW----------VTDKQPFTVSN 321

Query: 234 KRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQD 292
            +S+ +             + +S+    + A+AG D  + ++D R +  +P  ++     
Sbjct: 322 NKSIED-------------IQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNT 368

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAI 351
            V  I +S  K G L +SG D  ++ +WDL Q   + A         + +  +  H+ AI
Sbjct: 369 DVNVISWSD-KLGYLLASGDDNGVWGVWDLRQFSPDTANS------VQPVAQYDFHKGAI 421

Query: 352 NDFSFNPQVPWLIASAEEDNVVQVWKIS 379
              SFNP    ++A A EDN V +W +S
Sbjct: 422 TSISFNPLDESIVAVASEDNTVTLWDLS 449

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 81/168 (48%), Gaps = 16/168 (9%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD  +T  P+S++  H++ V    W   D  +  T S D
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDC-ATQTPLSVLKGHSNWVLCVAWSP-DGELIATGSMD 207

Query: 227 KTLQVHDKRSLSNSAQVLP---------VEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
            T+++ + ++       +            +PL+ +A     K  +A+A  D  + ++D 
Sbjct: 208 NTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAG--DKPRLASASKDGTIKIWDA 265

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
            R +  L+T++GH ++V+ +++     G+L +   D+ + +WD+   G
Sbjct: 266 SRRTC-LYTLSGHTNSVSCVKWGGQ--GLLYTGSHDKTIRVWDIKAGG 310

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 80/152 (52%), Gaps = 10/152 (6%)

Query: 171 QIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQ 230
           Q+E  +++ASDD T+ LW+   + +P++ +  H  +VN   +   D     + S D +++
Sbjct: 369 QVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIK 427

Query: 231 VHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL--RRLSEPLHTMA 288
           + D R     A        +  +A+S   + L++ +  DT + ++D+  R+LS  L    
Sbjct: 428 LWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCS-KDTTLKVWDVKTRKLSVDL---P 483

Query: 289 GHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
           GHQD V ++++S   DG  +CS G D+ + +W
Sbjct: 484 GHQDEVYTVDWSV--DGQRVCSGGKDKMVRLW 513

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 87/205 (42%), Gaps = 28/205 (13%)

Query: 175 ELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDK 234
            L SAS D T+ +WD  S    +  +  HT+ V+  KW    + +  T S DKT++V D 
Sbjct: 250 RLASASKDGTIKIWDA-SRRTCLYTLSGHTNSVSCVKWG--GQGLLYTGSHDKTIRVWDI 306

Query: 235 RSLSNSAQVLPVEKP-LNALAFSKHSKNLIAAAGTDTRVYL--YDLRRLSEPLHTMAGHQ 291
           ++      +L      +N L+ S      +   G D +      + R +++        +
Sbjct: 307 KAGGKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEARDIAK--------K 358

Query: 292 DAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAI 351
           +    +  S   + ++ ++  D  +F+W+  +     A+               GH+  +
Sbjct: 359 NYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLAR-------------MTGHQKLV 405

Query: 352 NDFSFNPQVPWLIASAEEDNVVQVW 376
           N  +F+P   +++ SA  DN +++W
Sbjct: 406 NHVAFSPDGRYIV-SASFDNSIKLW 429

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 80/202 (39%), Gaps = 46/202 (22%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           I++T N K    I++ +K  S  +   L  H      + FNPQ    L + S DT V  W
Sbjct: 84  IVSTSNQKA--IIWNLAKHSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAW 141

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  RP     +     +  KW+  D N+                             
Sbjct: 142 DMRSPHRPFYSTSSWRSAASQVKWNYKDPNV----------------------------- 172

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                        L ++ G D  ++++DLR+ S PL ++ GH  +V SI+F+  K   + 
Sbjct: 173 -------------LASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIM 217

Query: 309 SSGSDRRLFIWDLTQIGAEQAQ 330
           SS +D  +  WD ++   E  +
Sbjct: 218 SSSNDGTVKFWDYSKSTTESKR 239

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 16/134 (11%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           + +  + F+    +++A    DT V+ +D+R    P ++ +  + A + ++++     +L
Sbjct: 114 RAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVL 173

Query: 308 CSS-GSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIAS 366
            SS G+D  +F+WDL +            G   L  +  GH S++N   FN      I S
Sbjct: 174 ASSHGND--IFVWDLRK------------GSTPLCSL-KGHVSSVNSIDFNRFKSTEIMS 218

Query: 367 AEEDNVVQVWKISK 380
           +  D  V+ W  SK
Sbjct: 219 SSNDGTVKFWDYSK 232

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 19/139 (13%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEP---LHTMAGHQDAVTSIEFS 300
           L V+   NA++ +   ++++ A+     +Y+ DL     P   LH +   Q  V  +++S
Sbjct: 20  LKVDGGFNAVSINPSGRDVVLASRQG--LYIIDLDDPFTPPRWLHHITPWQ--VADVQWS 75

Query: 301 SH-KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ 359
            H        S S+++  IW+L +  +   +           ++H GH  AI D +FNPQ
Sbjct: 76  PHPAKPYWIVSTSNQKAIIWNLAKHSSNAIE----------FVLH-GHSRAITDINFNPQ 124

Query: 360 VPWLIASAEEDNVVQVWKI 378
            P ++A+   D  V  W +
Sbjct: 125 HPDVLATCSVDTYVHAWDM 143

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 125 KNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTT 184
           K+  ++A+ +G   IF++D  K  S  LC +L  H  +   + FN     E++S+S+D T
Sbjct: 168 KDPNVLASSHG-NDIFVWDLRKG-STPLC-SLKGHVSSVNSIDFNRFKSTEIMSSSNDGT 224

Query: 185 VALWD 189
           V  WD
Sbjct: 225 VKFWD 229

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 75/166 (45%), Gaps = 20/166 (12%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           ++S+S DTT  +WD+ S+    + ++ H   V D ++      +F +   D +++V D R
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR 318

Query: 236 SLSNSAQVL-----PVEKP--------------LNALAFSKHSKNLIAAAGTDT-RVYLY 275
           SL++S  +      P   P              L  L  S +  N++A    D+ ++ + 
Sbjct: 319 SLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIIL 378

Query: 276 DLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           D+R    P+  + GH  +V  I++   K  +L S   D +   WDL
Sbjct: 379 DMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 61/136 (44%), Gaps = 17/136 (12%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKSEGLCKTLSYHKDNGYGL 166
           T+   H+ EV   R++ K+ ++ A+  G G + ++D RS + S  + +  S         
Sbjct: 281 TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSPASGPNAG 340

Query: 167 AFNPQIEGE--LLS--------------ASDDTTVALWDINSTDRPVSIVMNHTDIVNDS 210
           A  P ++G   LL               A+D   + + D+ + + P+  +  HT  VN+ 
Sbjct: 341 ATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEI 400

Query: 211 KWHEFDENIFGTVSED 226
           KWH    N+  + S+D
Sbjct: 401 KWHPTKRNVLLSCSDD 416

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 3/88 (3%)

Query: 107 VTKKFEHEDEVIRARYMPKNDKIIATING-KGKIFIYDRSKSKSEGLCKTLSYHKDNGYG 165
            T   +  D ++R    P +  ++AT      KI I D    +S  L   L  H  +   
Sbjct: 342 TTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPIL--NLEGHTCSVNE 399

Query: 166 LAFNPQIEGELLSASDDTTVALWDINST 193
           + ++P     LLS SDD     WD+N++
Sbjct: 400 IKWHPTKRNVLLSCSDDCQALYWDLNNS 427

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 80/189 (42%), Gaps = 26/189 (13%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           ++S+S DTT  +WD+ S+    + ++ H   V D ++      +F +   D +++V D R
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR 318

Query: 236 SLSNSAQVLPVEK---------------------PLNALAFSKHSKNLIAAAGTDT-RVY 273
           SL++S  +                           L  L  S +  N++A    D+ ++ 
Sbjct: 319 SLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADSNKII 378

Query: 274 LYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLT----QIGAEQA 329
           + D+R    P+ T+ GH  +V  I++   K  +L S   D ++  WDL     +I     
Sbjct: 379 ILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFMEINGGSV 438

Query: 330 QEDADDGVP 338
           +     G P
Sbjct: 439 KSPGASGTP 447

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 62/140 (44%), Gaps = 23/140 (16%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKSEGLCK------------ 154
           T+   H+ EV   R++ K+ ++ A+  G G + ++D RS + S  + +            
Sbjct: 281 TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPA 340

Query: 155 --TLSYHKDNGYGL------AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI 206
             T +   D  Y L       ++P +      A+D   + + D+ + + P+  +  H+  
Sbjct: 341 AGTTTPSSDGSYALLRLEPSPYDPNVLATF--AADSNKIIILDMRNPESPILTLEGHSSS 398

Query: 207 VNDSKWHEFDENIFGTVSED 226
           VN+ KWH    N+  + S+D
Sbjct: 399 VNEIKWHPTKRNVLLSCSDD 418

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 3/78 (3%)

Query: 117 VIRARYMPKNDKIIATING-KGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGE 175
           ++R    P +  ++AT      KI I D    +S  L  TL  H  +   + ++P     
Sbjct: 354 LLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPIL--TLEGHSSSVNEIKWHPTKRNV 411

Query: 176 LLSASDDTTVALWDINST 193
           LLS SDD  V  WD+N++
Sbjct: 412 LLSCSDDCQVLYWDLNNS 429

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 125/275 (45%), Gaps = 38/275 (13%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLC-KTLSYHKDNGYGLAFNPQIEGELLSASDD 182
           P     +A+ +  G I I+D ++     +C  T+S H ++   + ++ Q  G + S S D
Sbjct: 245 PGESPRLASASKDGTIRIWDITRR----VCLYTMSGHTNSVSCIKWSGQ--GIIYSGSHD 298

Query: 183 TTVALWDINSTDRPVSIVMNHTDIVND---SKWHEFDENIFG-TVSEDKTLQVHDKRSLS 238
            TV +WD+N+  + ++I+ +H   VN    S  +      F  T ++  + +    ++L+
Sbjct: 299 KTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALA 358

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
           N  +V+     L         + L+  A  D  ++L++  + ++P+  M GHQ  V  + 
Sbjct: 359 NYEKVVKKNGKL---------EELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVA 409

Query: 299 FSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFN 357
           FS   DG  + S+  D  + +W            D  DG  + +    GH +++   +++
Sbjct: 410 FSP--DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWS 453

Query: 358 PQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
                L+ S  +D  ++VW +  + +S  +P + D
Sbjct: 454 ADCR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 79/167 (47%), Gaps = 14/167 (8%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD + T  P + +  H + V    +    E +  T S D
Sbjct: 150 AFAPNTSSRMVTGAGDNTARIWDCD-TQTPKATLTGHFNWVLCVSYCPNGE-VIATGSMD 207

Query: 227 KTLQVHDKRSLSNSAQVLPVE-KPLNALAF------SKHSKNLIAAAGTDTRVYLYDL-R 278
            T+++ D +        L    K + +LA+             +A+A  D  + ++D+ R
Sbjct: 208 NTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITR 267

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           R+   L+TM+GH ++V+ I++S    GI+ S   D+ + +WD+   G
Sbjct: 268 RVC--LYTMSGHTNSVSCIKWSGQ--GIIYSGSHDKTVRVWDMNADG 310

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 81/154 (52%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N ++E  +++ASDD T+ LW+   +++P++ +  H  +VN   +   D     + S D +
Sbjct: 367 NGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNS 425

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL--RRLSEPLHT 286
           +++ D R     +        +  +A+S   + L+ +   DT + ++D+  R+LS  L  
Sbjct: 426 IKLWDGRDGKFISTFRGHVASVYQVAWSADCR-LLVSCSKDTTLKVWDVRTRKLSVDL-- 482

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GH+D V ++++S   DG  +CS G D+ + IW
Sbjct: 483 -PGHKDEVYTVDWSV--DGKRVCSGGKDKMVRIW 513

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 82/172 (47%), Gaps = 12/172 (6%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           ++H D    LA N      L S S D TV LWD+NS     SI   H++  V+ S+WH  
Sbjct: 283 THHTDAVLSLAHNKHFRSVLASTSADHTVKLWDLNSGTAARSIASIHSNKNVSASEWHMS 342

Query: 216 DENIFGTVSEDKTL-----QVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
             +I  T   D  L     ++ D+ ++S    V+  E+ + A  F+  S+NLI       
Sbjct: 343 HGSILLTGGYDSRLALTDVRISDESNMSKYWSVMGGEE-IEAATFA--SENLILCGTDSG 399

Query: 271 RVYLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
            VY +D+R    S+P+ T+  H   ++++  +    G++ +    ++ + +W
Sbjct: 400 NVYSFDIRNNEGSKPVWTLKAHDAGISTLNCNKFIPGMMSTGAMGEKAVKLW 451

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 110/246 (44%), Gaps = 42/246 (17%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +P     LLSAS D T+  W +   D+    PV     H+ I+
Sbjct: 10  LRGTLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKGHSHII 69

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHD-------KRSLSNSAQVLPVEKPLNALAFSKHSK 260
            D      D     + S DKT+++ +       KR + + + VL V       A  + + 
Sbjct: 70  QDCT-VTADGEYALSASWDKTIRLWELATGKCVKRFVGHKSDVLSV-------AIDRRAT 121

Query: 261 NLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-----ILCSSGSDRR 315
            +++A+  D  V +++   L E + T+ GH D V+ +  + ++D       + S+G D+ 
Sbjct: 122 QIVSAS-RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKV 178

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
           + +W+L        Q +AD           GH + +N  + +P    L+ASA +D  + +
Sbjct: 179 VKVWNLHSF-----QIEAD---------FIGHNNYVNTVTASPDGS-LVASAGKDGQIML 223

Query: 376 WKISKK 381
           W +++K
Sbjct: 224 WNLTEK 229

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 11/112 (9%)

Query: 286 TMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHA 345
           T+ GH   VTS+  S  +  +L S+  D+ L  W LT        +D   GVP  +    
Sbjct: 13  TLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLT-------GDDQQYGVP--VRSFK 63

Query: 346 GHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISK-KLVSNIIPEYTDLKSL 396
           GH   I D +      + + SA  D  +++W+++  K V   +   +D+ S+
Sbjct: 64  GHSHIIQDCTVTADGEYAL-SASWDKTIRLWELATGKCVKRFVGHKSDVLSV 114

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 68/134 (50%), Gaps = 9/134 (6%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIEFSSHKDGI 306
           K +  + +S+    + A+AG D  + ++D R +  +P  ++      V  I +S  K G 
Sbjct: 328 KSVEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWS-EKIGY 386

Query: 307 LCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIA 365
           L +SG D  L+ +WDL Q     + ++ +D  P  +  +  H+ AI   +FNP    +IA
Sbjct: 387 LLASGDDNGLWGVWDLRQF----SPDNINDVQP--VAQYDFHKGAITSINFNPLDDSIIA 440

Query: 366 SAEEDNVVQVWKIS 379
            A EDN V +W +S
Sbjct: 441 VASEDNTVTLWDLS 454

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 66/126 (52%), Gaps = 2/126 (1%)

Query: 185 VALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
           + LWDIN + +P+S +    D +N  K+++ D N+ G+   D ++ ++D R+ S + +++
Sbjct: 198 INLWDINRS-KPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIV 256

Query: 245 PVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKD 304
              + +N++ ++         A  D   Y YD+R +S  L+    H  AV  ++ S   +
Sbjct: 257 QTMR-VNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGE 315

Query: 305 GILCSS 310
            ++ +S
Sbjct: 316 EVVTAS 321

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 88/192 (45%), Gaps = 26/192 (13%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI--------VNDS 210
           H+D  Y LA +     ++ S S D  +  WD++S ++  S   ++  I        VN  
Sbjct: 66  HQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNID 125

Query: 211 KWHEFDENIFGTVSEDKTLQV----HDKRSLSNSAQVLPV----------EKPLNALAFS 256
                ++N   + S+DKT+++    H+  +  ++ QV+            E     L  S
Sbjct: 126 SASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDHS 185

Query: 257 KHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRL 316
           + + N +       R+ L+D+ R S+PL  ++   D + +++F+ +   +L S+GSD  +
Sbjct: 186 RMTSNFVTGG---PRINLWDINR-SKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSI 241

Query: 317 FIWDLTQIGAEQ 328
            ++DL    A Q
Sbjct: 242 VLYDLRTNSATQ 253

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 133 INGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINS 192
           + G  +I ++D ++SK       LS+  DN   + FN      L SA  D ++ L+D+ +
Sbjct: 192 VTGGPRINLWDINRSKP---LSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRT 248

Query: 193 TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
                 IV   T  VN   W+  +   F   SED     +D R++S +  V 
Sbjct: 249 NSATQKIV--QTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVF 298

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/118 (19%), Positives = 53/118 (44%), Gaps = 7/118 (5%)

Query: 115 DEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKSEGLCKTLSYHKDNGYGLAFNPQIE 173
           D +   ++   +  ++ +      I +YD R+ S ++ + +T+  +      + +NP   
Sbjct: 217 DNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQTMRVN-----SMCWNPMEA 271

Query: 174 GELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV 231
              + AS+D     +D+ +  R +++  +H   V D       E +  T S DKT+++
Sbjct: 272 FNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEEVV-TASYDKTIRI 328

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 80/366 (21%), Positives = 148/366 (40%), Gaps = 50/366 (13%)

Query: 30  MYDFVSETKLTWPSLSIQWLP----SVDANVPLKQQEMILGTHTSGDENNYLKIAAIDLP 85
           +Y+ +    + WP +++  +P    S   N P   Q +++ T T   + N  ++  + + 
Sbjct: 129 VYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYP---QSLLMATATQASKKNQNELMVLKM- 184

Query: 86  YEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPK-NDKIIATINGKGKIFIYDR 144
                       S+  K+++K  +     ++       P   ++ I+  +   ++ +   
Sbjct: 185 ------------SQLAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRLKVSPF 232

Query: 145 SKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDI-NSTDRPVSIVMNH 203
           + +  E LC T+S   +NG    F      +L S         + I     RP+  V NH
Sbjct: 233 ANAAQEVLCSTMS---ENGEVYIF------DLASQVKAFETPGYQIPKQAKRPIHTVRNH 283

Query: 204 TDI---VNDSKWHEFDEN---IFGTVSEDKTL-QVHDKRSLSN-SAQVLPVEKPLNALAF 255
             +    ND  W    +    + G  S    L Q H  + +++  A  +   K +  L +
Sbjct: 284 GSVEGYAND--WSPIIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQW 341

Query: 256 SKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDR 314
           S+    + A+ G D  + ++D R +  +P  ++      V  I +S  K G L +SG D 
Sbjct: 342 SRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWS-EKIGYLLASGDDD 400

Query: 315 RLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVV 373
             + +WDL Q   + A           +  +  H+ AI   SFNP    +IA A EDN V
Sbjct: 401 GTWGVWDLRQFTPQNA------STASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTV 454

Query: 374 QVWKIS 379
            +W +S
Sbjct: 455 TLWDLS 460

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 126/285 (44%), Gaps = 48/285 (16%)

Query: 117 VIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLC-KTLSYHKDNGYGLAFNPQIEGE 175
           +++A   PK    +AT +  G I ++D  +     +C  TLS H ++   + +  +    
Sbjct: 242 LVKAGERPK----LATSSKDGTIKVWDTGRR----VCLYTLSGHVNSVSCVKWGGK--NL 291

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           L S S D TV +WD+N   + ++I+ +H   VN             ++S D  L+V    
Sbjct: 292 LYSGSHDKTVRVWDMNLGGKCINILKSHAHWVNHL-----------SLSTDYALRV-GPF 339

Query: 236 SLSNSAQVLPVEKPLNALA-FSKHSKN------LIAAAGTDTRVYLYDLRRLSEPLHTMA 288
             +      P E    AL  + K +K       L+  A  D  ++L++  + ++P+  M 
Sbjct: 340 DHTGIMPATPEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMT 399

Query: 289 GHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGH 347
           GHQ  V  + FS   DG  + S+  D  + +W            D+ DG  + +    GH
Sbjct: 400 GHQKLVNHVAFSP--DGRYIVSASFDNSIKLW------------DSRDG--KFITTFRGH 443

Query: 348 RSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
            +++   +++     L+AS  +D  ++VW I  K +S  +P + D
Sbjct: 444 VASVYQVAWSSDCR-LLASCSKDTSLKVWDIRTKKLSVDLPGHLD 487

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 76/147 (51%), Gaps = 10/147 (6%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           +++ASDD T+ LW+ + + +P+S +  H  +VN   +   D     + S D ++++ D R
Sbjct: 374 MVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDSR 432

Query: 236 SLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR--RLSEPLHTMAGHQDA 293
                         +  +A+S   + L+A+   DT + ++D+R  +LS  L    GH D 
Sbjct: 433 DGKFITTFRGHVASVYQVAWSSDCR-LLASCSKDTSLKVWDIRTKKLSVDL---PGHLDE 488

Query: 294 VTSIEFSSHKDG-ILCSSGSDRRLFIW 319
           V ++++S   DG  +CS G D+ + +W
Sbjct: 489 VYTVDWSV--DGKRVCSGGKDKMVRLW 513

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 79/169 (46%), Gaps = 18/169 (10%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           +F P     +++ + D T  +WD + T  P+  +  HT+ V    W   D  +  T S D
Sbjct: 150 SFAPHTSSRMVTGAGDNTARIWDCD-TQTPMVTLSGHTNWVLCVAWSP-DGELIATGSMD 207

Query: 227 KTLQVHDKRSLSNSAQVLPVEK---------PLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
            T+++ + ++     + +   +         PL+ +   +  K  +A +  D  + ++D 
Sbjct: 208 NTIRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPK--LATSSKDGTIKVWDT 265

Query: 278 -RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
            RR+   L+T++GH ++V+ +++      +L S   D+ + +WD+   G
Sbjct: 266 GRRVC--LYTLSGHVNSVSCVKWGGKN--LLYSGSHDKTVRVWDMNLGG 310

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 44/104 (42%), Gaps = 15/104 (14%)

Query: 274 LYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDA 333
           ++ +R ++     +AGH   +    F+ H    + +   D    IW            D 
Sbjct: 126 IFKVRPITRSSAAIAGHGSTILCSSFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 334 DDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           D   P  M+  +GH + +   +++P    LIA+   DN +++W+
Sbjct: 174 DTQTP--MVTLSGHTNWVLCVAWSPDGE-LIATGSMDNTIRLWE 214

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 102/220 (46%), Gaps = 20/220 (9%)

Query: 166 LAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVMNH-TDIVNDSKWHEFDENIFGTV 223
           + F+P  +G+ L + ++D  + +WD+ +T R V  +  H  DI +   +   D+ + G  
Sbjct: 454 VCFSP--DGKFLATGAEDKLIRIWDL-TTRRIVMTLQGHEQDIYSLDYFPSGDKLVSG-- 508

Query: 224 SEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD------L 277
           S D+T+++ D R+    +  L +E  +  +A S     LIAA   D  V ++D      +
Sbjct: 509 SGDRTVRIWDLRA-GQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLV 567

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDLTQIGAEQAQEDADDG 336
            RL        GH+D+V S+ F+  +DG    SGS DR + +W+L        +  A+  
Sbjct: 568 ERLDSENELGTGHKDSVYSVVFT--RDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTA 625

Query: 337 VPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
             E  + + GH+  +   +   Q    I S  +D  V  W
Sbjct: 626 ASE--VTYTGHKDFVLSVATT-QNDEFILSGSKDRGVLFW 662

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 109/287 (37%), Gaps = 78/287 (27%)

