Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30116.8ON50950927210.0
ACR018C6.8ON47847810401e-136
SAKL0E00792g6.8ON5115149971e-130
TDEL0G046306.8ON5035108581e-109
Kpol_1045.796.8ON5085167291e-89
NDAI0G00860singletonON5235327161e-87
KAFR0B065106.8ON5085216993e-85
TPHA0J002606.8ON5155156993e-85
KNAG0E027706.8ON5085216905e-84
Skud_16.56.8ON5155236498e-78
CAGL0A01089g6.8ON5355426448e-77
Smik_6.4806.8ON5165236314e-75
YPL272C6.8ON5175236305e-75
Suva_16.336.8ON5185236305e-75
KLTH0C11572g6.8ON5185336001e-70
TPHA0M001806.8ON5035195931e-69
NCAS0D021806.8ON5155265381e-61
Kwal_56.223416.8ON5195254953e-55
TBLA0A072206.8ON5095324583e-50
Kpol_1032.1singletonON2462402352e-21
CAGL0K00737g5.119ON4572591082e-04
Kpol_191.16.8ON1391381012e-04
Ecym_24835.119ON461139780.57
Kwal_33.150415.184ON52289741.9
TDEL0E051105.119ON469310722.9
ZYRO0F07634g8.688ON744129705.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3011
         (509 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...  1052   0.0  
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   405   e-136
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   388   e-130
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   335   e-109
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   285   1e-89
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              280   1e-87
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   273   3e-85
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   273   3e-85
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   270   5e-84
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   254   8e-78
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   252   8e-77
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   247   4e-75
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   247   5e-75
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   247   5e-75
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   235   1e-70
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   233   1e-69
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      211   1e-61
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   195   3e-55
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   181   3e-50
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...    95   2e-21
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    46   2e-04
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    44   2e-04
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    35   0.57 
Kwal_33.15041 s33 (927424..928992) [1569 bp, 522 aa] {ON} YGR177...    33   1.9  
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    32   2.9  
ZYRO0F07634g Chr6 (618348..620582) [2235 bp, 744 aa] {ON} simila...    32   5.8  

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/509 (100%), Positives = 509/509 (100%)

Query: 1   MATIASSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRL 60
           MATIASSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRL
Sbjct: 1   MATIASSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRL 60

Query: 61  FDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGI 120
           FDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGI
Sbjct: 61  FDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGI 120

Query: 121 PPYILRNILENNKFEFGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFP 180
           PPYILRNILENNKFEFGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFP
Sbjct: 121 PPYILRNILENNKFEFGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFP 180

Query: 181 KDTHALDILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCISVLKGAYRTTVKKSLNV 240
           KDTHALDILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCISVLKGAYRTTVKKSLNV
Sbjct: 181 KDTHALDILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCISVLKGAYRTTVKKSLNV 240

Query: 241 IRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMT 300
           IRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMT
Sbjct: 241 IRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMT 300

Query: 301 SVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFDLGVSYTNLMVECPLSFINDKDF 360
           SVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFDLGVSYTNLMVECPLSFINDKDF
Sbjct: 301 SVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFDLGVSYTNLMVECPLSFINDKDF 360

Query: 361 QHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDMSSLK 420
           QHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDMSSLK
Sbjct: 361 QHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDMSSLK 420

Query: 421 GKKLRRSNKIIRGKFIEINLVDMGEAQDGQFHTKNVNFTSSLGSKCLISVSCAILRGVGM 480
           GKKLRRSNKIIRGKFIEINLVDMGEAQDGQFHTKNVNFTSSLGSKCLISVSCAILRGVGM
Sbjct: 421 GKKLRRSNKIIRGKFIEINLVDMGEAQDGQFHTKNVNFTSSLGSKCLISVSCAILRGVGM 480

Query: 481 NIFMHYPESNDMDAFVECFQILLEDLAKK 509
           NIFMHYPESNDMDAFVECFQILLEDLAKK
Sbjct: 481 NIFMHYPESNDMDAFVECFQILLEDLAKK 509

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  405 bits (1040), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 222/478 (46%), Positives = 298/478 (62%), Gaps = 35/478 (7%)

Query: 42  ESERWSDDITLSNLRDSRLFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVV 101
           E E WSD  TL + R   L + QIS+AL +MI+ENVE+CVT+TD  KFAP   I YDDVV
Sbjct: 24  EQETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVV 83

Query: 102 IHIEFKTYKDELIECQNGIPPYILRNILENNKFEFGRPLWELIIVDYTMVILHCHEVMFD 161
             IEF+TYKDE I C +GIPPY+ R+IL  +KFE G+PLWE+ I D +MVI HCH V+FD
Sbjct: 84  RVIEFQTYKDEAIACHDGIPPYVARHILNKSKFEAGKPLWEVYIADGSMVIFHCHNVLFD 143

Query: 162 LFAAANFHLKFQKALSQFPKDTHALDILFVYEGNELQLS-KTNFDGMSQISVSPVQSLPL 220
           LFAA NFH++FQ+AL +  K+    + LFVYEG  LQL    +   +  + V    S P 
Sbjct: 144 LFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASSPF 203

Query: 221 ------QCISVLK--GAYRTTVKKSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNTLC 272
                  C   LK  GA  + V  SL + R +      + T +              +L 
Sbjct: 204 VSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDK------------ESLY 251

Query: 273 GTTVSGSLNAERLASLLELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIR- 331
           GTTVSG LN+++L SLL+L S E VC+ S LCAITLLSLKPLIR F+GSI F +P+D+R 
Sbjct: 252 GTTVSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