Query: 113 HEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQI 172
           HE ++    Y P  DK+++  +G   + I+D       G C      +D    +A +P  
Sbjct: 489 HEQDIYSLDYFPSGDKLVSG-SGDRTVRIWDLRA----GQCSLTLSIEDGVTTVAVSPG- 542

Query: 173 EGELLSA-SDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV 231
           +G+L++A S D TV +WD  +       ++   D           EN  GT  +D    V
Sbjct: 543 DGKLIAAGSLDRTVRIWDSET-----GFLVERLD----------SENELGTGHKDSVYSV 587

Query: 232 HDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-----------RL 280
                                  F++    +++ +  D  V L++LR             
Sbjct: 588 ----------------------VFTRDGHGVVSGS-LDRSVKLWNLRSANGGSTEGKANT 624

Query: 281 SEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPEL 340
           +    T  GH+D V S+  ++  D  + S   DR +  W            D   G P L
Sbjct: 625 AASEVTYTGHKDFVLSVA-TTQNDEFILSGSKDRGVLFW------------DTPSGNPLL 671

Query: 341 MMMHAGHRSAI------NDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
           M+   GHR+++      ND    P+   + A+   D   ++WK +KK
Sbjct: 672 MLQ--GHRNSVISVAVANDHPLGPEY-GVFATGSGDCKARIWKYTKK 715

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 131/291 (45%), Gaps = 29/291 (9%)

Query: 107 VTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGL 166
            ++  +H D  +  R    NDK +    G   + +YD  ++ +     T   HK N   +
Sbjct: 44  CSRTIQHSDSQVN-RLEITNDKKLLAAAGYQNVRLYD-IRTTNPNAVATFEGHKGNVTSV 101

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           +F  Q    ++++S+D T+ +WD+ S   P +    H   VN+   H  ++    +   D
Sbjct: 102 SFQ-QDNKWMVTSSEDGTIKVWDVRSPSVPRN--YKHNAPVNEVVIHP-NQGELISCDRD 157

Query: 227 KTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHS-KNLIAAAGTDTRVYLYDLRRLSE--- 282
            T+++ D      + Q++P +   +  + S  S  +++ AA      Y++++   ++   
Sbjct: 158 GTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHTDASN 217

Query: 283 --PLHTMAGHQDAVTSIEFSSH-KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPE 339
             P++  + H+D +T +  SS  K    CS  +DR   IW +         E  DD   E
Sbjct: 218 LKPINKFSAHKDYITRVVLSSDVKHMATCS--ADRTAKIWSV--------GETEDDFNLE 267

Query: 340 LMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEY 390
             +   GH+  + D +F+    +L+ +A  D+ V++W +S +    I+ +Y
Sbjct: 268 TTL--DGHQRWVWDCAFSADSAYLV-TASSDHYVRLWDLSTR---EIVRQY 312

>NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa]
           {ON} Anc_7.231
          Length = 608

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 103/221 (46%), Gaps = 34/221 (15%)

Query: 119 RARYMPKNDKIIAT-------INGK----GKIFIYDRSKSKS---EGLCKTLSY--HKDN 162
           RAR++ KN  I AT        NGK     K+   +R K +S   +G C+   +  H D 
Sbjct: 197 RARFV-KNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDG 255

Query: 163 GYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGT 222
              L FN ++   L + S D+TVA+WD+ S ++ +  +  HTD V   K   FDE    T
Sbjct: 256 VLTLQFNYRL---LFTGSYDSTVAIWDLCS-NKLIRRLSGHTDGV---KTLYFDEAKLVT 308

Query: 223 VSEDKTLQVHD-KRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLS 281
            S DKT++V + K     S      +  ++  AF K    +I +   D  V ++ +   S
Sbjct: 309 GSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK----IIVSGSADKTVKIWHVE--S 362

Query: 282 EPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDL 321
              +T+ GH + V  ++   H     C SGS D  + +WD+
Sbjct: 363 RTCYTLRGHTEWVNCVKL--HPKSFTCFSGSDDTTIRMWDI 401

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 81/154 (52%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N Q+E  +++ASDD T+ LWD     +P++ +  H  +VN   +   D     + S D +
Sbjct: 366 NGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP-DGRYIVSASFDNS 424

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR--RLSEPLHT 286
           +++ D R+ +  A        +  +A+S   + L+ +   DT + ++D+R  +LS  L  
Sbjct: 425 IKLWDGRNGTFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTKKLSVDL-- 481

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GH D V ++++S   DG  +CS+G D+ + IW
Sbjct: 482 -PGHNDEVYTVDWSV--DGKRVCSAGKDKMVRIW 512

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 76/168 (45%), Gaps = 16/168 (9%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P   G +++ S D T  +WD N T+ P+  +  H + V    W   D  +  T S D
Sbjct: 149 AFAPHTSGRMVTGSGDNTARIWDCN-TNTPMYTLKGHFNWVLCVAWCP-DGELIATGSMD 206

Query: 227 KTLQVHDKRSLSNSAQVLP---------VEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
            T+++ D     +  + L            +P++ +      +  +A+A  D  + ++D 
Sbjct: 207 NTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPR--LASASKDGTIKIWDT 264

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
            R    L T++GH ++V+ +++     GIL S   D+ +  WD+   G
Sbjct: 265 TRRVCVL-TLSGHTNSVSCVKWGGR--GILYSGSHDKTIRAWDMAAGG 309

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 118/278 (42%), Gaps = 47/278 (16%)

Query: 113 HEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQI 172
           H + V+   + P + ++IAT +    I ++D +K +S G  + L  H      L + P  
Sbjct: 184 HFNWVLCVAWCP-DGELIATGSMDNTIRLWDSNKGESYG--EALRGHAKWITSLTWEPMH 240

Query: 173 ------EGELLSASDDTTVALWDINSTDRPVSIVM--NHTDIVNDSKWHEFDENIFGTVS 224
                 +  L SAS D T+ +WD   T R V ++    HT+ V+  KW      I  + S
Sbjct: 241 LVKAGDQPRLASASKDGTIKIWD---TTRRVCVLTLSGHTNSVSCVKWG--GRGILYSGS 295

Query: 225 EDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTD--TRVYLYDLRRLSE 282
            DKT++  D  +           K +N L    H  N ++   TD   RV  +D     +
Sbjct: 296 HDKTIRAWDMAAGG---------KCINILKSHAHWINHLSL-NTDYALRVGAFD-HTGEK 344

Query: 283 PLHTMAGHQDAVTSIEFSSHKDG----ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVP 338
           P         A+ + E  + K+G    ++ ++  D  +++WD  +               
Sbjct: 345 PSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLK-------------AS 391

Query: 339 ELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
           + +    GH+  +N  +F+P   +++ SA  DN +++W
Sbjct: 392 KPITRMTGHQKLVNHVAFSPDGRYIV-SASFDNSIKLW 428

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 40/204 (19%), Positives = 86/204 (42%), Gaps = 45/204 (22%)

Query: 214 EFDENIFGTV-------SEDKTLQVHDKRSLSNSAQVLPVEKPLNALA----------FS 256
           +  +NI+ ++       +ED    V+  R++    +V PV +  +A+A          F+
Sbjct: 95  DIKDNIYSSILKPGHKTTEDFITIVYTPRAV---FKVRPVTRSSSAIAGHGSTILCSAFA 151

Query: 257 KHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRR 315
            H+   +     D    ++D    + P++T+ GH + V  + +    DG L ++GS D  
Sbjct: 152 PHTSGRMVTGSGDNTARIWDCN-TNTPMYTLKGHFNWVLCVAWCP--DGELIATGSMDNT 208

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ-------VPWLIASAE 368
           + +WD           +  +   E +    GH   I   ++ P         P  +ASA 
Sbjct: 209 IRLWD----------SNKGESYGEALR---GHAKWITSLTWEPMHLVKAGDQP-RLASAS 254

Query: 369 EDNVVQVWKISKKLVSNIIPEYTD 392
           +D  +++W  ++++    +  +T+
Sbjct: 255 KDGTIKIWDTTRRVCVLTLSGHTN 278

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 77/194 (39%), Gaps = 53/194 (27%)

Query: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189
           IA     G I IYD +K K     +TLS H D    L++N  I   L S S D T+   D
Sbjct: 483 IAIGQSNGIIEIYDVTKRK---CIRTLSGHTDRTACLSWNSHI---LTSGSRDRTILHRD 536

Query: 190 INSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKP 249
           +   D     + +HT  V   KW+E D                                 
Sbjct: 537 VRMKDPFFERIKSHTQEVCGLKWNESD--------------------------------- 563

Query: 250 LNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCS 309
                      N + + G D  V +YD   +  PL T+  H  AV ++ +S HK GIL +
Sbjct: 564 -----------NKLVSGGNDNTVNIYD-GCMPTPLLTLDEHTAAVKALAWSPHKRGILAT 611

Query: 310 SG--SDRRLFIWDL 321
            G  +DR+L IW++
Sbjct: 612 GGGTADRKLKIWNI 625

>NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.356
           YLR196W
          Length = 607

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 82/172 (47%), Gaps = 12/172 (6%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           ++H D    L+ N Q    L S S D TV LWD+N+     S+   H +  V+ S+WH  
Sbjct: 320 THHTDAVLSLSHNKQFRAVLASTSADHTVKLWDLNTATAARSLASIHNNKNVSSSEWHVS 379

Query: 216 DENIFGTVSEDKTL-----QVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
           + +I  T   D  +     ++ D++ +S    V+P E+ +    F+   +N+I       
Sbjct: 380 NGSILLTGGYDSRIALSDVRISDEKQMSKYWSVMPGEE-IECTTFA--DENIILCGTDAG 436

Query: 271 RVYLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
            +Y +D+R    S+P+ T+  H   ++S+  +    G++ +    ++ + +W
Sbjct: 437 NIYSFDIRNNENSKPVWTLKAHDAGISSLSCNKFIPGLMSTGAMGEKTVKLW 488

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 77/194 (39%), Gaps = 46/194 (23%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           +++T N K    I++ +KS S+ +   L  H      + FNP+    L + S DT V  W
Sbjct: 84  VVSTSNQKA--LIWNLAKSSSDAIEHVLHGHSRAITDINFNPENPDILATCSIDTYVHAW 141

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  +P           +  KW+  D NI                             
Sbjct: 142 DMRSPHKPFYSTSAWRSSASQVKWNFKDSNI----------------------------- 172

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                        L ++ G D  V+++DLR  S PL  + GH+ +V SI+FS  K   + 
Sbjct: 173 -------------LASSHGND--VFIWDLRNGSTPLCQLVGHESSVNSIDFSRFKSTEIM 217

Query: 309 SSGSDRRLFIWDLT 322
           SS +D  +  WD +
Sbjct: 218 SSSNDGTVKFWDYS 231

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 108/263 (41%), Gaps = 60/263 (22%)

Query: 117 VIRARYMPKNDKIIATINGKGKIF-IYDRSKSKSEGLCKTLSYHKD-----NGYGLAFNP 170
           V R ++MP + + +AT +   +I+ + D+ K +       + Y K      NG+ L   P
Sbjct: 110 VSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVN--LSLVKYGKGVGDVANGHTLGKLP 167

Query: 171 QIEGE---------LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFG 221
            +            +LS+S DTT  +WD+ +++   + ++ H   V D+K+     N+F 
Sbjct: 168 PVTSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDAKFLTQSSNLFA 227

Query: 222 TVSEDKTLQVHDKRSLSNSAQVL----------PVEKPLNA------------------- 252
           +   D +++V D R L++S  +           P +  L+A                   
Sbjct: 228 SCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAETS 287

Query: 253 -------------LAFSKHSKNLIAAAGTDTRVY-LYDLRRLSEPLHTMAGHQDAVTSIE 298
                        L  S    N++A    D+ V  + D+R    P+ T+ GH  A+  + 
Sbjct: 288 LAVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALNQLR 347

Query: 299 FSSHKDGILCSSGSDRRLFIWDL 321
           +   K  +L + G D ++  WDL
Sbjct: 348 WHPSKPNVLATCGDDCQILYWDL 370

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 118/288 (40%), Gaps = 69/288 (23%)

Query: 166 LAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVMNH-TDIVNDSKWHEFDENIFGTV 223
           + F+P  +G+ L + ++D  + +WD+ ST R V  +  H  DI +   +   D+ + G  
Sbjct: 384 VCFSP--DGKFLATGAEDKLIRIWDL-STKRIVMTLQGHEQDIYSLDYFPSGDKLVSG-- 438

Query: 224 SEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD------L 277
           S D+T+++ D R+    +  L +E  +  +A S      IAA   D  + ++D      +
Sbjct: 439 SGDRTVRIWDLRT-GQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLV 497

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDLTQIGAEQAQE----- 331
            RL        GH+D+V S+ F+    G++  SGS DR + +W+L   G+    +     
Sbjct: 498 ERLDSENELGTGHKDSVYSVVFTRDGQGVV--SGSLDRSVKLWNLHNTGSSSKNDSKPTA 555

Query: 332 --------------------------------------DADDGVPELMMMHAGHRSAI-- 351
                                                 D   G P LM+   GHR+++  
Sbjct: 556 ATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQ--GHRNSVIS 613

Query: 352 ----NDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKS 395
               N F   P    + A+   D   ++WK SK   +   P+  ++K+
Sbjct: 614 VAVANGFPLGPDY-GVFATGSGDCKARIWKYSKNKANASEPQVQEVKA 660

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 116/269 (43%), Gaps = 67/269 (24%)

Query: 129 IIATINGKGKIFIYD--------------RSKSKSEGLCKTLSYHKDNGYGLAFNPQIE- 173
           + AT++  G+++I+D               SK     +    S+    G+GL ++P I+ 
Sbjct: 244 LTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKS 303

Query: 174 GELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD 233
           G LL+      + L     T R       HT     SKW          ++E ++  V +
Sbjct: 304 GALLTGDCSGEIFL-----TSR-------HT-----SKW----------ITEKQSFSVGN 336

Query: 234 KRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR--RLSEPLHTMAGHQ 291
            +S+ +             + +SK  + + A AG D  + ++D R  +    + T A + 
Sbjct: 337 NKSIED-------------IQWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNV 383

Query: 292 DAVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSA 350
           D V  I ++   + +L +SG D+ ++ +WDL Q     +QE+A       +  +  H+ A
Sbjct: 384 D-VNVISWNEKMEYLL-ASGDDKGVWGVWDLRQFSP--SQENASP-----VAQYDFHKGA 434

Query: 351 INDFSFNPQVPWLIASAEEDNVVQVWKIS 379
           I   SFNP     +A A EDN V +W +S
Sbjct: 435 ITSISFNPLDESTVAVASEDNTVTLWDLS 463

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 101/232 (43%), Gaps = 14/232 (6%)

Query: 165 GLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVS 224
           G++F+   + + ++ SDD  + +W+ ++  +  ++  +H D V    WH     +  + S
Sbjct: 172 GISFS-GTDSKFVTCSDDNILKIWNFSNGQQESTLTGHHWD-VRSCDWHP-TMGLIASGS 228

Query: 225 EDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPL 284
           +D  +++ D RS    + +L  +  + +  F     N++A    D    ++D+R+  + L
Sbjct: 229 KDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFDIRQNMKEL 288

Query: 285 HTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMH 344
                  D + S+ +    + I      D  +  +DL      Q  +D+  G      + 
Sbjct: 289 AVYRDESDYM-SLTWHPINESIFTVGCYDGSMKHFDLM-----QEPQDSSSGC--FHNIP 340

Query: 345 AGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
             H   I   ++NP V  ++ASA +D  ++ W  S+ L  N    P Y + K
Sbjct: 341 YAHDKCITSLAYNP-VGHILASASKDRTIRFWTRSRPLDPNAFDDPTYNNKK 391

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 92/215 (42%), Gaps = 32/215 (14%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMN-----------HTDIVNDSKWHEFDENIFGTVS 224
            L+ +++ TV+LW++++T     I+ N           H   +ND KW+  D+ +F T  
Sbjct: 64  FLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMFFTCG 123

Query: 225 EDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKN-LIAAAGTDTRVYLYDLRRLSEP 283
            DK +++ D     N   +       N+  F   + N  I     D    L DLR ++  
Sbjct: 124 NDKFVKLWDTNKFINVQDL-----EFNSNLFQMDTANQFILVTLDDYYPRLIDLRNMNLG 178

Query: 284 LHTMAGHQDAVT-SIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
           +     H ++ T   + +  +D ++ SS +D  + IWD+ ++     +E           
Sbjct: 179 ITIFGKHLNSKTLCCKINPVRDNLIASSDNDGMIRIWDV-RMNYRSIEE----------- 226

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
               H  +IND  +N     LI++   D  +Q+W+
Sbjct: 227 -WKAHSRSINDMVWNDNGTKLISTG-VDGKIQIWR 259

>TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7.310
           YDL195W
          Length = 1265

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/300 (20%), Positives = 116/300 (38%), Gaps = 73/300 (24%)

Query: 134 NGKGKIFIYDRSKS--KSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASD---------- 181
           NG  +IF +++     +S  L K  + H      + FNP+ +  LLS  +          
Sbjct: 83  NGSIEIFKFNQENDSIQSNELIKN-NRHTGPIRSITFNPRQDNLLLSGGEGIINSSNSAK 141

Query: 182 ---------DTT--VALWDINSTDRPVSI------VMNHTDIVNDSKWHEFDENIFGTVS 224
                    +TT  + ++D+N  D P ++       MN  + ++   W++   ++F    
Sbjct: 142 TLPTINNIQNTTSEIFIYDLNDVDNPETLPMSPNMTMNRFETISSLAWNKSLSHVFSAAG 201

Query: 225 EDKTLQVHD---KRSLSNSAQVLPVEK-----------PLNALAFSKHSKN-----LIAA 265
               + + D   K+ + N   + P              P N+   +  + N     L A 
Sbjct: 202 NTSAVSIFDLKAKKEVINLNYINPTTGMKEIFSVVEWHPKNSTRIATATSNNISNPLNAT 261

Query: 266 AGTDTRVYLYDLRRLSEPL----------HTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
           A     +Y++DLR  + PL          +T+ GH D + S+++ +  +  L SSG D  
Sbjct: 262 ANAGDSIYIWDLRNSNAPLQILSPQQFENNTIVGHTDGIQSLDWCAQDETFLLSSGRDNS 321

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
           + +W            + D G+P  +  +    +      F P  P + ASA  D  ++V
Sbjct: 322 IMLW------------NPDSGLP--LTKYPKRNNWCFKSKFAPNFPEIFASASLDGKIEV 367

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 63/126 (50%), Gaps = 2/126 (1%)

Query: 185 VALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
           + LWD ++  RP++ +    D V+  K+++ + +IF +   D ++ ++D R+ S + + +
Sbjct: 196 INLWD-STRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFV 254

Query: 245 PVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKD 304
              +  NAL ++         A  D   Y YD+R LS  LH    H  AV  ++FS   D
Sbjct: 255 QKMRT-NALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGD 313

Query: 305 GILCSS 310
            I+  S
Sbjct: 314 EIVTGS 319

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 79/182 (43%), Gaps = 22/182 (12%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVND---SKWH-- 213
           H+D  Y +A N  +  +L +AS D  V  W++ ST   V     H  +++    +  H  
Sbjct: 66  HRDGVYTIAKNYHVLNKLATASADGVVKYWNM-STREEVCSFKAHYGLIHGLCVTPQHLS 124

Query: 214 -EFDENIFGTVSEDKTLQV-----HDKRSLSNSAQVLPVEKPL--------NALAFSKHS 259
              +EN   +  +D+T+++      D  S     +V+     L          L    H 
Sbjct: 125 QNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGEHAFLGIDHHR 184

Query: 260 KNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIW 319
            N     G    + L+D  R S P+  ++   D V++++F+ ++  I  S+GSD  + ++
Sbjct: 185 SNSNFVTG-GAEINLWDSTR-SRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLY 242

Query: 320 DL 321
           DL
Sbjct: 243 DL 244

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 84/210 (40%), Gaps = 14/210 (6%)

Query: 41  WPSLSIQWLPSVDANVPLKQQEMILGTHTSGDEN-NYLKIAAIDLPYEVVGLPDEDNSSE 99
           W   + + + S  A+  L     +   H S ++N NY+     D   ++  +  +D SSE
Sbjct: 95  WNMSTREEVCSFKAHYGLIHGLCVTPQHLSQNKNENYMLSCGDDRTVKLWSVNTDDFSSE 154

Query: 100 P-----VKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCK 154
                 +KS   + K F  E   +   +   N   +    G  +I ++D ++S+      
Sbjct: 155 RGDEEVIKSGNGLIKTFHGEHAFLGIDHHRSNSNFVT---GGAEINLWDSTRSRP---IT 208

Query: 155 TLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHE 214
            LS+  DN   + FN        SA  D +V L+D+  T+ P    +      N   W+ 
Sbjct: 209 NLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDL-RTNSPTQKFVQKMR-TNALCWNP 266

Query: 215 FDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
            +   F   +ED     +D R+LS +  V 
Sbjct: 267 MEAYNFVVANEDHNAYYYDMRNLSRALHVF 296

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 84/164 (51%), Gaps = 15/164 (9%)

Query: 166 LAFNPQIEGELLSA-SDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVS 224
           + F+P  +G+ L+A ++D  + +WDI +T + V I+  H   +    +    E +  + S
Sbjct: 463 VCFSP--DGKFLAAGAEDKLIRIWDI-TTKQIVMILKGHEQDIYSLDYFPSGEKLV-SGS 518

Query: 225 EDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD------LR 278
            DKT+++ D R+    +  L +E  +  ++ S ++   IAA   D    ++D      L+
Sbjct: 519 GDKTVRIWDLRT-GQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLK 577

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDL 321
           RL        GH+D++ S+ F+  KDG    SGS DR + +W+L
Sbjct: 578 RLDSQTDLQNGHKDSIYSVSFT--KDGKKLVSGSLDRSVKLWNL 619

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 81/213 (38%), Gaps = 63/213 (29%)

Query: 151 GLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD---------------- 194
           GLC T SY          +PQ E  +LS  DD TV LW +NS D                
Sbjct: 115 GLCVTPSY---------LSPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGI 165

Query: 195 -------------------------------------RPVSIVMNHTDIVNDSKWHEFDE 217
                                                +P+S +    D +N  ++++ + 
Sbjct: 166 IKTFHGEHAFQSLDHHRQKSNFVTGGAQIELWDTNRSKPISNLSWGADNINHVRFNQNEV 225

Query: 218 NIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
           +I  +   D ++ ++D R+ S + +++   +  N++ ++         A  D   Y YD+
Sbjct: 226 DILASTGSDNSVVLYDLRTNSPTQKIVQTMR-TNSICWNPVEAFNFVIANEDHNAYYYDM 284

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSS 310
           R +S+ LH    H  AV  ++FS   D ++  S
Sbjct: 285 RNMSKALHVFKDHVSAVMDVDFSPTGDEVVTGS 317

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 99/207 (47%), Gaps = 31/207 (14%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLS-ASDDTTVAL 187
           ++A   GK  IF+ + S  +   LC T     +N Y  + N    G  L+    +  V +
Sbjct: 277 LLAVALGKS-IFLTNNSNGEVIHLCDT-----ENEY-TSLNWVGSGSHLAVGQSNGIVEI 329

Query: 188 WDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSL--------SN 239
           +D+N   + +  ++ H+D V    W+ +   I  + S D  +   D RS         S+
Sbjct: 330 FDVNK-KKCIRTMLGHSDRVACLSWNSY---ILTSGSRDHNILHRDVRSPDPFFEKIESH 385

Query: 240 SAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEF 299
           S +V  ++  ++        +N + + G D  V +YD R  ++P  TM  H+ AV ++++
Sbjct: 386 SQEVCGLKWNVD--------ENKLVSGGNDNIVNVYD-RTSTKPFMTMTEHKAAVKALDW 436

Query: 300 SSHKDGILCSSG--SDRRLFIWDLTQI 324
           SSHK GIL + G  +DR L IW++  +
Sbjct: 437 SSHKRGILATGGGTADRHLKIWNVNNM 463

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 82/154 (53%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N ++E  +++ASDD T+ LWD   + +P++ +  H  +VN   +   D     + S D +
Sbjct: 366 NGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHVAFSP-DGRYIVSASFDNS 424

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR--RLSEPLHT 286
           +++ D R  +  A        +  +A+S   + L+ +   DT + ++D+R  +LS  L  
Sbjct: 425 IKLWDGRDGTFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTKKLSVDL-- 481

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GH+D V ++++S   DG  +CS+G D+ + IW
Sbjct: 482 -PGHKDEVYTVDWSV--DGKRVCSAGKDKMVRIW 512

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 76/167 (45%), Gaps = 14/167 (8%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD N T+ P+  +  H + V    W   D  +  T S D
Sbjct: 149 AFAPHTSSRMVTGAGDNTARIWDCN-TNTPMQTLKGHFNWVLCVAWSP-DGELIATGSMD 206

Query: 227 KTLQVHDKRSLSNSAQVLPVE-KPLNALAF------SKHSKNLIAAAGTDTRVYLYDL-R 278
            T+++       N    L    K + +L++          K  +A+A  D  + ++D  R
Sbjct: 207 NTIRLWQSEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDTAR 266

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           R+   L T++GH ++V+ +++     G+L S   D+ +  WD+   G
Sbjct: 267 RVC--LFTLSGHTNSVSCVKWGGR--GVLYSGSHDKTIRAWDMNAGG 309

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 91/214 (42%), Gaps = 36/214 (16%)

Query: 170 PQIEGELLSASDDTTVALWDINSTDRPVSI--VMNHTDIVNDSKWHEFDENIFGTVSEDK 227
           P  +  L SAS D T+ +WD   T R V +  +  HT+ V+  KW      +  + S DK
Sbjct: 244 PGDKPRLASASKDGTIKIWD---TARRVCLFTLSGHTNSVSCVKWG--GRGVLYSGSHDK 298

Query: 228 TLQVHDKRSLSNSAQVLPVEKP-LNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHT 286
           T++  D  +      +L      +N L+ S      + A       + +  ++ S P   
Sbjct: 299 TIRAWDMNAGGKCINILKSHAHWINHLSLSTDYALRVGA-------FDHTGKKPSSPEEA 351

Query: 287 MAGHQDAVTSIEFSSHKDG----ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
            A    A+ + E  + K+G    ++ ++  D  +++WD  +               + + 
Sbjct: 352 RA---KALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIK-------------STKPIT 395

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
              GH+  +N  +F+P   +++ SA  DN +++W
Sbjct: 396 RMTGHQKLVNHVAFSPDGRYIV-SASFDNSIKLW 428

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 87/204 (42%), Gaps = 45/204 (22%)

Query: 214 EFDENIFGTV-------SEDKTLQVHDKRSLSNSAQVLPVEKPLNALA----------FS 256
           +  +NI+ ++       +ED    V+  R++    +V PV +  +A+A          F+
Sbjct: 95  DIKDNIYNSILKPGYKTTEDFITIVYTPRAV---FKVRPVTRSSSAIAGHGSTILCSAFA 151

Query: 257 KHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRR 315
            H+ + +     D    ++D    + P+ T+ GH + V  + +S   DG L ++GS D  
Sbjct: 152 PHTSSRMVTGAGDNTARIWDCN-TNTPMQTLKGHFNWVLCVAWSP--DGELIATGSMDNT 208

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP-------QVPWLIASAE 368
           + +W        +  E+  D +        GH   I   S+ P         P L ASA 
Sbjct: 209 IRLWQ------SEKGENFGDAL-------RGHSKWITSLSWEPIHLVKPGDKPRL-ASAS 254

Query: 369 EDNVVQVWKISKKLVSNIIPEYTD 392
           +D  +++W  ++++    +  +T+
Sbjct: 255 KDGTIKIWDTARRVCLFTLSGHTN 278

>YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}
           PEX7Peroxisomal signal receptor for the N-terminal
           nonapeptide signal (PTS2) of peroxisomal matrix
           proteins; WD repeat protein; defects in human homolog
           cause lethal rhizomelic chondrodysplasia punctata (RCDP)
          Length = 375

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 123/281 (43%), Gaps = 42/281 (14%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSY-HKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           G GK+FI +  +S    + +  S+  +D  + LA+N   E ++L A  D T+ L+D    
Sbjct: 36  GNGKLFILEIDRSGR--IVEVNSFLTQDCLFDLAWNESHENQVLVAQGDGTLRLFDTTFK 93

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD---KRSLSN-SAQVLPVEK- 248
           + P++I   H   V    W+  +   F + S D ++++     K+SL   + + L + K 
Sbjct: 94  EFPIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKM 153

Query: 249 --PLNAL--------------------AFSKHSKNLIAAAGTDTRVYLYDLRRLS---EP 283
             PLNA+                     FS H +NL+ +   ++   L+D+R  S   + 
Sbjct: 154 VDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQN 213

Query: 284 LHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMM 343
              +    +A+T  +F+ ++  ++ + G D  + IWD+  +   ++       VP  +  
Sbjct: 214 NFLVHSGLEALT-CDFNKYRPYVVATGGVDNAIRIWDIRMLNKNESAT-IKRTVPGQLHN 271

Query: 344 HA-------GHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
            +        H  AI   +++P    ++ SA  D   ++W+
Sbjct: 272 SSCINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRIWR 312

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 103/239 (43%), Gaps = 22/239 (9%)

Query: 138 KIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPV 197
           K+F Y+++   S     TL  H+     +  +P +   L S+S D T  LWDI    + +
Sbjct: 256 KVFGYEKNDLTS---IDTLKGHQGRVSDVKLHP-LGKYLGSSSFDNTWRLWDIEKK-KEI 310

Query: 198 SIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSK 257
            +   H+  +    +H  D ++  T   D    + D RS  N   ++   KP+ +L ++ 
Sbjct: 311 LLQEGHSKEIFSLAFHT-DGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAP 369

Query: 258 HSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF 317
           +   L   +G D  + ++DLR       ++  H++ VTS+++  +  G + S+G D+ + 
Sbjct: 370 NGYQLATGSG-DGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIK 428

Query: 318 IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
           I               D    E +    GH   I     +P +  LI S+  D  V++W
Sbjct: 429 I--------------HDSKTYESVATLEGHTEKILTLDTSP-ISNLIVSSGWDRTVKIW 472

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 82/164 (50%), Gaps = 8/164 (4%)

Query: 159 HKDNGYGLAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDE 217
           H    + LAF+   +G L  +A  D+   +WD+ S    ++++  H   +    W     
Sbjct: 316 HSKEIFSLAFHT--DGSLTATAGFDSIGMIWDLRSGKNIMNLI-GHAKPIYSLDWAPNGY 372

Query: 218 NIFGTVSEDKTLQVHDKRSL-SNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD 276
            +  T S D T+++ D R+  SN A +   +  + ++ + K++   + +AG D  + ++D
Sbjct: 373 QL-ATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHD 431

Query: 277 LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWD 320
             +  E + T+ GH + + +++ +S    ++ SSG DR + IWD
Sbjct: 432 -SKTYESVATLEGHTEKILTLD-TSPISNLIVSSGWDRTVKIWD 473

>TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.356
           YLR196W
          Length = 563

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 82/173 (47%), Gaps = 14/173 (8%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           ++H D    L  N Q    L S S D TV LWD+NS     S+   H+   V+ S+WH  
Sbjct: 269 THHTDAVLSLTHNKQFRSVLASTSADHTVKLWDLNSATAARSMASIHSGKNVSSSEWHTT 328

Query: 216 DENIFGTVSEDKTLQVHDKR-----SLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDT 270
           + ++  T   D  + + D R      +S    V+P E  +  + F+  +   I   GTD+
Sbjct: 329 NGSVLLTGGYDSRIALSDVRIPDETKMSKYWSVVPGED-VETVTFADEN---IMLCGTDS 384

Query: 271 -RVYLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
             +Y +D+R    S+P+ T+  H   ++S+  + +  G++ +    ++ + +W
Sbjct: 385 GNIYSFDIRNNENSKPVWTLKAHDAGISSLCANRYIPGLMSTGAMGEKTVKLW 437

>Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247C -
           Hypothetical ORF [contig 164] FULL
          Length = 418

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 80/180 (44%), Gaps = 29/180 (16%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           ++S+S DTT  +WD+ S +   + ++ H   V D K+      +F +   D +++V D R
Sbjct: 181 IISSSIDTTCTVWDLQSPNYVKTQLIAHDSEVYDVKFLAQSTQLFASCGGDGSVRVFDLR 240

Query: 236 SLSNSAQVL-PVEKPLNALAFSKHSK--------------------------NLIAAAGT 268
           SL++S  +  P  +    L+ S+ S                           N++A    
Sbjct: 241 SLAHSTIIYEPNGQSAATLSQSQDSGGASGTSRDGSNSDNALLRLEPSPFDPNVVATFAH 300

Query: 269 D-TRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL-TQIGA 326
           D + V + D+R     + T+ GH  AV  I++   +  +L +   D +  +WDL TQ+ A
Sbjct: 301 DSSNVLILDMRYPGAAVLTLEGHSGAVNQIQWHQSRQNVLITCADDCQALLWDLNTQLTA 360

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 61/146 (41%), Gaps = 29/146 (19%)

Query: 108 TKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD-RSKSKSEGL-------CKTLSYH 159
           T+   H+ EV   +++ ++ ++ A+  G G + ++D RS + S  +         TLS  
Sbjct: 203 TQLIAHDSEVYDVKFLAQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPNGQSAATLSQS 262

Query: 160 KDNGYGLA-------------------FNPQIEGELLSASDDTTVALWDINSTDRPVSIV 200
           +D+G                       F+P +      A D + V + D+      V  +
Sbjct: 263 QDSGGASGTSRDGSNSDNALLRLEPSPFDPNVVATF--AHDSSNVLILDMRYPGAAVLTL 320

Query: 201 MNHTDIVNDSKWHEFDENIFGTVSED 226
             H+  VN  +WH+  +N+  T ++D
Sbjct: 321 EGHSGAVNQIQWHQSRQNVLITCADD 346

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 37/77 (48%)

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
           P+++  ++K   NLI ++  DT   ++DL+  +     +  H   V  ++F +    +  
Sbjct: 167 PVSSFHWNKIDPNLIISSSIDTTCTVWDLQSPNYVKTQLIAHDSEVYDVKFLAQSTQLFA 226

Query: 309 SSGSDRRLFIWDLTQIG 325
           S G D  + ++DL  + 
Sbjct: 227 SCGGDGSVRVFDLRSLA 243

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 98/214 (45%), Gaps = 19/214 (8%)

Query: 113 HEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQI 172
           HE  V++ ++ P +D+ +A+ +      ++D  +     L +    H    Y L F  Q 
Sbjct: 267 HEGRVVKVKFHP-SDRYVASASFDMTWRLWDVERQVELQLQEG---HAKEVYCLDF--QC 320

Query: 173 EGELL-SASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV 231
           +G LL SA  D+   +WD+ S  + + I+  H   +    W     ++  T S D T++V
Sbjct: 321 DGSLLCSAGLDSIGRIWDMRSG-QSLMILEGHAKPIYGVSWSPNGHHV-ATGSADGTVKV 378

Query: 232 HDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD----LRRLSEPLHTM 287
            D R + N   +L     ++ + F K S   + ++  D  V ++     LR     L ++
Sbjct: 379 WDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLR-----LASL 433

Query: 288 AGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
            GH D V SI+ S H    L SSG DR + +W L
Sbjct: 434 KGHTDKVMSIDIS-HDFSHLYSSGWDRSVKLWKL 466

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 71/206 (34%), Gaps = 63/206 (30%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           L++   D  V +W  +S +   +++  H   V   K+H  D                   
Sbjct: 240 LVTGGADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDR------------------ 281

Query: 236 SLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVT 295
                                      +A+A  D    L+D+ R  E L    GH   V 
Sbjct: 282 --------------------------YVASASFDMTWRLWDVERQVE-LQLQEGHAKEVY 314

Query: 296 SIEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDF 354
            ++F    DG +LCS+G D    IWD+                 + +M+  GH   I   
Sbjct: 315 CLDFQC--DGSLLCSAGLDSIGRIWDMRS--------------GQSLMILEGHAKPIYGV 358

Query: 355 SFNPQVPWLIASAEEDNVVQVWKISK 380
           S++P     +A+   D  V+VW I K
Sbjct: 359 SWSPNGH-HVATGSADGTVKVWDIRK 383

>Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON}
           YDR142C (REAL)
          Length = 376

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 122/282 (43%), Gaps = 44/282 (15%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD 194
           G GK++I +  +        +    +D  + +A+N   E ++L A  D T+ L+D    +
Sbjct: 36  GNGKLYILEIGREGKIAEVNSF-LTQDCLFDVAWNESHENQVLVAQGDGTLRLFDTTLKE 94

Query: 195 RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD---KRSL-SNSAQVLPVEK-- 248
            P++I   H   V    W+  +   F + S D ++++     K+SL S + + L + K  
Sbjct: 95  FPIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMSLTPRPLEITKMV 154

Query: 249 -PLNAL--------------------AFSKHSKNLIAAAGTDTRVYLYDLRR-LSEPLHT 286
            PLNA+                     FS H  NL+ +   ++   L+D+R   S+  + 
Sbjct: 155 DPLNAILLNKKNHTGISKNKNCVYQAQFSPHDPNLVISCSGNSYASLFDIRLPPSKNQNN 214

Query: 287 MAGHQ--DAVTSIEFSSHKDGILCSSGSDRRLFIWD---LTQIGAE------QAQEDADD 335
              H   +A+T  +F+ ++  ++ + G D  + IWD   LT  G+       Q Q     
Sbjct: 215 FLVHSGLEALT-CDFNKYRPYVVATGGVDNAIRIWDIRMLTTNGSATNNRTTQNQTHNPS 273

Query: 336 GVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
            + E++  H     AI   S++P    ++ SA  D   ++W+
Sbjct: 274 CINEIINAHG---LAIRKVSWSPHHSNILMSASYDMTCRIWR 312

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 107/239 (44%), Gaps = 28/239 (11%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H+ IV
Sbjct: 7   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIV 66

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D      D     + S DKT+++ D  +     + +  +  + ++A  + + ++I +  
Sbjct: 67  QDCA-LTADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAIDRKA-SMIISGS 124

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSH----KDGI-LCSSGSDRRLFIWDLT 322
            D  + ++ ++   E L TM GH D V+ +  + +     D + + S+GSD+ +  W++ 
Sbjct: 125 RDKTIKVWSIK--GECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNVN 182

Query: 323 QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
           Q      Q DAD           GH + IN    +P    LIASA +D  + +W +++K
Sbjct: 183 QF-----QIDAD---------FIGHNNYINAIVASPDGS-LIASAGKDGEIMMWDLAQK 226

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 84/199 (42%), Gaps = 27/199 (13%)

Query: 177 LSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS 236
           LSAS D T+ LWD+++ +     V +  D+++ +   +    I G  S DKT++V   + 
Sbjct: 79  LSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAIDRKASMIISG--SRDKTIKVWSIKG 136

Query: 237 -----------LSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLH 285
                        +  +V P +KP       +     + +AG+D  V  +++ +      
Sbjct: 137 ECLATMLGHNDWVSQVRVAPNDKP-------EDDTVTVISAGSDKVVKSWNVNQFQIDAD 189

Query: 286 TMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGV-----PEL 340
            + GH + + +I  +S    ++ S+G D  + +WDL Q  A       D+       P  
Sbjct: 190 FI-GHNNYINAI-VASPDGSLIASAGKDGEIMMWDLAQKRALYTLSAHDEVFALAFSPNR 247

Query: 341 MMMHAGHRSAINDFSFNPQ 359
             + A   S I  FS  PQ
Sbjct: 248 YWLAAATSSGIKIFSLEPQ 266

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 84/382 (21%), Positives = 147/382 (38%), Gaps = 82/382 (21%)

Query: 30  MYDFVSETKLTWPSLSIQWLPSV----DANVPLKQQEMILGTHTSGD---ENNYLKIAAI 82
           +Y+ +    + WP L++  +P        N P   Q ++L T T      EN  + +A  
Sbjct: 116 VYEMLHNVNMPWPCLTLDVIPDTLGTERRNYP---QSILLTTATQSSRKKENELMVLALS 172

Query: 83  DLPYEVVGL----------------PDEDNSSEPVK---SMIKVTKKFEHEDEVIRARYM 123
           +L   ++                  P  +N + P++   + +KV+       EV+ A   
Sbjct: 173 NLTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMS 232

Query: 124 PKNDKIIATINGKGKIFI---YDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIE-GELLSA 179
              D  I  +  + K F    Y   KS    +    ++    GYGL ++P I+ G LLS 
Sbjct: 233 ENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSG 292

Query: 180 SDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSN 239
                + L               HT     S+W          V++ ++  V +  S+ +
Sbjct: 293 DCSGQIYL------------TQRHT-----SRW----------VTDKQSFTVSNNESIED 325

Query: 240 SAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIE 298
                        + +S+    + A A  D  + ++D R +  +P  ++      V  I 
Sbjct: 326 -------------IQWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 372

Query: 299 FSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFN 357
           +S  K G L +SG D   + +WDL Q        +AD   P  +  +  H+ AI   +FN
Sbjct: 373 WSD-KIGYLLASGDDNGTWGVWDLRQF----TPSNADTVQP--VAQYDFHKGAITSIAFN 425

Query: 358 PQVPWLIASAEEDNVVQVWKIS 379
           P    ++A   EDN V +W +S
Sbjct: 426 PLDESIVAVGSEDNTVTLWDLS 447

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 83/172 (48%), Gaps = 12/172 (6%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           S+H D    L+ N      L S S D TV LWD+NS +   S+   H +  V+ S+WH  
Sbjct: 286 SHHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSGNAARSMASIHNNKNVSSSQWHHG 345

Query: 216 DENIFGTVSEDKTLQVHDKRSLSNSAQV-----LPVEKPLNALAFSKHSKNLIAAAGTDT 270
           + +I  T   D  + + D R +SN  ++     +   + +  + F+   +N+I A     
Sbjct: 346 NGSILLTGGYDSRIALTDVR-ISNENEMSKYWSVSNGEEVETVIFA--DENIILAGTDSG 402

Query: 271 RVYLYDLRR--LSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
            +Y +D+R    S+P+ T+  H   ++S+  ++   G++ +    ++ + +W
Sbjct: 403 NIYSFDIRNNAGSKPVWTLKAHDAGISSLSVNNFIPGLMSTGAMGEKAVKLW 454

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 2/132 (1%)

Query: 179 ASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLS 238
           A+    + LWD+N   +PVS +    D +   K+++ + +I  +   D ++ ++D R+ S
Sbjct: 195 ATGGAKIQLWDVNRV-KPVSNLSWGADNITSVKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
            + +++   +  NA+ ++         A  D   Y YD+R LS  L+    H  AV  ++
Sbjct: 254 PTQKIVQTMR-TNAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 299 FSSHKDGILCSS 310
           FS   D I+  S
Sbjct: 313 FSPTGDEIVTGS 324

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 90/187 (48%), Gaps = 27/187 (14%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIV---------ND 209
           H+D  Y +A N     +L + S D  +  W++++ +  VS   ++  I          +D
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHD 125

Query: 210 SKWHEFDENIFGTVSEDKTLQV--------HDKRSLSNSAQVLPVEKPLNAL----AFS- 256
            K    ++N   + S+DKT+++         +KRS  N + V+  E  +       AF  
Sbjct: 126 KKPDLKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDS-VINEEGLVRTFDGESAFQG 184

Query: 257 --KHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDR 314
              H  N   A G   ++ L+D+ R+ +P+  ++   D +TS++F+ ++  IL S+GSD 
Sbjct: 185 IDSHRVNSTFATG-GAKIQLWDVNRV-KPVSNLSWGADNITSVKFNQNETDILASTGSDN 242

Query: 315 RLFIWDL 321
            + ++DL
Sbjct: 243 SIVLYDL 249

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 102/260 (39%), Gaps = 23/260 (8%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD 194
           G  KI ++D ++ K       LS+  DN   + FN      L S   D ++ L+D+ +  
Sbjct: 197 GGAKIQLWDVNRVKP---VSNLSWGADNITSVKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 195 RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE-KPLNAL 253
               IV   T   N   W+  +   F   +ED     +D R+LS S  V       +  +
Sbjct: 254 PTQKIV--QTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDV 311

Query: 254 AFSKHSKNLIAAA-GTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS 312
            FS     ++  +     R+Y  +     E  HT       V  +++S   D     SGS
Sbjct: 312 DFSPTGDEIVTGSYDKSIRIYNTNHGHSREIYHTK--RMQHVFQVKYSM--DAKYIISGS 367

Query: 313 DR------RLFIWDLTQIGA--EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
           D       R   W+ + +    E+ + + D+ + E       H   I   S +  VP +I
Sbjct: 368 DDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFR----HMPEIKRISRHRHVPEVI 423

Query: 365 ASAEEDNVVQVWKISKKLVS 384
             A+E   +++  I ++ V+
Sbjct: 424 KKAQEIKNIELSSIKRREVN 443

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 96/214 (44%), Gaps = 35/214 (16%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW----HEFDEN---------IFGT 222
           LL+AS+D T+  W+I    +P S  M    ++  S++    HE D N         +F T
Sbjct: 488 LLTASNDLTIKKWNI---PKP-SDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFAT 543

Query: 223 VSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSE 282
            S DKT ++ D  +   +A +   ++ L  ++F ++ K L+A    D  + ++ L   S 
Sbjct: 544 ASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDK-LLATCSGDKTIKIWSLDTFS- 601

Query: 283 PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
            + T+ GH +AV    F  +K   L SSG+D  + IWD +     +  +   + +  L +
Sbjct: 602 VVRTLEGHTNAVQRCHF-INKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTI 660

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
              G                LIASA+ D V Q W
Sbjct: 661 QRDGE---------------LIASADADGVFQFW 679

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 98/225 (43%), Gaps = 20/225 (8%)

Query: 175 ELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDK 234
           + ++ SDD  + +W+ ++  +   +  +H D V    WH     +  + S+D  +++ D 
Sbjct: 177 KFVTCSDDNVLKIWNFSNGQQERVLSGHHWD-VKSCDWHP-KMGLIVSGSKDNLIKLWDP 234

Query: 235 RSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAV 294
           R+  N + +L ++  +    F     NL+A    D  + +YD+R+    L T+    D +
Sbjct: 235 RTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYM 294

Query: 295 TSIEFSSHKDGIL---CSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAI 351
            S+ +    + I    C +G+ +     DL          D  +  P    +   H  ++
Sbjct: 295 -SLSWHPINETIFSVGCYNGAIKHF---DLLH--------DNSNSTPACHTIPYAHEKSV 342

Query: 352 NDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
              +++P V  ++ASA +D  ++ W  S+ +  N    P Y + K
Sbjct: 343 TSLAYSP-VGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKK 386

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 108/221 (48%), Gaps = 29/221 (13%)

Query: 166 LAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVM--NHTDIVNDSKWHEFDENIFGT 222
           + F+P  +GE L + ++D  + +W+I   +R + +V+  +  DI +   + +  + + G 
Sbjct: 347 ICFSP--DGEFLATGAEDKLIRIWNIK--ERKIVMVLKGHEQDIYSLDYFPDGQKLVSG- 401

Query: 223 VSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD------ 276
            S D+++++ D ++    +  L +E  +  +A S +   LIAA   D  V ++D      
Sbjct: 402 -SGDRSIRIWDLKT-GQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFL 459

Query: 277 LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDLTQIGAEQAQEDADD 335
           + RL     +  GHQD+V S+ F+  KDG    SGS DR + +W+L          D   
Sbjct: 460 VERLDSDNESGNGHQDSVYSVAFT--KDGQHVVSGSLDRTVKLWNLG---------DTQS 508

Query: 336 GVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
           G  +  + + GH+  +   + +    ++ + +++  V+ +W
Sbjct: 509 GTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVI-IW 548

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 109/250 (43%), Gaps = 36/250 (14%)

Query: 148 KSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIV 207
           K   +   L  H+ + Y L + P  + +L+S S D ++ +WD+ +     S+ ++  D V
Sbjct: 371 KERKIVMVLKGHEQDIYSLDYFPDGQ-KLVSGSGDRSIRIWDLKTGQ--CSLTLSIEDGV 427

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHD-------KRSLSNSAQVLPVEKPLNALAFSKHSK 260
                   +  +    S D+++++ D       +R  S++      +  + ++AF+K  +
Sbjct: 428 TTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQ 487

Query: 261 NLIAAAGTDTRVYLYDLRRLSEPLH----TMAGHQDAVTSIEFSSHKDGILCSSGSDRRL 316
           ++++ +  D  V L++L            T  GH+D V S+  +S+ D  + S   DR +
Sbjct: 488 HVVSGS-LDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVA-TSNDDKYIFSGSKDRGV 545

Query: 317 FIWDLTQIGAEQAQEDADDGVPELMMMHAGHR-SAINDFSFNPQVP-----WLIASAEED 370
            IW            D D G P LM+   GHR S I+  + N  V       L A+   D
Sbjct: 546 IIW------------DKDSGNPILMLQ--GHRNSVISVATVNSNVDDGKNYKLFATGSGD 591

Query: 371 NVVQVWKISK 380
              ++WK  K
Sbjct: 592 CKARIWKYFK 601

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 74/328 (22%), Positives = 131/328 (39%), Gaps = 73/328 (22%)

Query: 113 HEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAF---- 168
           H + V+   + P + ++IAT +    I +++ SK K  G    L  H      L++    
Sbjct: 185 HHNWVLCCSWSP-DGELIATGSMDNTIRLWESSKGKPYG--DALRGHSKWITSLSWEPIH 241

Query: 169 --NPQIEGELLSASDDTTVALWDINSTDRPVSIV--MNHTDIVNDSKWHEFDENIFGTVS 224
              P  +  L +AS D T+ +WD   T R V ++    HT  V+  KW    +N+  + S
Sbjct: 242 LVKPGDKPRLATASKDGTIKIWD---TTRRVCLLTLCGHTSSVSCVKWG--GKNVLYSGS 296

Query: 225 EDKTLQVHDKRSLSNSAQVL--------------------------------PVEKPLNA 252
            DKT++  D         +L                                P E    A
Sbjct: 297 HDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKA 356

Query: 253 LA-FSKHSKN------LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG 305
           L  + K +K       L+  A  D  +YL++  + ++P+  M GHQ  V  + FS   DG
Sbjct: 357 LKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP--DG 414

Query: 306 -ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
             + S+  D  + +W            D  DG  + +    GH +++   +++     L+
Sbjct: 415 RYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAWSSDCR-LL 459

Query: 365 ASAEEDNVVQVWKISKKLVSNIIPEYTD 392
            S  +D  ++VW +  + +S  +P + D
Sbjct: 460 VSCSKDTTLKVWDVKTRKLSVDLPGHQD 487

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 75/175 (42%), Gaps = 30/175 (17%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD ++  R  ++  +H  ++  S W   D  +  T S D
Sbjct: 150 AFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCS-WSP-DGELIATGSMD 207

Query: 227 KTLQV---------------HDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTR 271
            T+++               H K   S S + + + KP +        K  +A A  D  
Sbjct: 208 NTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGD--------KPRLATASKDGT 259

Query: 272 VYLYD-LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           + ++D  RR+   L T+ GH  +V+ +++      +L S   D+ +  WD+   G
Sbjct: 260 IKIWDTTRRVC--LLTLCGHTSSVSCVKWGGKN--VLYSGSHDKTIRCWDMNLNG 310

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 111/299 (37%), Gaps = 91/299 (30%)

Query: 99  EPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSY 158
           E ++S+ KV K   H   V   R+  K   ++ +   +G+I+++D +K  ++G       
Sbjct: 92  EELRSVAKVKK---HTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQG------- 141

Query: 159 HKDNGYGLAFNPQIEGELL-----------SASDDTTVALWDIN--------STDRPVSI 199
           +   G G+A  P  E + L           SA      ++WD+         S   P S 
Sbjct: 142 YSPFGPGVAMTPIEEVQSLAWNQTLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPTSG 201

Query: 200 VMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHS 259
           + N   +V   +WH                        SNS +V                
Sbjct: 202 LKNQLSVV---EWHP-----------------------SNSTKV---------------- 219

Query: 260 KNLIAAAGTDTR--VYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRL 316
                A G D    + ++DLR  + PL  ++ GH   + S+++    D ++ SSG D   
Sbjct: 220 ---ATATGNDNEPVILVWDLRNSNAPLKVLSQGHSKGILSLDWCQQDDKLMISSGRDNTC 276

Query: 317 FIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
            +W+      E+AQ+         +       +      F P+ P L ASA  DN VQV
Sbjct: 277 ILWN-----PEEAQK---------LTQFPTRGNWCFKTKFAPEAPDLFASASFDNKVQV 321

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 64/125 (51%), Gaps = 2/125 (1%)

Query: 199 IVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNA-LAFSK 257
           ++  H+  + D  +H  +  I  T S D  +   D RS   +     V     A + ++ 
Sbjct: 109 VLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWNF 168

Query: 258 HSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLF 317
            + N++A+A ++  ++++DLR+   PLH + GH ++V SI+FS   +  + SS +D  + 
Sbjct: 169 KNPNVMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVK 227

Query: 318 IWDLT 322
            WD +
Sbjct: 228 FWDYS 232

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 79/197 (40%), Gaps = 20/197 (10%)

Query: 113 HEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAF-NPQ 171
           H   +    + P N +I+AT +    +  +D   S+      ++           F NP 
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWNFKNPN 172

Query: 172 IEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQ- 230
           +    ++++    + +WD+     P+ I+  H + VN   +  F+E    + S D T++ 
Sbjct: 173 V----MASAHSNDIFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKF 228

Query: 231 ----VHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLY------DLRRL 280
               V+DK  L       PV K    L F +    ++   G +  VYL       D   +
Sbjct: 229 WDYSVNDKEPLRTVVTDFPVSKG-RYLPFGR-GFCVMPMTGGNNSVYLSSSTTSNDSGPI 286

Query: 281 S--EPLHTMAGHQDAVT 295
           S  +P++   GH D V+
Sbjct: 287 SKFQPIYVFKGHADRVS 303

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 68/140 (48%), Gaps = 21/140 (15%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRR-LSEP--LHTMAGHQDAVTSIEFS 300
           L V+   NA++ S   ++++ A+     +Y+ DL    S P  LH +   +  V  +++S
Sbjct: 21  LRVDGGFNAVSISPSGRDVVLASRQG--LYVVDLDDPFSAPRWLHHITPWE--VADVQWS 76

Query: 301 SH--KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP 358
            H  K   + S+ S+++  +W+L++  +   +           ++H GH  AI D +F+P
Sbjct: 77  PHPSKPSWVVST-SNQKALVWNLSRSSSNAVEH----------VLH-GHSRAITDINFHP 124

Query: 359 QVPWLIASAEEDNVVQVWKI 378
             P ++A+   D  V  W +
Sbjct: 125 TNPEILATCSIDAYVHAWDM 144

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 67/160 (41%), Gaps = 16/160 (10%)

Query: 222 TVSEDKTLQVHDKRSLSNSAQ--VLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRR 279
           + S  K L  +  RS SN+ +  +    + +  + F   +  ++A    D  V+ +D+R 
Sbjct: 87  STSNQKALVWNLSRSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDMRS 146

Query: 280 LSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPE 339
                ++ +        ++++     ++ S+ S+  +FIWDL +            G   
Sbjct: 147 SRRAFYSASVWSAGAAQVKWNFKNPNVMASAHSND-IFIWDLRK------------GCMP 193

Query: 340 LMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKIS 379
           L ++  GH +++N   F+      I S+  D  V+ W  S
Sbjct: 194 LHIL-KGHANSVNSIDFSRFNETEIMSSSNDGTVKFWDYS 232

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 107/238 (44%), Gaps = 27/238 (11%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLS S D T+  W +   D+    PV     H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D    + D     + S DKTL++ D  +     + +  +  + ++A  + + ++I +  
Sbjct: 69  QDCTLTQ-DGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKA-SMIISGS 126

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFS---SHKDGI-LCSSGSDRRLFIWDLTQ 323
            D  + ++ ++   + L T+ GH D V+ +  +    + D + + S+G+D+ +  W+L Q
Sbjct: 127 RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQ 184

Query: 324 IGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
                 Q +AD           GH   +N  + +P    LIASA +D  + +W +++K
Sbjct: 185 F-----QIEAD---------FVGHNGNVNAVTASPDGT-LIASAGKDGEIMLWNLAEK 227

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 84/193 (43%), Gaps = 16/193 (8%)

Query: 177 LSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS 236
           LSAS D T+ LWD+ + +     V + +D+++ +   +    I G  S DKT++V   + 
Sbjct: 81  LSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISG--SRDKTIKVWTIKG 138

Query: 237 LSNSAQVLPVEKPLNALAFSKHSKN----LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
               A +L     ++ +  +   +N     + +AG D  V  ++L +  +      GH  
Sbjct: 139 -QCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQF-QIEADFVGHNG 196

Query: 293 AVTSIEFSSHKDGIL-CSSGSDRRLFIWDLTQIGAEQAQEDADDGV-----PELMMMHAG 346
            V ++  ++  DG L  S+G D  + +W+L +  A       D+       P    + A 
Sbjct: 197 NVNAV--TASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPNRYWLAAA 254

Query: 347 HRSAINDFSFNPQ 359
             S I  F  +PQ
Sbjct: 255 TASGIKIFCLDPQ 267

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 2/132 (1%)

Query: 179 ASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLS 238
           A+    + LWD+N   +PVS +    D +   K+++ + +I  +   D ++ ++D R+ S
Sbjct: 195 ATGGAKIHLWDVNRL-KPVSNLSWGADNITSVKFNQSETDILASTGSDNSIVLYDLRTNS 253

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
            + +++   +  NA+ ++         A  D   Y YD+R LS  L+    H  AV  ++
Sbjct: 254 PTQKIVQTMR-TNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 299 FSSHKDGILCSS 310
           FS   D I+  S
Sbjct: 313 FSPTGDEIVTGS 324

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 90/186 (48%), Gaps = 25/186 (13%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI----VNDSKWHE 214
           H+D  Y +A N     +L + S D  +  W++++ +  VS   ++  I    V   ++H+
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPRFHD 125

Query: 215 F-----DENIFGTVSEDKTLQV-------------HDKRSLSNSAQVLPVEKPLNAL-AF 255
                 ++N   + S+DKT+++              D  S++N   ++      +A    
Sbjct: 126 KKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAFQGI 185

Query: 256 SKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
             H +N   A G   +++L+D+ RL +P+  ++   D +TS++F+  +  IL S+GSD  
Sbjct: 186 DSHRENSTFATG-GAKIHLWDVNRL-KPVSNLSWGADNITSVKFNQSETDILASTGSDNS 243

Query: 316 LFIWDL 321
           + ++DL
Sbjct: 244 IVLYDL 249

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 101/257 (39%), Gaps = 23/257 (8%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD 194
           G  KI ++D ++ K       LS+  DN   + FN      L S   D ++ L+D+ +  
Sbjct: 197 GGAKIHLWDVNRLKP---VSNLSWGADNITSVKFNQSETDILASTGSDNSIVLYDLRTNS 253

Query: 195 RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE-KPLNAL 253
               IV   T   N   W+  +   F T +ED     +D R+LS S  V       +  +
Sbjct: 254 PTQKIV--QTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDV 311

Query: 254 AFSKHSKNLIAAA-GTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS 312
            FS     ++  +     R+Y  +     E  HT       V  +++S   D     SGS
Sbjct: 312 DFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTK--RMQHVFQVKYSM--DAKYIISGS 367

Query: 313 DR------RLFIWDLTQIGA--EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
           D       R   W+ + +    E+ + + D+ + E       H   I   S +  VP +I
Sbjct: 368 DDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFR----HMPEIKRISRHRHVPQVI 423

Query: 365 ASAEEDNVVQVWKISKK 381
             A+E   +++  I ++
Sbjct: 424 KKAQEIKNIELNSIKRR 440

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 103/284 (36%), Gaps = 74/284 (26%)

Query: 107 VTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCK----TLSYHKDN 162
           V +   H   V   R+  K   +  +   +G+IF++D +K  + G       T     D 
Sbjct: 96  VARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPFGPGTAMTPIDE 155

Query: 163 GYGLAFNPQIEGELLSASDDTTVALWDIN--------STDRPVSIVMNHTDIVNDSKWHE 214
              LA+N  +     SA      ++WD+         S   P S + N   +V   +WH 
Sbjct: 156 VQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHSGLKNQLAVV---EWHP 212

Query: 215 FDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTR--V 272
                                  SNS +V                     A G D    +
Sbjct: 213 -----------------------SNSTRV-------------------ATATGNDNEPVI 230

Query: 273 YLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQE 331
            ++DLR  + PL  M+ GH   + S+++  H + ++ SSG D    +W+      E+AQ+
Sbjct: 231 LVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCILWN-----PEEAQK 285

Query: 332 DADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
                    +  +    +      F P+ P L ASA  DN +QV
Sbjct: 286 ---------LTQYPTRGNWCFKTKFAPEAPDLFASASFDNKIQV 320

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 28/62 (45%)

Query: 265 AAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQI 324
           A   +  V  +   R    +  +A H   V ++ F++ +  +  S GS   +F+WD  +I
Sbjct: 77  AGALENGVVEFFCARERRSVARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKI 136

Query: 325 GA 326
            A
Sbjct: 137 SA 138

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 105/246 (42%), Gaps = 42/246 (17%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHD-------KRSLSNSAQVLPVEKPLNALAFSKHSK 260
            D      D     + S DKTL++ D       +R + + + V+ V+    A        
Sbjct: 69  QDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA-------- 119

Query: 261 NLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-----ILCSSGSDRR 315
           ++I +   D  + ++ ++   + L T+ GH D V+ +    ++        + S+G+D+ 
Sbjct: 120 SMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKM 177

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
           +  W+L Q      Q +AD           GH S IN  + +P    LIASA +D  + +
Sbjct: 178 VKAWNLNQF-----QIEAD---------FIGHNSNINTLTASPDGT-LIASAGKDGEIML 222

Query: 376 WKISKK 381
           W ++ K
Sbjct: 223 WNLAAK 228

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 105/246 (42%), Gaps = 42/246 (17%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHD-------KRSLSNSAQVLPVEKPLNALAFSKHSK 260
            D      D     + S DKTL++ D       +R + + + V+ V+    A        
Sbjct: 69  QDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA-------- 119

Query: 261 NLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-----ILCSSGSDRR 315
           ++I +   D  + ++ ++   + L T+ GH D V+ +    ++        + S+G+D+ 
Sbjct: 120 SMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKM 177

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
           +  W+L Q      Q +AD           GH S IN  + +P    LIASA +D  + +
Sbjct: 178 VKAWNLNQF-----QIEAD---------FIGHNSNINTLTASPDGT-LIASAGKDGEIML 222

Query: 376 WKISKK 381
           W ++ K
Sbjct: 223 WNLAAK 228

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 105/246 (42%), Gaps = 42/246 (17%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHD-------KRSLSNSAQVLPVEKPLNALAFSKHSK 260
            D      D     + S DKTL++ D       +R + + + V+ V+    A        
Sbjct: 69  QDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA-------- 119

Query: 261 NLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-----ILCSSGSDRR 315
           ++I +   D  + ++ ++   + L T+ GH D V+ +    ++        + S+G+D+ 
Sbjct: 120 SMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKM 177

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
           +  W+L Q      Q +AD           GH S IN  + +P    LIASA +D  + +
Sbjct: 178 VKAWNLNQF-----QIEAD---------FIGHNSNINTLTASPDGT-LIASAGKDGEIML 222

Query: 376 WKISKK 381
           W ++ K
Sbjct: 223 WNLAAK 228

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 105/246 (42%), Gaps = 42/246 (17%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHD-------KRSLSNSAQVLPVEKPLNALAFSKHSK 260
            D      D     + S DKTL++ D       +R + + + V+ V+    A        
Sbjct: 69  QDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA-------- 119

Query: 261 NLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-----ILCSSGSDRR 315
           ++I +   D  + ++ ++   + L T+ GH D V+ +    ++        + S+G+D+ 
Sbjct: 120 SMIISGSRDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKM 177

Query: 316 LFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQV 375
           +  W+L Q      Q +AD           GH S IN  + +P    LIASA +D  + +
Sbjct: 178 VKAWNLNQF-----QIEAD---------FIGHNSNINTLTASPDGT-LIASAGKDGEIML 222

Query: 376 WKISKK 381
           W ++ K
Sbjct: 223 WNLAAK 228

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 25/185 (13%)

Query: 148 KSEGLCKT---------LSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVS 198
           K +GL KT         L +H++N   +    QI+             LWD N + +P+S
Sbjct: 162 KGDGLLKTYYGDHAFFGLDHHRNNSTFVTGGAQIQ-------------LWDANRS-KPIS 207

Query: 199 IVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKH 258
            +    D V   K+++ + +I  +   D ++ ++D R+ S + ++    +  NA+ ++  
Sbjct: 208 NLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIRQSMRT-NAICWNPM 266

Query: 259 SKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFI 318
                  A  D   Y YD+R +S  L+    H  AV  ++FS   D I+  S  D+ + I
Sbjct: 267 EAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGS-YDKTIRI 325

Query: 319 WDLTQ 323
           +   Q
Sbjct: 326 YKTNQ 330

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 96/210 (45%), Gaps = 11/210 (5%)

Query: 113 HEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQI 172
           HE  V + ++ P +D+ +A+ +      ++D  +   E   +    H    Y L F  Q 
Sbjct: 270 HEARVSKVKFHP-SDRFVASASFDMTWRLWDVER---ETELQLQEGHAKEVYCLDF--QC 323

Query: 173 EGELL-SASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQV 231
           +G LL SA  D+   +WD+  T R + ++  H   +    W     ++  T S D T+QV
Sbjct: 324 DGSLLCSAGLDSVGHVWDMR-TGRSLMVLEGHAKPIYGVSWSPNGHHV-ATGSGDGTVQV 381

Query: 232 HDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQ 291
            D R  +  + +L     ++ + F K + N + ++  D  + ++      + L ++ GH 
Sbjct: 382 WDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIK-LASLQGHT 440

Query: 292 DAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           D + S++  S     L SSG DR + IW L
Sbjct: 441 DKILSVDI-SRGGANLWSSGWDRSVKIWAL 469

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 76/183 (41%), Gaps = 25/183 (13%)

Query: 203 HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPV----EKPLNALAFSKH 258
           H D +    W   D  +  T   D  +++ + ++ S+S     V    E  ++ + F   
Sbjct: 224 HDDKIGGVAWSS-DSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHP- 281

Query: 259 SKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLF 317
           S   +A+A  D    L+D+ R +E L    GH   V  ++F    DG +LCS+G D    
Sbjct: 282 SDRFVASASFDMTWRLWDVERETE-LQLQEGHAKEVYCLDFQC--DGSLLCSAGLDSVGH 338

Query: 318 IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           +WD+                   +M+  GH   I   S++P     +A+   D  VQVW 
Sbjct: 339 VWDMR--------------TGRSLMVLEGHAKPIYGVSWSPNGH-HVATGSGDGTVQVWD 383

Query: 378 ISK 380
           I K
Sbjct: 384 IRK 386

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 107/238 (44%), Gaps = 27/238 (11%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLS S D T+  W +   D+    PV     H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D    + D     + S DKTL++ D  +     + +  +  + ++A  + + ++I +  
Sbjct: 69  QDCTLTQ-DGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKA-SMIISGS 126

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFS---SHKDGI-LCSSGSDRRLFIWDLTQ 323
            D  + ++ ++   + L T+ GH D V+ +  +    + D + + S+G+D+ +  W+L Q
Sbjct: 127 RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQ 184

Query: 324 IGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
                 Q +AD           GH   +N  + +P    LIASA +D  + +W +++K
Sbjct: 185 F-----QIEAD---------FVGHNGNVNTVTASPDGT-LIASAGKDGEIMLWNLAEK 227

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 85/193 (44%), Gaps = 16/193 (8%)

Query: 177 LSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS 236
           LSAS D T+ LWD+ + +     V + +D+++ +   +    I G  S DKT++V   + 
Sbjct: 81  LSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISG--SRDKTIKVWTIKG 138

Query: 237 LSNSAQVLPVEKPLNALAFSKHSKN----LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
               A +L     ++ +  +   +N     + +AG D  V  ++L +  +      GH  
Sbjct: 139 -QCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQF-QIEADFVGHNG 196

Query: 293 AVTSIEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGV-----PELMMMHAG 346
            V ++  ++  DG ++ S+G D  + +W+L +  A       D+       P    + A 
Sbjct: 197 NVNTV--TASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNRYWLAAA 254

Query: 347 HRSAINDFSFNPQ 359
             S I  F  +PQ
Sbjct: 255 TASGIKIFCLDPQ 267

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 95/215 (44%), Gaps = 36/215 (16%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW----HEFDEN---------IFGT 222
           LL+AS+D T+  W +    +P SI+     I+  S++    HE D N         IF T
Sbjct: 454 LLTASNDLTIKKWKV---PKPTSIM--DVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 508

Query: 223 VSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSE 282
            S DKT ++    +    A +   ++ L  ++F ++ K L+A +  D  V ++ L   S 
Sbjct: 509 ASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDK-LLATSSGDKTVKIWSLDTFS- 566

Query: 283 PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
            + T+ GH +AV    F  +K   L S G+D  + IWD +        +  ++ +  L  
Sbjct: 567 VMKTLEGHSNAVQRCSF-INKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNT 625

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           M+ G                +I SA+ D V Q WK
Sbjct: 626 MNDGD---------------MIVSADADGVFQFWK 645

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 94/213 (44%), Gaps = 25/213 (11%)

Query: 149 SEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-- 206
           S  L   +++  DN + L   P     LL +S + +V L D NS        +  T+I  
Sbjct: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 207 ---VNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLI 263
              +N+    +F+       +   +++++D R+    + V  ++   N++  S  S++ +
Sbjct: 61  LRVINN----DFENGCIFAATSLASVKIYDVRN--GDSPVATIKNDKNSVFLSLESRHDM 114

Query: 264 AAAGT-----DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLF 317
              GT     D  +++YD+R  S+P+      H D +T I+F      IL S  +D    
Sbjct: 115 LVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTN 174

Query: 318 IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSA 350
           I+DL       AQED D+ + +++   + H   
Sbjct: 175 IYDL-------AQEDEDEALHQVINYASIHSCG 200

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 88/186 (47%), Gaps = 25/186 (13%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIV---------ND 209
           H+D  Y +A N     +L + S D  +  W++++ +  VS   ++  I          +D
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHD 125

Query: 210 SKWHEFDENIFGTVSEDKTLQV-------------HDKRSLSNSAQVLPVEKPLNAL-AF 255
            K    ++N   + S+DKT+++              D  S++N   ++      +A    
Sbjct: 126 KKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQGI 185

Query: 256 SKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
             H +N   A G   +++L+D+ RL +P+  ++   D +TS+ F+ ++  IL S+GSD  
Sbjct: 186 DSHRENSTFATG-GAKIHLWDVNRL-KPISNLSWGADNITSVRFNQNETDILASTGSDNS 243

Query: 316 LFIWDL 321
           + ++DL
Sbjct: 244 IVLYDL 249

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 63/132 (47%), Gaps = 2/132 (1%)

Query: 179 ASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLS 238
           A+    + LWD+N   +P+S +    D +   ++++ + +I  +   D ++ ++D R+ S
Sbjct: 195 ATGGAKIHLWDVNRL-KPISNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
            + +++   +  NA+ ++         A  D   Y YD+R LS  L     H  AV  ++
Sbjct: 254 PTQKIVQTMRT-NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVD 312

Query: 299 FSSHKDGILCSS 310
           FS   D I+  S
Sbjct: 313 FSPTGDEIVTGS 324

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 47/110 (42%), Gaps = 5/110 (4%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD 194
           G  KI ++D ++ K       LS+  DN   + FN      L S   D ++ L+D+ +  
Sbjct: 197 GGAKIHLWDVNRLKP---ISNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 195 RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
               IV   T   N   W+  +   F T +ED     +D R+LS S  V 
Sbjct: 254 PTQKIV--QTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVF 301

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 93/215 (43%), Gaps = 36/215 (16%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW----HEFDEN---------IFGT 222
           LL+AS+D T+  W I    +P S   N   I+  S++    HE D N         IF T
Sbjct: 455 LLTASNDLTIKKWKI---PKPTS--TNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 509

Query: 223 VSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSE 282
            S DKT ++ +  +    A +   ++ L  ++F ++ K L+A    D  V ++ L   S 
Sbjct: 510 ASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDK-LLATCSGDKTVKIWSLETFS- 567

Query: 283 PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMM 342
            + T+ GH +AV    F  +K   L S G+D  + IWD       +  +  ++ +  L  
Sbjct: 568 VMKTLEGHTNAVQRCSF-INKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNT 626

Query: 343 MHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           M+ G                 I SA+ D + Q WK
Sbjct: 627 MNDGDT---------------IVSADADGIFQFWK 646

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 346 GHRSAINDFSFNPQVP---WLIASAEEDNVVQVWKISKKLVSNIIPEYT 391
           GH   I+   F  Q+    WL+AS + + +V+VW + K+   + + E+T
Sbjct: 142 GHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEHT 190

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 99/221 (44%), Gaps = 29/221 (13%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDEN 218
           H+    G+ F+P  +   +SA DD T+ +W +  T++ +  +  H D V    +H+    
Sbjct: 52  HEGPVRGIDFHP-TQPLFVSAGDDYTIKVWSL-ETNKCLYTLDGHLDYVRTVFFHKELPW 109

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
           I  + S+D+T+++ + ++    A +      +    F   +++LI +A  D  V ++D+ 
Sbjct: 110 II-SASDDQTIRIWNWQNRKEIACITGHNHFVMCAQFHP-TEDLIVSASLDETVRVWDIS 167

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVP 338
           +L E  H+  G     TS E                        +I A+Q   D   G  
Sbjct: 168 KLREK-HSAPGRSAMPTSFE-----------------------EKIAAQQNLLDGGFGDC 203

Query: 339 ELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKIS 379
            +  +  GH   +N  SF+P +P LI S  +D  V++WK+S
Sbjct: 204 TVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKMS 243

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 18/134 (13%)

Query: 247 EKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGI 306
           E P+  + F   ++ L  +AG D  + ++ L   ++ L+T+ GH D V ++ F      I
Sbjct: 53  EGPVRGIDFHP-TQPLFVSAGDDYTIKVWSLET-NKCLYTLDGHLDYVRTVFFHKELPWI 110

Query: 307 LCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIAS 366
           + +S  D+ + IW+       Q +++        +    GH   +    F+P    LI S
Sbjct: 111 ISAS-DDQTIRIWNW------QNRKE--------IACITGHNHFVMCAQFHPTED-LIVS 154

Query: 367 AEEDNVVQVWKISK 380
           A  D  V+VW ISK
Sbjct: 155 ASLDETVRVWDISK 168

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDR-PVSIVMNHTDIVNDSKWHEFDENIFGTVSE 225
           +F+P +   ++S  DD  V LW +++T    +     HT+ V+   +H   +N+  +V E
Sbjct: 220 SFHPTLP-LIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHP-TQNLILSVGE 277

Query: 226 DKTLQVHD 233
           DKTL+V D
Sbjct: 278 DKTLRVWD 285

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 253 LAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG 311
           + FS+    + A+ G D  + ++D R +  +P  ++      V  I ++  K G L +SG
Sbjct: 338 IQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWN-EKIGYLLASG 396

Query: 312 SDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEED 370
            D   + +WDL Q     A   +       +  +  H+ AI   SFNP    +IA A ED
Sbjct: 397 DDNGSWGVWDLRQFSPNTAASTSP------VAQYNFHKGAITSISFNPLDDSIIAVASED 450

Query: 371 NVVQVWKIS 379
           N V +W +S
Sbjct: 451 NTVSLWDLS 459

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 97/208 (46%), Gaps = 12/208 (5%)

Query: 116 EVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGE 175
           E +R       D    T +    + I++ S  K E   + L+ H  +     ++P++ G 
Sbjct: 168 ECLRDISFSNTDSKFVTCSDDNILKIWNFSNGKQE---RILTGHHWDVKSCDWHPEM-GL 223

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           ++S S D  V  WD  S  + VS ++N    V  +++     N    +S+DK+ +V D R
Sbjct: 224 IVSGSKDNLVKFWDPRS-GQCVSTILNFKHTVLRTRFQPTRGNYLLGISKDKSCRVFDIR 282

Query: 236 SLSNSAQVLPVEKPLNALAFSKHSKN--LIAAAGTDTRVYLYD-LRRLSEPLHTMA-GHQ 291
             +++ ++L V   ++ +  S H  N  +   A  D  +  +D L  L +P+HT+   H+
Sbjct: 283 --NHTKELLTVRDEVDFMTLSWHPINESVFTLANYDGSIKHFDILEDLEKPIHTIPFAHE 340

Query: 292 DAVTSIEFSSHKDGILCSSGSDRRLFIW 319
             +T++ ++     IL S+  DR +  W
Sbjct: 341 KCITAMSYNP-IGHILASASKDRTIRFW 367

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 95/226 (42%), Gaps = 21/226 (9%)

Query: 173 EGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232
           + + ++ SDD  + +W+ ++  +   +  +H D V    WH  +  +  + S+D  ++  
Sbjct: 179 DSKFVTCSDDNILKIWNFSNGKQERILTGHHWD-VKSCDWHP-EMGLIVSGSKDNLVKFW 236

Query: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
           D RS    + +L  +  +    F     N +     D    ++D+R  ++ L T+   +D
Sbjct: 237 DPRSGQCVSTILNFKHTVLRTRFQPTRGNYLLGISKDKSCRVFDIRNHTKELLTV---RD 293

Query: 293 AVTSIEFSSH--KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSA 350
            V  +  S H   + +   +  D  +  +D+         ED +  +  +      H   
Sbjct: 294 EVDFMTLSWHPINESVFTLANYDGSIKHFDIL--------EDLEKPIHTIPF---AHEKC 342

Query: 351 INDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
           I   S+NP +  ++ASA +D  ++ W  SK +  N    P Y + K
Sbjct: 343 ITAMSYNP-IGHILASASKDRTIRFWTRSKPIDPNGFDDPTYNNHK 387

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 2/132 (1%)

Query: 179 ASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLS 238
           A+    + LWD+N   +PVS +    D +   K+++ + +I  +   D ++ ++D R+ S
Sbjct: 195 ATGGAKIHLWDVNRL-KPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 239 NSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298
            + +++   +  NA+ ++         A  D   Y YD+R LS  L+    H  AV  ++
Sbjct: 254 PTQKIVQTMR-TNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 299 FSSHKDGILCSS 310
           FS   D I+  S
Sbjct: 313 FSPTGDEIVTGS 324

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 90/186 (48%), Gaps = 25/186 (13%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI----VNDSKWHE 214
           H+D  Y +A N     +L + S D  +  W++++ +  VS   ++  +    V   ++H+
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHD 125

Query: 215 F-----DENIFGTVSEDKTLQV-------------HDKRSLSNSAQVLPVEKPLNAL-AF 255
                  +N   + S+DKT+++              D  S++N   ++      +A    
Sbjct: 126 KKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGI 185

Query: 256 SKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRR 315
             H +N   A G   +++L+D+ RL +P+  ++   D +TS++F+ ++  IL S+GSD  
Sbjct: 186 DSHRENSTFATG-GAKIHLWDVNRL-KPVSDLSWGADNITSLKFNQNETDILASTGSDNS 243

Query: 316 LFIWDL 321
           + ++DL
Sbjct: 244 IVLYDL 249

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 102/257 (39%), Gaps = 23/257 (8%)

Query: 135 GKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD 194
           G  KI ++D ++ K       LS+  DN   L FN      L S   D ++ L+D+ +  
Sbjct: 197 GGAKIHLWDVNRLKP---VSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 195 RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE-KPLNAL 253
               IV   T   N   W+  +   F T +ED     +D R+LS S  V       +  +
Sbjct: 254 PTQKIV--QTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDV 311

Query: 254 AFSKHSKNLIAAA-GTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS 312
            FS     ++  +     R+Y  +     E  HT       V  +++S     I+  SGS
Sbjct: 312 DFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH--VFQVKYSMDSKYII--SGS 367

Query: 313 DR------RLFIWDLTQIGA--EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
           D       R   W+ + +    E+ + + D+ + E       H   I   S +  VP +I
Sbjct: 368 DDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFR----HMPEIKRISRHRHVPQVI 423

Query: 365 ASAEEDNVVQVWKISKK 381
             A+E   +++  I ++
Sbjct: 424 KKAQEIKNIELSSIKRR 440

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 136/329 (41%), Gaps = 52/329 (15%)

Query: 71  GDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKII 130
           G E N L +A       ++ +PD    S P  S+    + +E  ++++ +    ++   I
Sbjct: 347 GPELNKLALATNSPSLRIIPVPD---LSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWI 403

Query: 131 ATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFN----PQIEGE-----LLSASD 181
           AT +      ++      +E  CK   Y K  G+  A      P I  +     LL+AS+
Sbjct: 404 ATASKDNTAIVW----RYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASN 459

Query: 182 DTTVALWDINSTDRPVSIVMNHTDIVNDSKW----HEFDEN---------IFGTVSEDKT 228
           D T+  W I     P         I+  S++    HE D N         IF T S DKT
Sbjct: 460 DLTIKKWII-----PKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKT 514

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMA 288
            ++ +  +    A +   ++ L  ++F ++ K L+A +  D  V ++ L   S  + T+ 
Sbjct: 515 CKIWNLENGELEATLANHKRGLWDVSFCQYDK-LLATSSGDKTVKIWSLDTFS-VMKTLE 572

Query: 289 GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHR 348
           GH +AV    F  +K   L S G+D  + IWD +     +  +  ++ +  L  M+ G  
Sbjct: 573 GHTNAVQRCSF-INKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGD- 630

Query: 349 SAINDFSFNPQVPWLIASAEEDNVVQVWK 377
                         +I SA+ D V Q WK
Sbjct: 631 --------------MIVSADADGVFQFWK 645

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 346 GHRSAINDFSFNPQVP---WLIASAEEDNVVQVWKISKKLVSNIIPEYT 391
           GH   I+   F  Q+    WL+AS + + +V+VW + K+   + + E+T
Sbjct: 142 GHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHT 190

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 112/268 (41%), Gaps = 64/268 (23%)

Query: 129 IIATINGKGKIFIYDRS--------------KSKSEGLCKTLSYHKDNGYGLAFNPQIE- 173
           + AT++  G+++I+D +              K+  + +    S+    GY L ++P I+ 
Sbjct: 237 LTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKT 296

Query: 174 GELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD 233
           G LL+      V L               HT     SKW          +S+ +   V +
Sbjct: 297 GALLTGDCSGQVYL------------TQRHT-----SKW----------ISDKEPFTVAN 329

Query: 234 KRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQD 292
            +S+ +             + +S+    + A+ G D  + ++D R +  +P  ++     
Sbjct: 330 NQSVED-------------IQWSRTESTVFASCGCDGYIRVWDTRSKKHKPAISVKASNT 376

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAI 351
            V  I +S  K G L +SG D   + +WDL Q     +  ++++  P  +  +  H+ AI
Sbjct: 377 DVNVISWS-EKIGYLLASGDDNGTWGVWDLRQF----SPSNSNNTSP--VAQYDFHKGAI 429

Query: 352 NDFSFNPQVPWLIASAEEDNVVQVWKIS 379
              SFNP    ++A A EDN V +W +S
Sbjct: 430 TSISFNPLDESIVAVASEDNTVTLWDLS 457

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 93/213 (43%), Gaps = 29/213 (13%)

Query: 176 LLSASDDTTVALWDINSTDRPVSIVMNHTDIVND--SKWHEFDEN---------IFGTVS 224
           LL+AS+D T+  W I         V  H   +++   + HE D N         IF T S
Sbjct: 423 LLTASNDLTIKKWKIPKPSAGDEEVEFHDVKISEYTRRAHEKDINALSISPNDSIFATAS 482

Query: 225 EDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPL 284
            DKT ++ D  +  + A +   ++ L  ++F +  K +IA    D  + ++ L   S  +
Sbjct: 483 YDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDK-IIATCSGDKTIKIWSLDTFS-VI 540

Query: 285 HTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMH 344
            T+ GH +AV    F  +K   L S+G+D  + IWD++        +  ++ +  L + +
Sbjct: 541 KTLEGHTNAVQKCSF-INKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQN 599

Query: 345 AGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
            G                LI SA+ D V Q W+
Sbjct: 600 DGD---------------LIVSADADGVFQFWR 617

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 253 LAFSKHSKNLIAAAGTDTRVYLYDLR-RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG 311
           + FS+    + A  G D  + ++D R +  +P  ++      V  I ++  K G L +SG
Sbjct: 339 IQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWN-EKIGYLLASG 397

Query: 312 SDRRLF-IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEED 370
            D   + +WDL Q     A   +       +  ++ H+ AI   +FNP    +IA A ED
Sbjct: 398 DDNGTWGVWDLRQFSPNNAASVSP------VAQYSFHKGAITSIAFNPLDDSIIAVASED 451

Query: 371 NVVQVWKIS 379
           N V +W +S
Sbjct: 452 NTVTLWDLS 460

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 73/166 (43%), Gaps = 30/166 (18%)

Query: 182 DTTVALWDINSTD-RP-VSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLS- 238
           D  + +WD  S   +P +S+  + TD VN   W+E    +  +  ++ T  V D R  S 
Sbjct: 355 DGYIRIWDTRSKKHKPAISVKASSTD-VNVISWNEKIGYLLASGDDNGTWGVWDLRQFSP 413

Query: 239 -NSAQVLPVEK------PLNALAFSKHSKNLIAAAGTDTRVYLYDL-------------- 277
            N+A V PV +       + ++AF+    ++IA A  D  V L+DL              
Sbjct: 414 NNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAA 473

Query: 278 --RRLSE-PLHTMAGH-QDAVTSIEFSSHKDGILCSSGSDRRLFIW 319
             + L + P   +  H Q  V  +++     G L S+G+D  L IW
Sbjct: 474 ETKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTD-GLNIW 518

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDIN 191
           S+HK     +AFNP  +  +  AS+D TV LWD++
Sbjct: 426 SFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLS 460

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 93/216 (43%), Gaps = 53/216 (24%)

Query: 160 KDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENI 219
           +D  + +A+N   E + L A  D ++ L+DIN    P++I   H   V    W+  ++N+
Sbjct: 60  QDCLFDVAWNESHESQCLVAQGDGSLRLFDINLQKYPIAIFKEHKKEVLSCNWNLINKNL 119

Query: 220 FGTVSEDKTLQVHDKR---------------------------SLSNSAQVL------PV 246
           F + S D  ++V                               SL+N +Q +       +
Sbjct: 120 FLSSSWDGDVKVWSTARQASLITLSPIHTDPTAIVNTKSNINPSLNNVSQPILHPRSTAI 179

Query: 247 EKPLNALA--------------FSKHSKNLIAAAGTDTRVYLYDLRR----LSEPLHTMA 288
            +P+ + +              FS H  N++A     + + L+DLR+    +   + T +
Sbjct: 180 RQPVTSASMQGNDNKNCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQS 239

Query: 289 GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQI 324
           G++    +++F+ ++  I+ +SG D+ + +WD+  I
Sbjct: 240 GYE--TLTLDFNKYRSHIIATSGVDKAIKMWDMRFI 273

>Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 77/194 (39%), Gaps = 53/194 (27%)

Query: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189
           +A   G G + IYD  K K     +TLS H D    L++N  +   L S S D  +   D
Sbjct: 317 LAVGQGNGLVEIYDVMKRK---CIRTLSGHVDRVACLSWNNHV---LTSGSRDHRILHRD 370

Query: 190 INSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKP 249
           +   D     + +HT  V   KW+  D                                 
Sbjct: 371 VRMPDPFFETIESHTQEVCGLKWNVID--------------------------------- 397

Query: 250 LNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCS 309
                      N +A+ G D  V++Y+    S P+ T   H+ AV ++ +S HK GIL +
Sbjct: 398 -----------NKLASGGNDNMVHVYEGTSKS-PILTFDEHKAAVKAMAWSPHKRGILAT 445

Query: 310 SG--SDRRLFIWDL 321
            G  +DRRL IW++
Sbjct: 446 GGGTADRRLKIWNV 459

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 109/230 (47%), Gaps = 26/230 (11%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           A +P      ++ S+DTT+ +WD+ S    V++   H   V D    +    +F +VSED
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLASGKLKVTLT-GHVMTVRDIAVSDRHPYLF-SVSED 203

Query: 227 KTLQVHDKRSLSNSAQVLPVEKPLNAL-AFSKH-SKNLIAAAGTDTRVYLYDLRRLSEPL 284
           KT++  D   L  +  +      L+ +   S H + +LIA AG D+ V L+D+ R   P+
Sbjct: 204 KTVKCWD---LEKNQIIRDYHGHLSGVRTVSIHPTLDLIATAGRDSVVKLWDI-RTRVPV 259

Query: 285 HTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMH 344
            T+ GH+  +  +E +   D  + SS +D  + +WD+    A              M + 
Sbjct: 260 ITLVGHKGPINQVECAP-VDPQIVSSSTDATVRLWDIVAGKA--------------MKVL 304

Query: 345 AGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKIS-KKLVSNIIPEYTDL 393
             H+ ++   + +P   + +ASA  D+ ++ W ++   L++N   E T +
Sbjct: 305 THHKRSVRAIALHPN-EFSMASACTDD-IRSWGLADGSLLTNFESEKTGI 352

>ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]
           {ON} similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 608

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 93/210 (44%), Gaps = 23/210 (10%)

Query: 119 RARYMPKNDKIIATINGKGKIFIYDRSKSKS---EGLC--KTLSYHKDNGYGLAFNPQIE 173
           RAR  P+       +    K+   DR K +S   +G C  K    H D    L FN +  
Sbjct: 240 RAR-APQQSDCGGKVTTPWKVIYRDRFKVESNWRKGTCLIKEFKGHMDGVLALQFNTRY- 297

Query: 174 GELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHD 233
             L + S D+T+A+WD+  T R V  + +HTD V   K   FD+    T S DKT++V +
Sbjct: 298 --LFTGSYDSTIAIWDL-CTGRLVRRLSSHTDGV---KALYFDDQKLITGSLDKTIRVWN 351

Query: 234 KRSLSNSAQVLPVEKPLNALAFSKHS-KNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
                 + + +   +       S  S K +I +   D  V ++ +   S   +++ GH +
Sbjct: 352 YL----TGECISTYRGHTDSVLSVDSYKKIIVSGSADKTVKVWHVE--SRTCYSLRGHTE 405

Query: 293 AVTSIEFSSHKDGILCSSGS-DRRLFIWDL 321
            V  ++   H    LC S S D  + +WD+
Sbjct: 406 WVNCVKL--HPKSFLCFSCSDDTTIRMWDI 433

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 107/238 (44%), Gaps = 27/238 (11%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D    + D     + S DKTL++ D  +     + +  +  + ++A  + + ++I +  
Sbjct: 69  QDCTLTQ-DGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKA-SMIISGS 126

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFS---SHKDGI-LCSSGSDRRLFIWDLTQ 323
            D  + ++ ++   + L T+ GH D V+ +  +    + D + + S+G+D+ +  W+L Q
Sbjct: 127 RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQ 184

Query: 324 IGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
                 Q +AD           GH   +N  + +P    LIASA +D  + +W + +K
Sbjct: 185 F-----QIEAD---------FVGHNGNVNAVTASPDGS-LIASAGKDGEIMLWNLLEK 227

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 89/193 (46%), Gaps = 16/193 (8%)

Query: 177 LSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS 236
           LSAS D T+ LWD+ + +     V + +D+++ +   +    I G  S DKT++V   + 
Sbjct: 81  LSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISG--SRDKTIKVWTIKG 138

Query: 237 LSNSAQVLPVEKPLNALAFSKHSKN----LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
               A +L     ++ +  +   +N     + +AG D  V  ++L +  +      GH  
Sbjct: 139 -QCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQF-QIEADFVGHNG 196

Query: 293 AVTSIEFSSHKDG-ILCSSGSDRRLFIWDL---TQIGAEQAQED--ADDGVPELMMMHAG 346
            V ++  ++  DG ++ S+G D  + +W+L   T +    AQ++  A    P    + A 
Sbjct: 197 NVNAV--TASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSAQDEVFALAFSPNRYWLAAA 254

Query: 347 HRSAINDFSFNPQ 359
             S +  FS +PQ
Sbjct: 255 TASGVKIFSLDPQ 267

>TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 104/239 (43%), Gaps = 28/239 (11%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H+ IV
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIV 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D      D     + S DKTL++ D  +     + +  +  + ++A  + + ++I +  
Sbjct: 69  QDCA-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKA-SMIISGS 126

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKD-----GILCSSGSDRRLFIWDLT 322
            D  V ++ ++   + L TM GH D V+ +     +D       + S+G D+ +  W++ 
Sbjct: 127 RDKTVKVWTIK--GQCLATMLGHNDWVSQVRIVPTEDVNDDTVTVISAGMDKMVKAWNVN 184

Query: 323 QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
           Q      Q +AD           GH + +N  + +P    LIASA +D  + +W ++ K
Sbjct: 185 QF-----QIEAD---------FIGHNNYVNTVTASPDGS-LIASAGKDGEIMLWNLADK 228

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 73/147 (49%), Gaps = 4/147 (2%)

Query: 179 ASDDTTVALWDI--NSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS 236
           ++ +    +W++  NST+    I+  H   + D  +H     I  T S D  +   D RS
Sbjct: 87  STSNQKAMVWNLSRNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRS 146

Query: 237 LSNSAQVLPVEKP-LNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVT 295
                      +   + + ++  + N++A++ +D  V ++DLR+   PL+T+ GH+ +V 
Sbjct: 147 PQRPYYSTSEWRAGASQVKWNFRNSNIMASSHSD-HVCIWDLRKGCTPLYTLQGHEGSVN 205

Query: 296 SIEFSSHKDGILCSSGSDRRLFIWDLT 322
           +I+F+  K+  + SS +D  +  WD +
Sbjct: 206 NIDFNKAKETEIMSSSNDGTVKFWDYS 232

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 62/144 (43%), Gaps = 17/144 (11%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           + +  + F  H   ++A    DT V  +D+R    P ++ +  +   + ++++     I+
Sbjct: 115 RAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSNIM 174

Query: 308 CSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASA 367
            SS SD  + IWDL +            G   L  +  GH  ++N+  FN      I S+
Sbjct: 175 ASSHSDH-VCIWDLRK------------GCTPLYTLQ-GHEGSVNNIDFNKAKETEIMSS 220

Query: 368 EEDNVVQVWKISKKLVSNIIPEYT 391
             D  V+ W  S   VS+  P +T
Sbjct: 221 SNDGTVKFWDYS---VSDTKPRHT 241

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 71/162 (43%), Gaps = 24/162 (14%)

Query: 221 GTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRL 280
           G + ED  L     +SLS     L V+   NA++ +   ++++ A+     +Y+ DL   
Sbjct: 3   GYIGEDPYLSTTFGKSLS-----LRVDGGFNAVSINPSGRDVVLASRRG--LYVVDLDDP 55

Query: 281 SEP---LHTMAGHQDAVTSIEFSSH-KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDG 336
             P   LH     +  V  +++S H        S S+++  +W+L++      +      
Sbjct: 56  FSPPRWLHHRTSWE--VADVQWSPHPAKPYWVVSTSNQKAMVWNLSRNSTNAIEH----- 108

Query: 337 VPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKI 378
                ++H GH  AI D +F+P  P ++A+   D  V  W +
Sbjct: 109 -----ILH-GHFRAITDINFHPHHPEILATCSVDTYVLAWDM 144

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 155 TLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD 194
           TL  H+ +   + FN   E E++S+S+D TV  WD + +D
Sbjct: 196 TLQGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWDYSVSD 235

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 80/175 (45%), Gaps = 14/175 (8%)

Query: 164 YGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFD---ENIF 220
           + L   P  +  LL+   +  + L D N T +P+  +      +ND K  + D    N+ 
Sbjct: 17  WCLKLQPAYKHGLLTGLSNGEICLLDWN-TGKPLQKIRASETAINDMKIIDSDFVAGNLI 75

Query: 221 GTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGT-----DTRVYLY 275
            + S D +++V D RS   +  V  +    N+   S  S++ + A GT     D  +++Y
Sbjct: 76  SSASID-SVKVFDIRS---NDCVAKINNETNSPFLSLDSRHGLLACGTELQGIDAAIHIY 131

Query: 276 DLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA 329
           D+R+   PL ++   H D VT I+F      +L S  +D    I+DL Q   E A
Sbjct: 132 DVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDDEEDA 186

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 99/216 (45%), Gaps = 35/216 (16%)

Query: 176 LLSASDDTTVALWDI-NSTDRPVSIVMNHTDIVNDSKW----HEFDEN---------IFG 221
           LL+AS+D T+  W + N  DR  +I + H  IV  S++    HE D N         IF 
Sbjct: 448 LLTASNDLTIKRWKVPNPNDRK-AIELPH--IVKASEYTRRAHEKDINAISMSPNDSIFA 504

Query: 222 TVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLS 281
           T S DKT ++ +  +    A +   ++ L  +AF ++   L+A    D  + L+ L   +
Sbjct: 505 TASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDW-LLATCSGDRSINLWSLESFT 563

Query: 282 EPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELM 341
             L T+ GH +AV  + F  + +  L S+G+D  + IWD +     +  +  ++ +  L 
Sbjct: 564 -VLKTLEGHTNAVQRVSF-INGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALA 621

Query: 342 MMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWK 377
           + + G                LI +A+ D V Q W+
Sbjct: 622 VANDGQ---------------LIITADADGVFQFWE 642

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 224 SEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEP 283
           S+++ L+ +D  +   + + + +  P   L   + S  L+A  GTD  V ++D+      
Sbjct: 79  SQNQLLRFYDLET-KRTTRSMKISSPAYVLDCDE-SSTLLAVGGTDGSVNVFDIAN-GYV 135

Query: 284 LHTMAGHQDAVTSIEFSSHKDG---ILCSSGSDRRLFIWDLTQ 323
            H++ GH   ++S++F    D    +L S  ++  + IWDL +
Sbjct: 136 THSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVK 178

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 346 GHRSAINDFSFNPQVP---WLIASAEEDNVVQVWKISKKLVSNIIPEYT 391
           GH + I+   F  +V    WL+AS + + +V++W + K+   + + E+T
Sbjct: 141 GHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHT 189

>NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231
          Length = 767

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 91/191 (47%), Gaps = 22/191 (11%)

Query: 138 KIFIYDRSKSKS---EGLCKTLSY--HKDNGYGLAFNPQIEGELLSASDDTTVALWDINS 192
           K+   +R K +S   +G+C+   +  H D    L FN ++   L + S D+T+A+WD+ S
Sbjct: 335 KVIYRERFKVESNWRKGICQIQEFKGHLDGVLTLQFNYRL---LFTGSYDSTIAIWDLCS 391

Query: 193 TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNA 252
            ++ +  +  HTD V   K   FD+    T S DKT++V + +    + Q +   +    
Sbjct: 392 -NKLIRRLSGHTDGV---KTLHFDDQKLVTGSLDKTIRVWNYK----TGQCISTYRGHTD 443

Query: 253 LAFSKHS-KNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG 311
              S  S K +I +   D  + ++ +   S   +T+ GH + V  ++   H     C SG
Sbjct: 444 SIMSVDSYKKIIVSGSADKTIKVWHVE--SRTCYTLRGHTEWVNCVKL--HPKSFTCFSG 499

Query: 312 S-DRRLFIWDL 321
           S D  + +WD+
Sbjct: 500 SDDTTIRMWDI 510

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 97/227 (42%), Gaps = 24/227 (10%)

Query: 175 ELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTV---SEDKTLQV 231
           + ++ SDD  + +W+ ++  +   +  +H D V    WH      FG +   S+D  ++ 
Sbjct: 177 KFVTCSDDNVLKIWNFSNGQQERVLSGHHWD-VKSCDWHPR----FGLIVSGSKDNLIKF 231

Query: 232 HDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQ 291
            D R+  N + +L ++  +    F     NL+A    D    +YD+R+    L T+    
Sbjct: 232 WDPRTGRNVSTILGLKHTIIKTKFQPTQGNLLAVVAKDKSTKIYDIRQNMRELQTIRDDV 291

Query: 292 DAVTSI--EFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRS 349
           D ++ +    +     + C +G+ +     DL          D +  VP    +   H  
Sbjct: 292 DYMSLVWHPINETMFSVGCYNGAIKHF---DLLH--------DNNSPVPSSHTITYAHEK 340

Query: 350 AINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
           ++   +++P V  ++ASA +D  ++ W  S+ +  N    P Y + K
Sbjct: 341 SVTSLAYSP-VGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKK 386

>Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON}
           (100800..102569) [1770 nt, 590 aa]
          Length = 589

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 81/209 (38%), Gaps = 56/209 (26%)

Query: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189
           +A   G G + IYD  K K     +TLS H D    L++N  I   L S S D  +   D
Sbjct: 340 LAVGQGNGLMEIYDVVKKK---CIRTLSGHTDRVSCLSWNNNI---LSSGSRDRRILHRD 393

Query: 190 INSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKP 249
           +   D   + +  HT  V   KW+         V E+K                      
Sbjct: 394 VRIADPFFAQIETHTQEVCGLKWN---------VEENK---------------------- 422

Query: 250 LNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCS 309
                        +A+ G D  V +YD   ++ P  T   H  AV +I +S HK GIL +
Sbjct: 423 -------------LASGGNDNIVCVYDGTSVT-PTLTFREHTAAVKAIGWSPHKRGILAT 468

Query: 310 SG--SDRRLFIWDLTQIGAEQAQEDADDG 336
            G  +DRRL IW+   +       DAD G
Sbjct: 469 GGGTADRRLKIWN---VNTAMKLNDADTG 494

>TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON}
           Anc_7.231 YIL046W
          Length = 574

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 83/182 (45%), Gaps = 31/182 (17%)

Query: 150 EGLCKTLSY--HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIV 207
            G C+   +  H D    L FN ++   L + S D+T+A+WD+ S  + +  +  H+D +
Sbjct: 228 RGCCQIREFKGHMDGVLTLQFNYRL---LFTGSYDSTIAIWDLYS-GKLIRRLNGHSDGI 283

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHD---KRSLS----NSAQVLPVEKPLNALAFSKHSK 260
              K   FDEN   T S DKT++V D    R +S    +S  +L V+            K
Sbjct: 284 ---KTLYFDENKLITGSLDKTIRVWDYKGGRCISTYKGHSDSILSVD----------CYK 330

Query: 261 NLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIW 319
            LI +   D  V ++ + R     +T+ GH + V  ++   H     C S S D  + +W
Sbjct: 331 KLIVSGSADCSVKVWHIER--RTCYTLKGHTEWVNCVKL--HPTSFSCFSASDDCTIRMW 386

Query: 320 DL 321
           DL
Sbjct: 387 DL 388

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 75/173 (43%), Gaps = 22/173 (12%)

Query: 153 CKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW 212
           C TL  H +    +  +P       SASDD T+ +WD+ S ++ + +   H   V     
Sbjct: 352 CYTLKGHTEWVNCVKLHP-TSFSCFSASDDCTIRMWDLRS-NKCLKVFKGHVGQVQ---- 405

Query: 213 HEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL---PVEKPLN-ALAFSKHSKNLIAAAGT 268
               + I  ++ + + L V D+   S SAQ     P + PL+ ++ +  H    + +   
Sbjct: 406 ----KVIPLSIKDIEGLVVDDEVQSSASAQSTADEPCDDPLDTSIPYPTH----LLSCSL 457

Query: 269 DTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
           D  + L+D+    + + T  GH + V  I   + +   + S   D  + +WDL
Sbjct: 458 DNTIKLWDV-YTGKCVRTQFGHVEGVWDIAADNFR---IVSGSHDGCVKVWDL 506

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 69/154 (44%), Gaps = 20/154 (12%)

Query: 100 PVKSMIKVTKKFE----HEDEVIRARYMPKNDKIIATINGKGKIFIYD------------ 143
           PVK + K+  +      H  +V+   + P ND I+A+ +  GKI I++            
Sbjct: 75  PVKEVGKIPDQVPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVD 134

Query: 144 -RSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMN 202
                K     + LS H      L F+P  E  L S+S D TV +WDI+  +  V   + 
Sbjct: 135 EEGNPKDLKPVRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEE--VKFTLK 192

Query: 203 HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS 236
           H D+V  S    +D     TVS DK L+V D R+
Sbjct: 193 HPDMVT-SMSFSYDGKHLVTVSRDKKLRVWDVRA 225

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 24/129 (18%)

Query: 212 WHEFDENIFGTVSEDKTLQVHDKRSL--SNSAQVLPVEKPLNALAFSKHSKNLIAAAGTD 269
           W+      F  +   +  ++ D+  L   ++AQVL  +       FS  + +++A+   D
Sbjct: 63  WNSSGGGAFAVIPVKEVGKIPDQVPLFRGHTAQVLDTD-------FSPFNDHIVASGSDD 115

Query: 270 TRVYLYDLRR---LSE------------PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDR 314
            ++ ++++     L E            P+  ++GH   V  + F    + IL SS  D 
Sbjct: 116 GKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHPLAENILASSSLDY 175

Query: 315 RLFIWDLTQ 323
            + IWD++Q
Sbjct: 176 TVKIWDISQ 184

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 75/167 (44%), Gaps = 14/167 (8%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++   D T  +WD + T  P   +  H + V    W   D  +  T S D
Sbjct: 152 AFAPHTSSRVVTGGGDNTARIWDCD-TQTPKVTLNGHRNWVLCVSW-SADGEVIATGSMD 209

Query: 227 KTLQVHDKRSLSNSAQVLPVE-KPLNALAF------SKHSKNLIAAAGTDTRVYLYD-LR 278
            T+++ D  S       L    K + +L +         SK  +A+A  D  + ++D  R
Sbjct: 210 NTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSR 269

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           R+   L T+ GH ++V+ +++    +GIL S   D+ +  WD+ Q G
Sbjct: 270 RVC--LMTLGGHTNSVSCVKWGG--EGILYSGSHDKTVRAWDMKQNG 312

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 79/154 (51%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N + E  +++ASDD T+ LW+     +P+S +  H  +VN   +   D     + S D +
Sbjct: 369 NGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP-DGKYIVSASFDNS 427

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL--RRLSEPLHT 286
           +++ D +  +  +        +  +A+S   + L+ +   DT + ++D+  R+LS  L  
Sbjct: 428 IKLWDGKEGTFLSTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVKTRKLSVDL-- 484

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GHQD V ++++S   DG  +CS G D+ + +W
Sbjct: 485 -PGHQDEVYTVDWSV--DGKRVCSGGKDKMMRLW 515

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 96/215 (44%), Gaps = 38/215 (17%)

Query: 170 PQIEGELLSASDDTTVALWDINSTDRPVSIVM--NHTDIVNDSKWHEFDENIFGTVSEDK 227
           P  +  L SAS D T+ +WD   + R V ++    HT+ V+  KW    E I  + S DK
Sbjct: 247 PGSKPRLASASKDGTIRIWD---SSRRVCLMTLGGHTNSVSCVKWG--GEGILYSGSHDK 301

Query: 228 TLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTD--TRVYLYDLRRLSEPLH 285
           T++  D +            K +N L    H  N ++ + TD   RV  +D   + +P +
Sbjct: 302 TVRAWDMKQNG---------KCINILKSHAHWVNHLSLS-TDYALRVGAFDYTGV-KPAN 350

Query: 286 TMAGHQDAVTSIEFSSHKDG----ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELM 341
                  A+ + E  + K+G    ++ ++  D  +F+W+  +            G   + 
Sbjct: 351 AKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLK------------GTKPIS 398

Query: 342 MMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
            M  GH+  +N  +F+P   +++ SA  DN +++W
Sbjct: 399 RM-TGHQKLVNHVAFSPDGKYIV-SASFDNSIKLW 431

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 67/147 (45%), Gaps = 25/147 (17%)

Query: 254 AFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS- 312
           AF+ H+ + +   G D    ++D    + P  T+ GH++ V  + +S+  DG + ++GS 
Sbjct: 152 AFAPHTSSRVVTGGGDNTARIWDCDTQT-PKVTLNGHRNWVLCVSWSA--DGEVIATGSM 208

Query: 313 DRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP-------QVPWLIA 365
           D  + +WD            A+ G P L     GH   I   ++ P         P L A
Sbjct: 209 DNTIRLWD------------AESGKP-LGDALRGHSKWITSLTWEPIHLVEPGSKPRL-A 254

Query: 366 SAEEDNVVQVWKISKKLVSNIIPEYTD 392
           SA +D  +++W  S+++    +  +T+
Sbjct: 255 SASKDGTIRIWDSSRRVCLMTLGGHTN 281

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/103 (20%), Positives = 44/103 (42%), Gaps = 15/103 (14%)

Query: 274 LYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDA 333
           ++ ++ ++     +AGH   +    F+ H    + + G D    IW            D 
Sbjct: 128 VFKVKPITRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIW------------DC 175

Query: 334 DDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVW 376
           D   P++ +   GHR+ +   S++     +IA+   DN +++W
Sbjct: 176 DTQTPKVTL--NGHRNWVLCVSWSADGE-VIATGSMDNTIRLW 215

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 96/225 (42%), Gaps = 17/225 (7%)

Query: 173 EGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232
           + + ++ SDD  + +W+ ++  +   +  +H D V    WH     +  + S+D  +++ 
Sbjct: 177 DSKFVTCSDDNILKIWNFSNGQQERVLSGHHWD-VKSCDWHP-TMGLIVSGSKDNLIKLW 234

Query: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
           D RS    + +L  +  +    F     NL+A    D    ++D+R+  + L +     D
Sbjct: 235 DPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESD 294

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQ-IGAEQAQEDADDGVPELMMMHAGHRSAI 351
            + S+ +    + I      D  L  +DL Q  G+  +  D    +P        H   I
Sbjct: 295 YM-SLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHD----IP------YAHDKCI 343

Query: 352 NDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
              S+NP V  ++ASA +D  ++ W  S+ +  N    P Y + K
Sbjct: 344 TSLSYNP-VGHILASASKDRTIRFWTRSRPMDPNAFDDPTYNNKK 387

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 113/245 (46%), Gaps = 26/245 (10%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSK 211
           L + ++ H      L  +P       + S+DTTV +WD+ S    +++   H   V D  
Sbjct: 107 LIRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDLASGKLKLTLA-GHVMTVRDVA 165

Query: 212 WHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNAL-AFSKH-SKNLIAAAGTD 269
             +    +F + SEDK ++  D   L  +  +      L+ +     H + +LIA+AG D
Sbjct: 166 ISQRHPYLF-SASEDKMVKCWD---LEKNQIIRDYHGHLSGVHTVDIHPTLDLIASAGRD 221

Query: 270 TRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA 329
             V L+D+R  +  + T+ GH+  +T +        ++ SS +D  + +WD+T       
Sbjct: 222 GVVKLWDIRSRTAVM-TLIGHKSPITKVHCLPVNPQVV-SSSTDATVRLWDVTA------ 273

Query: 330 QEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISK-KLVSNIIP 388
                 G    ++ H  H+ ++ DFS +P    ++++  +D  ++ WK+ +  L++N   
Sbjct: 274 ------GKSYKILTH--HKRSVRDFSLHPSEFSMVSACTDD--IRSWKLPEGALLTNFAS 323

Query: 389 EYTDL 393
           E T +
Sbjct: 324 ESTGI 328

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 72/154 (46%), Gaps = 16/154 (10%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKD---NGYGLAFNPQIEGELLSASDDTTV 185
           +IA+    G + ++D    +S     TL  HK      + L  NPQ+    +S+S D TV
Sbjct: 214 LIASAGRDGVVKLWD---IRSRTAVMTLIGHKSPITKVHCLPVNPQV----VSSSTDATV 266

Query: 186 ALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED-KTLQVHDKRSLSNSAQVL 244
            LWD+ +  +   I+ +H   V D   H  + ++    ++D ++ ++ +   L+N A   
Sbjct: 267 RLWDVTA-GKSYKILTHHKRSVRDFSLHPSEFSMVSACTDDIRSWKLPEGALLTNFAS-- 323

Query: 245 PVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
                +N L+ ++   +++ A G D  +  YD +
Sbjct: 324 ESTGIINTLSVNQ--DDVLFAGGDDGMLSFYDYK 355

>TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {ON}
           Anc_7.356 YLR196W
          Length = 582

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 84/171 (49%), Gaps = 10/171 (5%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTD--RPVSIVMNHTDIVNDSKWHE 214
           ++H D    L+ N      L S S D TV +WD+NS D  R ++ + N+T+ V+ S+WH 
Sbjct: 287 THHTDAILSLSHNKHFRSVLASTSADHTVKIWDLNSGDAARSLASIHNNTN-VSSSEWHW 345

Query: 215 FDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNA--LAFSKHSKNLIAAAGTDT-R 271
            + +I  T   D  + + D R +S+ +Q+      +    +  +  +   I   GTD   
Sbjct: 346 TNGSILLTSGYDSRVALSDVR-ISDESQMSKYWSVMGGEDIETATFADENIILCGTDAGN 404

Query: 272 VYLYDLRR--LSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
           VY +D+R    S+P+ T+  H   ++++  +    G++ +    ++ L +W
Sbjct: 405 VYSFDVRNGDASKPVWTLKAHDAGISTLNSNRFIPGMMSTGAMGEKTLKLW 455

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 285 HTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA 329
           H    H DA+ S+  + H   +L S+ +D  + IWDL    A ++
Sbjct: 284 HITTHHTDAILSLSHNKHFRSVLASTSADHTVKIWDLNSGDAARS 328

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 77/167 (46%), Gaps = 14/167 (8%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD + T  P+  +  H++ V    W   D  +  T S D
Sbjct: 148 AFAPHTSSRMVTGAGDNTARIWDCD-TQTPLCTLKGHSNWVLCVAW-SADGEVIATGSMD 205

Query: 227 KTLQVHDKRSLSNSAQVLPVE-KPLNALAF------SKHSKNLIAAAGTDTRVYLYD-LR 278
            T+++ D     +    L    K + +L++          K  +A+A  D  + ++D  R
Sbjct: 206 ATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTR 265

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           R+   ++T++GH  +V+ I++      +L S+  DR +  WD+   G
Sbjct: 266 RVC--IYTLSGHTSSVSCIKWGGRN--VLYSASHDRTVRCWDMAAGG 308

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 118/279 (42%), Gaps = 46/279 (16%)

Query: 124 PKNDKIIATINGKGKIFIYDRSKSKSEGLC-KTLSYHKDNGYGLAFNPQIEGELLSASDD 182
           P     +A+ +  G I I+D ++     +C  TLS H  +   + +  +    L SAS D
Sbjct: 243 PGEKPRLASASKDGTIKIWDTTRR----VCIYTLSGHTSSVSCIKWGGR--NVLYSASHD 296

Query: 183 TTVALWDINSTDRPVSIVMNHTDIVNDS--------KWHEFDENIFGTVSEDKTLQVHDK 234
            TV  WD+ +  + ++I+ +H   VN          +   FD     T ++  + +    
Sbjct: 297 RTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYALRMGPFDH----TGTKPASPEDAQA 352

Query: 235 RSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAV 294
           R+L N  +V      +         + L+     D  +YL++  + S+P+  M GHQ  V
Sbjct: 353 RALRNYEKVAKKNGTM---------EELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLV 403

Query: 295 TSIEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIND 353
             + FS   DG  + S+  D  + +W            D  DG  + +    GH +++  
Sbjct: 404 NHVAFS--PDGRYIVSASFDNSIKLW------------DGRDG--KFIATFRGHVASVYQ 447

Query: 354 FSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392
            +++     L+ S  +D  ++VW +  + ++  +P + D
Sbjct: 448 VAWSSDCR-LLVSCSKDTTLKVWDVKTRKLTVDLPGHND 485

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 76/154 (49%), Gaps = 10/154 (6%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N  +E  +++ SDD T+ LW+     +P+  +  H  +VN   +   D     + S D +
Sbjct: 365 NGTMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP-DGRYIVSASFDNS 423

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL--RRLSEPLHT 286
           +++ D R     A        +  +A+S   + L++ +  DT + ++D+  R+L+  L  
Sbjct: 424 IKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCS-KDTTLKVWDVKTRKLTVDL-- 480

Query: 287 MAGHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
             GH D V ++++S   DG  +CS G D+ + +W
Sbjct: 481 -PGHNDEVYTVDWSV--DGKRVCSGGKDKMVRLW 511

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 29/148 (19%)

Query: 254 AFSKH-SKNLIAAAGTDT-RVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG 311
           AF+ H S  ++  AG +T R++  D +    PL T+ GH + V  + +S+  DG + ++G
Sbjct: 148 AFAPHTSSRMVTGAGDNTARIWDCDTQ---TPLCTLKGHSNWVLCVAWSA--DGEVIATG 202

Query: 312 S-DRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP-------QVPWL 363
           S D  + +WD     +E+ Q   D           GH   I   S+ P       + P L
Sbjct: 203 SMDATIRLWD-----SEKGQSLGD--------ALRGHTKWITSLSWEPIHLVKPGEKPRL 249

Query: 364 IASAEEDNVVQVWKISKKLVSNIIPEYT 391
            ASA +D  +++W  ++++    +  +T
Sbjct: 250 -ASASKDGTIKIWDTTRRVCIYTLSGHT 276

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 72/163 (44%), Gaps = 29/163 (17%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDEN 218
           HKD    L+F+ +    L+S S D  +  WD+ +        +   D+            
Sbjct: 423 HKDEITALSFDSE---ALVSGSRDKKIFHWDLTTGK-----CIQQLDL------------ 462

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
           IF     D  +     RSL+N A +L  E P+  +   +   + +A    D  V L+DLR
Sbjct: 463 IFTPTHSDIKMPA---RSLNNGACLLGTEAPM--IGALQCYNSALATGTKDGIVRLWDLR 517

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
            + +P+  + GH D +TS++F S K   L +   D  + IWDL
Sbjct: 518 -VGKPVRLLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 556

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 66/150 (44%), Gaps = 30/150 (20%)

Query: 174 GELLSAS-DDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232
           G L S+S  D  V +WD+N   + V  +  H   VN  +  + + N+  T S+D TL++ 
Sbjct: 332 GTLCSSSYQDRIVKVWDLNHGIQ-VGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLW 390

Query: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292
           D   L+ S ++     PL      + ++ ++                    +H    H+D
Sbjct: 391 D---LNLSREIYLDHSPL-----KEKTEEIVTPC-----------------IHNFELHKD 425

Query: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLT 322
            +T++ F S     L S   D+++F WDLT
Sbjct: 426 EITALSFDSEA---LVSGSRDKKIFHWDLT 452

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 109/245 (44%), Gaps = 41/245 (16%)

Query: 143 DRSKSKSEGLCKT---------LSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST 193
           D S +  +GL KT         L +H++N   +    QI+             LWD +S 
Sbjct: 157 DESVNTKDGLIKTFYGEHAFQGLDHHRNNSTFVTGGAQIQ-------------LWD-SSR 202

Query: 194 DRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNAL 253
            +P+S +    D V + K+++ + +I  +   D ++ ++D R+ S + +++   +  NA+
Sbjct: 203 SKPISNLTWGADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIVQSMRS-NAI 261

Query: 254 AFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS- 312
            ++         A  D   Y YD+R +S  L+    H  AV  ++FS    G    +GS 
Sbjct: 262 CWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSP--TGTELVTGSY 319

Query: 313 DRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNV 372
           D+ + I+D   IG   ++E          + H      +    ++    ++++ +++ N 
Sbjct: 320 DKTIRIYD---IGHGHSRE----------IYHTKRMQHVFQVKYSMDSRYIVSGSDDGN- 365

Query: 373 VQVWK 377
           V++W+
Sbjct: 366 VRLWR 370

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 72/181 (39%), Gaps = 41/181 (22%)

Query: 147 SKSEGLCKTLSYHKDNGYGLAFNPQI------EGELLSASDDTTVALWDINSTDRPVSIV 200
           S  E LC +   H     GL  +P+       E  ++S  DD T+ LW +NS D      
Sbjct: 98  STREELC-SFKAHYGLVTGLCVSPEKYSSDKNEHFMISCGDDKTIKLWSVNSED------ 150

Query: 201 MNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSK 260
                              F  V +D+++   D        +    E     L   +++ 
Sbjct: 151 -------------------FANVKDDESVNTKD-----GLIKTFYGEHAFQGLDHHRNNS 186

Query: 261 NLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWD 320
             +       ++ L+D  R S+P+  +    D VT+++F+  +  IL S+GSD  + ++D
Sbjct: 187 TFVTGGA---QIQLWDSSR-SKPISNLTWGADNVTNVKFNQTETDILASTGSDNSIVLYD 242

Query: 321 L 321
           L
Sbjct: 243 L 243

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 77/167 (46%), Gaps = 8/167 (4%)

Query: 159 HKDNGYGLAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDE 217
           H    Y L+F  Q +G L+ +A  D    +WD+ S    +S+V  H   +  S W +   
Sbjct: 309 HSKEIYSLSF--QTDGSLIATAGADKVGIIWDLRSGKNILSLV-GHAKPIYCSDWSQ--N 363

Query: 218 NIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDL 277
                 S D T+++ D R + +   +L  +  +  L F K +   + ++  D  + ++  
Sbjct: 364 GYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSS 423

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQI 324
               + +HT+ GH D + SI+ SS    I+ S G DR + +W +  I
Sbjct: 424 DSWVK-IHTLQGHNDKILSIDISSDYQTIV-SGGWDRSVKLWSMEAI 468

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 72/149 (48%), Gaps = 6/149 (4%)

Query: 166 LAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSE 225
           + F+P  +  + SAS DTT  LWDI  T+  + +   H+  +    + + D ++  T   
Sbjct: 274 VKFHPS-QKYIGSASFDTTWRLWDI-VTNSELLLQEGHSKEIYSLSF-QTDGSLIATAGA 330

Query: 226 DKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLH 285
           DK   + D RS  N   ++   KP+    +S++      +   D  + ++DLR++ + + 
Sbjct: 331 DKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSG--DGTIKIWDLRKV-DDVE 387

Query: 286 TMAGHQDAVTSIEFSSHKDGILCSSGSDR 314
           T+  H++ VT ++F       L SS  D+
Sbjct: 388 TILAHKNVVTDLKFEKENSKFLISSSYDK 416

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 108/229 (47%), Gaps = 24/229 (10%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           A +P      ++ S+DTT+ +WD+ +T +  + +  H   V D    +    +F +VSED
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWDL-ATGKLRTTLAGHVMTVRDIAISDRHPYLF-SVSED 203

Query: 227 KTLQVHDKRSLSNSAQVLPVEKPLNAL-AFSKH-SKNLIAAAGTDTRVYLYDLRRLSEPL 284
           KT++  D   L  +  +      L+ +   S H + +LIA AG D+ + L+D+ R   P+
Sbjct: 204 KTVKCWD---LEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDI-RTRVPV 259

Query: 285 HTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMH 344
            T+ GH+  +  ++ +   D  + SS +D  + +WD+    A              M + 
Sbjct: 260 ITLVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDVVAGKA--------------MKVL 304

Query: 345 AGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTDL 393
             H+ ++   + +P+  + +ASA  D++     +   L++N   E T +
Sbjct: 305 THHKRSVRATALHPK-EFSVASACTDDIRSWGLVEGSLLTNFESEKTGI 352

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 104/238 (43%), Gaps = 18/238 (7%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDEN 218
           H ++   +AF+   + + ++ SDD  + +W+ ++  +   +  +H D V    WH  +  
Sbjct: 176 HTESIRDMAFSSN-DSKFVTCSDDNILKIWNFSNGKQERILSGHHWD-VKSCDWHP-EMG 232

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
           +  + S+D  +++ D RS +  + +L  +  +    F     NL+ A   D    ++D+R
Sbjct: 233 LIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVP 338
                L  +    D +T +E+    + +   +  D  L  +DL Q          D   P
Sbjct: 293 YSMRELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ----------DLNEP 341

Query: 339 ELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
            L + +A H   I   S+NP V  + A+A +D  ++ W  ++ +  N    P Y + K
Sbjct: 342 ILTIPYA-HDKCITSLSYNP-VGHIFATAAKDRTIRFWTRARPIDPNAYDDPTYNNKK 397

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 86/193 (44%), Gaps = 17/193 (8%)

Query: 185 VALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
           + LWD N + +P+S +    D +   K+++ + +I  +   D  + ++D R+ S + +++
Sbjct: 194 IHLWDSNRS-KPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQKII 252

Query: 245 PVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKD 304
              +  NA+ ++         A  D   Y YD+R +S  LH    H  AV  ++FS   D
Sbjct: 253 QTMRT-NAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGD 311

Query: 305 GILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
            I+  S  D+ + I+      A +             + H      +    F+    ++I
Sbjct: 312 EIVTGS-YDKTIRIFKTNHGHARE-------------VYHTKRMQHVFQVKFSMDSKYII 357

Query: 365 ASAEEDNVVQVWK 377
           + +++ N V++W+
Sbjct: 358 SGSDDGN-VRLWR 369

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 82/178 (46%), Gaps = 16/178 (8%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVN-----DSKWH 213
           H+D  Y +A N     +L S S D  +  W++++ +  VS   ++  +       +    
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWNMSTREEFVSFKAHYGLVTGLCVTPEHTSK 125

Query: 214 EFDENIFGTVSEDKTLQV----HDKRSLSNSAQVLPVEKPLNAL----AFSK--HSKNLI 263
             +EN   +  +DKT+++    +D  S   S   L  E  L       AF    H +   
Sbjct: 126 NKNENFMLSCGDDKTVKLWSVNNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHREAS 185

Query: 264 AAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
                  +++L+D  R S+P+  ++   D +TS++F+ ++  IL S+GSD  + ++DL
Sbjct: 186 TFVTGGAQIHLWDSNR-SKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDL 242

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 105/257 (40%), Gaps = 19/257 (7%)

Query: 133 INGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINS 192
           + G  +I ++D ++SK       LS+  DN   + FN      L S   D  + L+D+  
Sbjct: 188 VTGGAQIHLWDSNRSKP---ISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDL-R 243

Query: 193 TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE-KPLN 251
           T+ P   ++  T   N   W+  +   F   +ED     +D R++S +  V       + 
Sbjct: 244 TNSPTQKII-QTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVM 302

Query: 252 ALAFSKHSKNLIAAAGTDT-RVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSS 310
            + FS     ++  +   T R++  +     E  HT       V  ++FS     I+  S
Sbjct: 303 DVDFSPTGDEIVTGSYDKTIRIFKTNHGHAREVYHTK--RMQHVFQVKFSMDSKYIISGS 360

Query: 311 --GSDR--RLFIWDLTQIGA--EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
             G+ R  R   W+ + +    E+ + D D+ + E       H   I   S +  VP +I
Sbjct: 361 DDGNVRLWRSKAWERSNVKTTREKNKLDYDEKLKERFK----HMPEIKRISRHRHVPKVI 416

Query: 365 ASAEEDNVVQVWKISKK 381
             A+E   +++  + ++
Sbjct: 417 KKAQEIKGIELSSMKRR 433

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 86/183 (46%), Gaps = 14/183 (7%)

Query: 151 GLCKTL-SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVND 209
           G+ K++ + H+    GL ++P     LLS   D  V LWD+ S       +  H   V+ 
Sbjct: 205 GIAKSIDAAHEGKIGGLDWHPD-GNHLLSGGGDNLVKLWDMTSN--SFEELRGHAGRVSR 261

Query: 210 SKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVE---KPLNALAFSKHSKNLIAAA 266
            K H     +  + S D T  + D   L    ++   E   K +  +AF      L+A+A
Sbjct: 262 VKVHP-SGRLAASASFDLTWILWD---LERKVELQLQEGHSKAVYTIAFQSDGA-LLASA 316

Query: 267 GTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGA 326
           G D    ++DLR   EP+  + GH  A++ +++S +    L ++G+D  + +WD+  +G 
Sbjct: 317 GLDAVCAIWDLRS-GEPIMKLEGHAGAISGVDWSPNGY-QLATAGADGTVRVWDIRNVGT 374

Query: 327 EQA 329
           E A
Sbjct: 375 ESA 377

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 65/147 (44%), Gaps = 12/147 (8%)

Query: 178 SASDDTTVALWDINSTDRPVSIVM--NHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKR 235
           SAS D T  LWD+   +R V + +   H+  V    +   D  +  +   D    + D R
Sbjct: 273 SASFDLTWILWDL---ERKVELQLQEGHSKAVYTIAFQS-DGALLASAGLDAVCAIWDLR 328

Query: 236 SLSNSAQVLPVEKPLNALAFSKHSKN--LIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDA 293
           S      ++ +E    A++    S N   +A AG D  V ++D+R +      +A HQ A
Sbjct: 329 S---GEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLA-HQVA 384

Query: 294 VTSIEFSSHKDGILCSSGSDRRLFIWD 320
              ++F  +    L S G DR + I++
Sbjct: 385 ALDVKFKKNNGTFLVSCGHDRLVNIFN 411

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/345 (20%), Positives = 128/345 (37%), Gaps = 80/345 (23%)

Query: 103 SMIKVTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYD---RSKSKSEGLCKTLS-- 157
           ++++ T    H D V +A  +    KI     G GK+       R +S  E L + L+  
Sbjct: 85  TVLQATPDLSHWDSVAQASVIYPLSKIQWMPKGTGKLATCSDSLRIRSVEEQLHEQLNLS 144

Query: 158 ---YHKD-----NGYGLAFNPQIEG---------ELLSASDDTTVALWDINSTDRPVSIV 200
              Y K      NG  L   P +            +L +S DTT  +WD+ +++   + +
Sbjct: 145 LVKYGKSLGEVSNGRMLGQLPPVTSFDWNALDTNLILFSSIDTTCTVWDLQASNYVKTQL 204

Query: 201 MNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL----------PVEKPL 250
           + H   V D+K+     N+F +   D +++V D R L++S  +           P +  +
Sbjct: 205 IAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQV 264

Query: 251 NALAF-------------------------------------SKHSKNLIAAAGTDTRVY 273
           + LA                                      S    N++A    D+ V 
Sbjct: 265 HTLAAHEQDGQLQKNSQSSALSSSASSSLGALDNCALLRLEPSPFDPNILATIQQDSNVV 324

Query: 274 -LYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQI-------- 324
            + D+R    P+  + GH   V  +++   K  +L + G D ++  WDL ++        
Sbjct: 325 IILDMRYPGSPMLLLEGHAAPVNQLKWHPSKPNVLATCGDDCQILYWDLLELLSASQVWT 384

Query: 325 GAEQAQEDADDGVP--ELMMMHAGHRSAINDFSFNPQVPWLIASA 367
           G  Q +      V   E   M    +  +N+F + P   W+  +A
Sbjct: 385 GLTQQRWSTTSTVRTLETPQMSYTAQYEVNNFVWRPSGDWIGYTA 429

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 74/195 (37%), Gaps = 46/195 (23%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           +++T N K    I++ +K  S  +   L  H      + F+PQ    L + S DT V  W
Sbjct: 85  VVSTSNQKA--IIWNLAKPSSNAIEHVLHKHFRAITDINFSPQHPDILATCSIDTYVHAW 142

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  RP           +  KW   D+N+                             
Sbjct: 143 DLRSPQRPFYTTSGWLSGASQVKWSFNDQNV----------------------------- 173

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                        L +A G D  V ++DLR+ S PL  + GH  +V S++F+  K   L 
Sbjct: 174 -------------LASAHGND--VCIWDLRKGSTPLGKLVGHGSSVNSVDFNRFKRTELM 218

Query: 309 SSGSDRRLFIWDLTQ 323
           +  +D  +  WD ++
Sbjct: 219 TGSNDGSVKFWDYSK 233

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 63/147 (42%), Gaps = 16/147 (10%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           + +  + FS    +++A    DT V+ +DLR    P +T +G     + +++S +   +L
Sbjct: 115 RAITDINFSPQHPDILATCSIDTYVHAWDLRSPQRPFYTTSGWLSGASQVKWSFNDQNVL 174

Query: 308 CSS-GSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIAS 366
            S+ G+D  + IWDL +            G   L  +  GH S++N   FN      + +
Sbjct: 175 ASAHGND--VCIWDLRK------------GSTPLGKL-VGHGSSVNSVDFNRFKRTELMT 219

Query: 367 AEEDNVVQVWKISKKLVSNIIPEYTDL 393
              D  V+ W  SK     I    TD 
Sbjct: 220 GSNDGSVKFWDYSKSCNEPIKTIRTDF 246

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 70/170 (41%), Gaps = 24/170 (14%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           +FN Q    +L+++    V +WD+     P+  ++ H   VN   ++ F      T S D
Sbjct: 167 SFNDQ---NVLASAHGNDVCIWDLRKGSTPLGKLVGHGSSVNSVDFNRFKRTELMTGSND 223

Query: 227 KTLQVHD-KRSLSNSAQVLPVEKPL---NALAFSKHSKNLIAAAGTDTRVYLYDLRRLS- 281
            +++  D  +S +   + +  + P+     L F +    L+ + G    VY+  L +   
Sbjct: 224 GSVKFWDYSKSCNEPIKTIRTDFPIWRGRYLPFGEGC-CLMPSVGGFNSVYVASLAKRDG 282

Query: 282 ---------EPLHTMAGHQDAVTSIEFSSHKDGILCSS-GSDR--RLFIW 319
                    +P++   GH D VT   + S      C S G DR  +L  W
Sbjct: 283 VEEVNDSKLQPIYAFKGHDDRVTDFVWRSRSS---CGSDGCDREFQLVTW 329

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 11/69 (15%)

Query: 310 SGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEE 369
           S S+++  IW+L +  +   +           ++H  H  AI D +F+PQ P ++A+   
Sbjct: 87  STSNQKAIIWNLAKPSSNAIEH----------VLHK-HFRAITDINFSPQHPDILATCSI 135

Query: 370 DNVVQVWKI 378
           D  V  W +
Sbjct: 136 DTYVHAWDL 144

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/288 (20%), Positives = 123/288 (42%), Gaps = 32/288 (11%)

Query: 126 NDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTV 185
           ++K IA     G I ++  S  +   + K L+ H  +   L FN + E  L+S S+   +
Sbjct: 73  DNKTIAGALDNGIIELFYLSNDQLTSVAK-LTTHTSSVKTLKFNSKQENVLVSGSNKGEI 131

Query: 186 ALWDINSTDR----PVS--IVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRS--- 236
            +WD N   +    P++    M   + +    W++   ++F +        + D ++   
Sbjct: 132 FVWDTNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKKE 191

Query: 237 ---LSNSAQVLPVEKPLNALAFSKHSKNLIAAAG---TDTRVYLYDLRRLSEPLHTM-AG 289
              LS ++    ++  L+ + +  ++   +A A     D  + ++DLR  + PL  +  G
Sbjct: 192 VIHLSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQG 251

Query: 290 HQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRS 349
           H   + S+++    + ++ SSG D  + +W+             + G  E +       +
Sbjct: 252 HSKGIISLDWCHEDESLMLSSGRDNTVLLWN------------PESG--EKLSQFPTRSN 297

Query: 350 AINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397
                 F P +P + ASA  DN ++V  + + LV+ +  + T+ K  E
Sbjct: 298 WCFKTKFAPAMPDIFASASFDNKIEVQTL-QNLVNTLDQKKTETKQHE 344

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 70/152 (46%), Gaps = 12/152 (7%)

Query: 180 SDDTTVALWDINSTD--RPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVH--DKR 235
           S D+ + LW + STD  +PV+ +   T   ND  W   ++ I G + ++  +++      
Sbjct: 37  SSDSVLELWSLLSTDTVKPVASISTDTKF-NDLDWSYDNKTIAGAL-DNGIIELFYLSND 94

Query: 236 SLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSE----PL--HTMAG 289
            L++ A++      +  L F+   +N++ +      ++++D  +  +    P+   T   
Sbjct: 95  QLTSVAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVWDTNKAKQTDYVPMTPGTAMT 154

Query: 290 HQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
             + +TS+ ++     +  S+G+     IWDL
Sbjct: 155 PLEEITSLSWNQSLAHVFASAGATVYASIWDL 186

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 105/239 (43%), Gaps = 28/239 (11%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      LLSAS D T+  W +   D+    PV     H+ IV
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIV 67

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D      D     + S DKTL++ +  +     +    +  + ++A  + + ++I +  
Sbjct: 68  QDCA-LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKA-SMIISGS 125

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG-----ILCSSGSDRRLFIWDLT 322
            D  + ++ ++   + L TM GH D V+ +  + +++       L S+G D+ +  W++ 
Sbjct: 126 RDKTIKVWTIK--GDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNVN 183

Query: 323 QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381
           Q      Q +AD           GH + IN  + +P    LIASA +D  + +W + +K
Sbjct: 184 QF-----QIEAD---------FVGHNNYINTITASPDGT-LIASAGKDGDIMLWNLKEK 227

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 104/234 (44%), Gaps = 27/234 (11%)

Query: 165 GLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVS 224
           G+AF+P     +L A   +T+ LWD       +    +H   V    +H   + IF +  
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYR-MGTLLHRFEDHEGPVRGLDFHP-TQPIFVSAG 72

Query: 225 EDKTLQVHDKRSLSNSAQVLPVEKPLNAL--AFSKHSKNLIAAAGTDTRVYLYDLRRLSE 282
           +D T++V    SL  +  +  ++  L+ +   F  H    I +A  D  + +++ +   E
Sbjct: 73  DDYTIKVW---SLETNKCLYTLQGHLDYVRTVFFHHELPWIISASDDQTIRIWNWQNRKE 129

Query: 283 PLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLT----------------QIGA 326
            +  + GH   V   +F  ++D ++ S+  D  + +WD++                QI A
Sbjct: 130 -IACLTGHNHFVMCAQFHPNED-LVVSASLDESVRVWDISGLRKKHSAPGTTSMEDQIAA 187

Query: 327 EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISK 380
           +    D   G   +  +  GH   +N  SF+P +P LI S  +D  V++W++S+
Sbjct: 188 QNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMSQ 240

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 103/252 (40%), Gaps = 45/252 (17%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDEN 218
           H+    GL F+P  +   +SA DD T+ +W +  T++ +  +  H D V    +H     
Sbjct: 52  HEGPVRGLDFHPT-QPIFVSAGDDYTIKVWSL-ETNKCLYTLQGHLDYVRTVFFHHELPW 109

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
           I  + S+D+T+++ + ++    A  L         A    +++L+ +A  D  V ++D+ 
Sbjct: 110 II-SASDDQTIRIWNWQNRKEIA-CLTGHNHFVMCAQFHPNEDLVVSASLDESVRVWDIS 167

Query: 279 RL----SEPLHTM-------------AGHQDAVTSIEFSSHKDGI----------LCSSG 311
            L    S P  T               G  D V       H  G+          L  SG
Sbjct: 168 GLRKKHSAPGTTSMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSG 227

Query: 312 SD-RRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEED 370
           SD R++ +W ++Q  A +                 GH + ++   F+P    LI S  ED
Sbjct: 228 SDDRQVKLWRMSQTKAWEVD------------TCRGHTNNVDCVIFHPHQN-LIISVGED 274

Query: 371 NVVQVWKISKKL 382
             +++W + K++
Sbjct: 275 KTLRIWDLDKRV 286

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 90/193 (46%), Gaps = 18/193 (9%)

Query: 162 NGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDE---N 218
           N + L   P     LL++  +  V L D  +T + +  +  H   VND      D    +
Sbjct: 33  NNWCLKLQPIYNSGLLTSLSNGRVELIDW-ATHKSILQIQTHATSVNDMVIINNDRMNGS 91

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGT-----DTRVY 273
           +  T +ED  ++++D   L ++  V  ++   +A   S  S++ +   GT     D  ++
Sbjct: 92  LIATAAED-AVKIYD---LKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTELSGVDAELH 147

Query: 274 LYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQED 332
           +YD+R   +PL ++   H D +TSI+F      +L S  +D  + I+DLTQ    Q ++D
Sbjct: 148 VYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQ----QEEDD 203

Query: 333 ADDGVPELMMMHA 345
           A   V     +H+
Sbjct: 204 ALHQVINFASIHS 216

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 103/231 (44%), Gaps = 16/231 (6%)

Query: 166 LAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSE 225
           ++F+P  + + +S SDD  + +W+ ++  +   +  +H D V    WH     +  + S+
Sbjct: 171 ISFSP-TDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWD-VKSCDWHP-KMGLIVSGSK 227

Query: 226 DKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLH 285
           D  ++  D RS S  + +L  +  + +  F     NL++    D    +YD+R+ ++ L 
Sbjct: 228 DNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKELF 287

Query: 286 TMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHA 345
           ++    D +T +++    + +      D  +  +DL+Q   E         +P       
Sbjct: 288 SVRDDVDYMT-LQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPTHNIP------Y 337

Query: 346 GHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
            H   +   +++P +  ++ASA +D  ++ W  S+ +  N    P Y + K
Sbjct: 338 AHEKCVTSLAYSP-IGHIMASASKDRTIRFWTRSRAVDPNAFDDPTYNNEK 387

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 129/290 (44%), Gaps = 31/290 (10%)

Query: 107 VTKKFEHEDEVIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGL 166
            ++  +H D  +  R    NDK +    G   + +YD  ++ +     T   HK N   L
Sbjct: 24  CSRTIQHSDSQVN-RLEITNDKKLLGAAGHQNVRLYD-IRTTNPNPVATFEGHKGNVTSL 81

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           +F  Q    ++++S+D T+ +WD+ S   P +    H   VN+   H  ++    +   D
Sbjct: 82  SFQ-QDNRWMVTSSEDGTIKVWDVRSPSVPRN--YKHNAPVNEVVIHP-NQGELISCDRD 137

Query: 227 KTLQVHDKRSLSNSAQVLPVEK-PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLH 285
             +++ D      + Q+ P +  PL +L+ +    +++ AA +    Y++++     P H
Sbjct: 138 GNIRIWDLGENQCTHQLTPEDNTPLQSLSVAS-DGSMLVAANSKGNCYVWEM-----PNH 191

Query: 286 TMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDA-----DDGVPEL 340
           T A +   VT  +F +H + I       R L   D+  +    A + A     DD   +L
Sbjct: 192 TDASNLKPVT--KFKAHSNYIT------RILLSSDVKHLATCSADKTARTWSLDDNF-KL 242

Query: 341 MMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNIIPEY 390
                GH+  + D +F+    +L+ +A  D+ V++W +S +    I+ +Y
Sbjct: 243 ESTLDGHQRWVWDCAFSADSAYLV-TASSDHYVRLWDLSTR---EIVRQY 288

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 73/163 (44%), Gaps = 29/163 (17%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDEN 218
           H D    L+F+ +    L+S S D  +  WD+ +      + +  T   ND+K       
Sbjct: 425 HSDEITALSFDSE---ALISGSKDRKILHWDLVTGKCVQQLDLIVTPTYNDTK------- 474

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
               VS          RS +NS  VL  E P+  +   +   + +A+   D  V L+DLR
Sbjct: 475 ----VS---------ARSANNSTSVLGSEAPM--IGALQCYNSALASGTKDGVVRLWDLR 519

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321
            + +P+  + GH D +TS++F S K   L +   D  + IWDL
Sbjct: 520 -IGKPVRALEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 558

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 104/223 (46%), Gaps = 26/223 (11%)

Query: 166 LAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVMNH-TDIVNDSKWHEFDENIFGTV 223
           + F+P  +G+ L + ++D  + +WDI +  + V I+  H  DI +   +   D+ + G  
Sbjct: 453 VCFSP--DGKFLATGAEDRLIRIWDIENR-KIVMILQGHEQDIYSLDYFPSGDKLVSG-- 507

Query: 224 SEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD------L 277
           S D+T+++ D R+    +  L +E  +  +A S      IAA   D  V ++D      +
Sbjct: 508 SGDRTVRIWDLRT-GQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLV 566

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDLTQIGAEQAQEDADDG 336
            RL     +  GH+D+V S+ F+  +DG    SGS DR + +W+L     +   +  + G
Sbjct: 567 ERLDSENESGTGHKDSVYSVVFT--RDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 624

Query: 337 VPELMMMHAGHRSAINDFSFN---PQVPWLIASAEEDNVVQVW 376
             E+  +  GH+    DF  +    Q    I S  +D  V  W
Sbjct: 625 TCEVTYI--GHK----DFVLSVATTQNDEYILSGSKDRGVLFW 661

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 105/239 (43%), Gaps = 27/239 (11%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +P     LLSAS D T+  W +   D+    PV     H+ I+
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKGHSHII 68

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D      D     + S DKTL++ D  S  +  + +  +  + +++    +  +++A+ 
Sbjct: 69  QDCTVTN-DGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGATQIVSAS- 126

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDG----ILCSSGSDRRLFIWDLTQ 323
            D  V +++   + E + T+ GH D V+ +  +   +      + S+G D+ + +WDL  
Sbjct: 127 RDKTVKVWN--TVGECVVTLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKVWDLQS 184

Query: 324 IGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
              E     AD           GH + +N  + +P    + ASA +D  + +W ++ K+
Sbjct: 185 FTIE-----AD---------FIGHNNYVNTVTPSPDGS-IFASAGKDGQIMLWNLNAKI 228

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 76/175 (43%), Gaps = 30/175 (17%)

Query: 167 AFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSED 226
           AF P     +++ + D T  +WD N T  P+S +  H + V    W   D  +  T S D
Sbjct: 150 AFAPHTSSRMITGAGDNTARIWDCN-TQTPMSTLKGHFNWVLCVSWSP-DGELIATGSMD 207

Query: 227 KTLQV---------------HDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTR 271
            T+++               H K   S S + + + KP          K  +A+A  D  
Sbjct: 208 NTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKP--------GQKPRLASASKDGT 259

Query: 272 VYLYD-LRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIG 325
           + ++D  RR+   L T++GH  +V+ I++     G+L S   D+ +  WD+   G
Sbjct: 260 IKIWDTTRRVC--LITLSGHTSSVSCIKWGGQ--GVLYSGSHDKTIRAWDMNLGG 310

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 79/152 (51%), Gaps = 6/152 (3%)

Query: 169 NPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKT 228
           N ++E  +++ASDD T+ LW+   + +P++ +  H  +VN   +     +I  + S D +
Sbjct: 367 NGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIV-SASFDNS 425

Query: 229 LQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMA 288
           +++ + R     +        +  +A+S   + L+ +   DT + ++D++     +  + 
Sbjct: 426 IKLWNGRDGKFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVKTKKLAVD-LP 483

Query: 289 GHQDAVTSIEFSSHKDG-ILCSSGSDRRLFIW 319
           GH+D V ++++S   DG  +CS G D+ + +W
Sbjct: 484 GHKDEVYTVDWSV--DGKRVCSGGKDKMVRLW 513

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 59/138 (42%), Gaps = 25/138 (18%)

Query: 254 AFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS- 312
           AF+ H+ + +     D    ++D      P+ T+ GH + V  + +S   DG L ++GS 
Sbjct: 150 AFAPHTSSRMITGAGDNTARIWDCN-TQTPMSTLKGHFNWVLCVSWSP--DGELIATGSM 206

Query: 313 DRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNP-------QVPWLIA 365
           D  + +W+       + Q   D           GH   I   S+ P       Q P L A
Sbjct: 207 DNTIRLWE-----GNKGQPVGD--------ALRGHGKWITSLSWEPIHLVKPGQKPRL-A 252

Query: 366 SAEEDNVVQVWKISKKLV 383
           SA +D  +++W  ++++ 
Sbjct: 253 SASKDGTIKIWDTTRRVC 270

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 90/193 (46%), Gaps = 17/193 (8%)

Query: 185 VALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
           + LWD N + +P++ +    D ++  K+++ + +I  +   D +L ++D R+ S + +++
Sbjct: 195 IQLWDSNRS-KPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIV 253

Query: 245 PVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKD 304
              +  NA+ ++         A  D   Y YD+R +S  L+    H  AV  ++FS   D
Sbjct: 254 QTMRT-NAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGD 312

Query: 305 GILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLI 364
            I+  S  D+ + I++ T   + +             + H      +    F+    +++
Sbjct: 313 EIVTGS-YDKTIRIFNTTHGHSRE-------------IYHTKRMQHVFQVKFSMDAKYIV 358

Query: 365 ASAEEDNVVQVWK 377
           + +++ N V++W+
Sbjct: 359 SGSDDGN-VRLWR 370

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 5/112 (4%)

Query: 133 INGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINS 192
           + G  KI ++D ++SK       LS+  DN   + FN      L SA  D ++ L+D+ +
Sbjct: 189 VTGGAKIQLWDSNRSKP---LTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRT 245

Query: 193 TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVL 244
                 IV   T   N   W+  +   F   +ED     +D R++S +  V 
Sbjct: 246 NSPTQKIV--QTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVF 295

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 108/249 (43%), Gaps = 33/249 (13%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDR----PVSIVMNHTDIV 207
           L  TL  H      LA +      L+SAS D T+  W +   D+    PV     H  IV
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIV 67

Query: 208 NDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267
            D      D     + S DKTL++ +  +     +    +  + ++A  + + ++I +  
Sbjct: 68  QDCA-LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKA-SMIISGS 125

Query: 268 TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHK-----DGILCSSGSDRRLFIWDLT 322
            D  + ++ ++   + L T+ GH D V+ +  + ++     +  L S+GSD+ +  W++ 
Sbjct: 126 RDKTIKVWSIK--GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNIN 183

Query: 323 QIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKL 382
           Q      Q +AD           GH + IN  + +P    L+ASA +D  + +W + +K 
Sbjct: 184 QF-----QIEAD---------FVGHNNYINSITASPDGS-LVASAGKDGDIMLWNLKQK- 227

Query: 383 VSNIIPEYT 391
                P YT
Sbjct: 228 ----TPLYT 232

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 80/190 (42%), Gaps = 36/190 (18%)

Query: 168 FNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDK 227
           +NP     L+S+S DTT  +WD+ S +   + ++ H   V D ++      +F +   D 
Sbjct: 251 WNPIDTNFLISSSIDTTCIVWDLQSNNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 310

Query: 228 TLQVHDKRSLSNSAQVLP---------------VEKP--LNA------------------ 252
           +++V D RSL++S  +                 V+ P  LN                   
Sbjct: 311 SVRVFDLRSLAHSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKSNALLR 370

Query: 253 LAFSKHSKNLIAAAGTDTR-VYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG 311
           L  S    N+IA  G D+  V + D+R    P+ T+ GH   +  I++   K   + SS 
Sbjct: 371 LEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTILSSS 430

Query: 312 SDRRLFIWDL 321
            D ++  W+L
Sbjct: 431 DDCQVLYWNL 440

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 87/190 (45%), Gaps = 15/190 (7%)

Query: 149 SEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVN 208
           S  L ++ S+  +N + L   P  +  LL+   +  + L D NS      I  + T I N
Sbjct: 3   SYSLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI-N 60

Query: 209 DSKWHEFD---ENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAA 265
           D K  + D    ++  + S D  ++V D R+   +A V  +    N+   S  S++ + A
Sbjct: 61  DLKVIDSDFAAGHLVSSASID-AVKVFDIRT---NACVAKIHNEANSPFISLDSRHGLLA 116

Query: 266 AGT-----DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIW 319
            GT     D  VY+YD+RR   PL ++   H D VT I+F      +L S  +D    I+
Sbjct: 117 CGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIY 176

Query: 320 DLTQIGAEQA 329
           DL Q   E A
Sbjct: 177 DLKQDEEEDA 186

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 117/248 (47%), Gaps = 32/248 (12%)

Query: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVND-- 209
           L + ++ H      +A +P       + S+DTT+ +WD+ +T +    +  H   V D  
Sbjct: 121 LMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDL-ATGKLKLTLSGHIMTVKDIC 179

Query: 210 -SKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNAL-AFSKH-SKNLIAAA 266
            SK H +   +F + SEDK ++  D   L  +  +      L+ +     H + NLIA A
Sbjct: 180 ISKRHPY---MF-SASEDKLVKCWD---LEKNRVIRDYHGHLSGVHTVDIHPTLNLIATA 232

Query: 267 GTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGA 326
           G D+ V L+D+ R   P+ TMAGH+  +  ++     D  + S  +D  + +WD+T    
Sbjct: 233 GRDSVVRLWDI-RTKLPVMTMAGHKSPINRVKCLP-VDPQVVSCSADATVRLWDITA--- 287

Query: 327 EQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISK-KLVSN 385
                    G    ++ H  H+ ++ D   +P   + I+SA  D+ ++ WK+ + +L++N
Sbjct: 288 ---------GKTLKVLTH--HKRSVRDIGIHPG-EFSISSACTDD-IRSWKLPEGQLLTN 334

Query: 386 IIPEYTDL 393
              E T +
Sbjct: 335 FQSEKTGI 342

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 77/175 (44%), Gaps = 12/175 (6%)

Query: 164 YGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI----VNDSKWHEFDENI 219
           + L   P     LLS+  +  V L D N+ +   ++   +T I    V DS   ++D   
Sbjct: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDS---DYDNGS 73

Query: 220 FGTVSEDKTLQVHDKRSLSNSAQV-LPVEKPLNALAFSKHSKNLIAA---AGTDTRVYLY 275
             +V+ +  ++V D R   NS    L  EK    L+       L      +G D  +++Y
Sbjct: 74  VFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIY 133

Query: 276 DLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA 329
           D+R   +P+  +   H D VT I+F      +L S  +D    ++DLTQ+  E A
Sbjct: 134 DIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDA 188

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 77/195 (39%), Gaps = 46/195 (23%)

Query: 129 IIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALW 188
           +++T N K    I++ +K+ S  +   L  H      + F+PQ    L + S DT V  W
Sbjct: 85  VVSTSNQKA--IIWNLTKTSSNAIEYVLHGHSRAITDINFSPQHPDILATCSIDTYVHAW 142

Query: 189 DINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248
           D+ S  RP     +        KW+  D NI                             
Sbjct: 143 DMRSPQRPFYSTSSWKSSAAQVKWNHSDVNI----------------------------- 173

Query: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308
                        + ++ G D  V+++DLR  S PL  ++ H+ +V SI+F+  +   + 
Sbjct: 174 -------------MASSHGDD--VFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIM 218

Query: 309 SSGSDRRLFIWDLTQ 323
           SS +D  +  WD ++
Sbjct: 219 SSSNDGTVKFWDYSR 233

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 65/146 (44%), Gaps = 14/146 (9%)

Query: 248 KPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           + +  + FS    +++A    DT V+ +D+R    P ++ +  + +   ++++     I+
Sbjct: 115 RAITDINFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWNHSDVNIM 174

Query: 308 CSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASA 367
            SS  D  +FIWDL             +G   L  + + H S++N   FN      I S+
Sbjct: 175 ASSHGDD-VFIWDLR------------NGSTPLFKL-SSHESSVNSIDFNRFRSTEIMSS 220

Query: 368 EEDNVVQVWKISKKLVSNIIPEYTDL 393
             D  V+ W  S+ +  ++   +TD 
Sbjct: 221 SNDGTVKFWDYSRNVEDSLRTIHTDF 246

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 62/137 (45%), Gaps = 15/137 (10%)

Query: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRR-LSEPLHTMAGHQDAVTSIEFSSH 302
           L V+   NA++ +   ++++ A+     +Y+ DL    S P          V  +++S H
Sbjct: 21  LKVDGGFNAVSINPSGRDVVLASRQG--LYIIDLDDPFSPPRWLYHATSWQVADVQWSPH 78

Query: 303 -KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVP 361
                   S S+++  IW+LT+  +   +           ++H GH  AI D +F+PQ P
Sbjct: 79  PAKPYWVVSTSNQKAIIWNLTKTSSNAIE----------YVLH-GHSRAITDINFSPQHP 127

Query: 362 WLIASAEEDNVVQVWKI 378
            ++A+   D  V  W +
Sbjct: 128 DILATCSIDTYVHAWDM 144

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 88/194 (45%), Gaps = 12/194 (6%)

Query: 130 IATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWD 189
           +A   G G + IYD  K K     +TLS H D    L++N  I   L S S D  +   D
Sbjct: 306 LAVGQGNGLVEIYDIVKRK---CIRTLSGHMDRVACLSWNNHI---LTSGSRDRKILHRD 359

Query: 190 INSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKP 249
           +   +     V  HT  V   KW+  DEN   +   D  + V+D  S   + ++      
Sbjct: 360 VRMPEPYFEQVETHTQEVCGLKWNT-DENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAA 418

Query: 250 LNALAFSKHSKNLIAAAG--TDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGIL 307
           + A+A+S H + ++A  G   D ++ ++++   ++      G Q  V ++ +S + + ++
Sbjct: 419 VKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGSQ--VCNMIWSKNTNELV 476

Query: 308 CSSGSDR-RLFIWD 320
            S G  R  L +WD
Sbjct: 477 TSHGYSRYNLTLWD 490

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 113/272 (41%), Gaps = 68/272 (25%)

Query: 166 LAFNPQIEGELL-SASDDTTVALWDINSTDRPVSIVMNH-TDIVNDSKWHEFDENIFGTV 223
           + F+P  +G+ L + ++D  + +WDI +  + V ++  H  DI +   +   D+ + G  
Sbjct: 381 VCFSP--DGKFLATGAEDRLIRIWDI-AKKQIVMVLQGHEQDIYSLDYFPSGDKLVSG-- 435

Query: 224 SEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYD------L 277
           S D+T+++ D R+    +  L +E  +  +A S      IAA   D  V ++D      +
Sbjct: 436 SGDRTVRIWDLRT-GQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLV 494

Query: 278 RRLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGS-DRRLFIWDLT-------------- 322
            RL        GH+D+V S+ F+   +G++  SGS DR + +W+L               
Sbjct: 495 ERLDSENELGTGHKDSVYSVVFTRDGNGVV--SGSLDRSVKLWNLRGDKNNSSSGKPTPG 552

Query: 323 --------------QIGAEQAQE--------------DADDGVPELMMMHAGHRSAI--- 351
                          +   Q  +              D   G P LM+   GHR+++   
Sbjct: 553 TCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQ--GHRNSVISV 610

Query: 352 ---NDFSFNPQVPWLIASAEEDNVVQVWKISK 380
              N F   PQ   + A+   D   ++WK +K
Sbjct: 611 AVANGFPLGPQY-GVFATGSGDCKARIWKYTK 641

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 105/238 (44%), Gaps = 18/238 (7%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDEN 218
           H ++   +AF+   + + ++ SDD  + +W+ ++  +   +  +H D V    WH  +  
Sbjct: 176 HTESIRDMAFSSN-DSKFVTCSDDNILKIWNFSNGKQERVLSGHHWD-VKSCDWHP-EMG 232

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
           +  + S+D  +++ D RS +  + +L  +  +    F     NL+ A   D    ++D+R
Sbjct: 233 LIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVP 338
              + L  +    D +T +E+    + +   +  D  L  +DL Q   E          P
Sbjct: 293 YSMKELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQNLNE----------P 341

Query: 339 ELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
            L + +A H   I   S+NP V  + A+A +D  ++ W  ++ +  N    P Y + K
Sbjct: 342 ILTIPYA-HDKCITSLSYNP-VGHIFATAAKDRTIRFWTRARPIDPNAYDDPTYNNKK 397

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 85/176 (48%), Gaps = 11/176 (6%)

Query: 155 TLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHE 214
           ++++  DN + L   P     LL++  + +V L D    ++ +S +  H   ++D     
Sbjct: 8   SINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDW-VKNKQISQIQAHGTTISDMVVLN 65

Query: 215 FDEN---IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAA---AGT 268
            D N   +  T +ED ++++ D RS S++   L  EK    L+       L      +G 
Sbjct: 66  NDRNNGFLIATAAED-SVKIFDLRS-SDTVATLKNEKSAPFLSLDSRHGMLACGTELSGV 123

Query: 269 DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQ 323
           D  +++YD++   +PL ++   H D +T+I+F      +L S  +D  + I+DLTQ
Sbjct: 124 DAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQ 179

>NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON}
           Anc_7.356 YLR196W
          Length = 581

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 82/170 (48%), Gaps = 8/170 (4%)

Query: 157 SYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-VNDSKWHEF 215
           ++H D    L+ N Q    L S S D TV LWD+N+     S+   H+   V+ S+WH  
Sbjct: 288 THHTDAILSLSHNKQFRAVLASTSADHTVKLWDLNNGQTARSLASVHSGKNVSASEWHPT 347

Query: 216 DENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNA--LAFSKHSKNLIAAAGTDT-RV 272
           + +I  T   D  + + D R +SN  ++      ++   +  +  +   I   GTD+  +
Sbjct: 348 NGSILLTGGYDSRVALSDVR-ISNEKEMSKYWSVMSGEEIECTTFANENIILCGTDSGNI 406

Query: 273 YLYDLR--RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSG-SDRRLFIW 319
           Y +D+R    S+P+ T+  H   ++++  +S   G++ +    ++ + +W
Sbjct: 407 YSFDIRNNENSKPVWTLKAHDAGISTLSTNSFIPGLMSTGAMGEKAVKLW 456

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 104/238 (43%), Gaps = 18/238 (7%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDEN 218
           H ++   +AF+   + + ++ SDD  + +W+ ++      +  +H D V    WH  +  
Sbjct: 176 HTESIRDMAFSSN-DSKFVTCSDDNILKIWNFSNGKEERVLSGHHWD-VKSCDWHP-EMG 232

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
           +  + S+D  +++ D RS +  + +L  +  +    F     NL+ A   D    ++D+R
Sbjct: 233 LIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRVFDIR 292

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVP 338
              + L  +    D +T +E+    + +   +  D  L  +DL Q          D   P
Sbjct: 293 YSMKELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ----------DLNEP 341

Query: 339 ELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
            L + +A H   I   S+NP V  + A+A +D  ++ W  ++ +  N    P Y + K
Sbjct: 342 VLTIPYA-HDKCITSLSYNP-VGHIFATAAKDRTIRFWTRARPVDPNAYDDPTYNNKK 397

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 81/168 (48%), Gaps = 9/168 (5%)

Query: 166 LAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSE 225
           +AF+P +     +AS D T  LW  +    P+ I   H + V+   +H     +F T S 
Sbjct: 530 VAFSP-LGHYFATASHDQTARLWSCDHI-YPLRIFAGHLNDVDTVSFHPNGTYVF-TGSS 586

Query: 226 DKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLH 285
           DKT ++ D  +  +    L    P+ A A S   +  ++    D  + ++D+    + L 
Sbjct: 587 DKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGR-WLSTGSEDGIINVWDIG-TGKRLK 644

Query: 286 TMAGH-QDAVTSIEFSSHKDG-ILCSSGSDRRLFIWDLTQIGAEQAQE 331
            M GH ++AV S+ +S  K+G +L S G+D  L +WD+ +  AE   E
Sbjct: 645 QMRGHGKNAVYSLSYS--KEGHVLVSGGADHSLRVWDVKKSTAEPGSE 690

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 104/238 (43%), Gaps = 18/238 (7%)

Query: 159 HKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDEN 218
           H ++   +AF+   + + ++ SDD  + +W+ ++  +   +  +H D V    WH  +  
Sbjct: 178 HTESIRDMAFSSN-DSKFVTCSDDNILKIWNFSNGKQERVLSGHHWD-VKSCDWHP-EMG 234

Query: 219 IFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLR 278
           +  + S+D  +++ D RS +  + +L  +  +    F     NL+ A   D    ++D+R
Sbjct: 235 LIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIR 294

Query: 279 RLSEPLHTMAGHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVP 338
              + L  +    D +T +E+    + +   +  D  L  +DL Q          D   P
Sbjct: 295 YSMKELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ----------DLNEP 343

Query: 339 ELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKKLVSNII--PEYTDLK 394
            L + +A H   I   S+NP V  + A+A +D  ++ W  ++    N    P Y + K
Sbjct: 344 ILTIPYA-HDKCITSLSYNP-VGHIFATAAKDRTIRFWTRARPTDPNAYDDPTYNNKK 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,827,122
Number of extensions: 2093433
Number of successful extensions: 10036
Number of sequences better than 10.0: 1079
Number of HSP's gapped: 8297
Number of HSP's successfully gapped: 1880
Length of query: 397
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 285
Effective length of database: 40,638,807
Effective search space: 11582059995
Effective search space used: 11582059995
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)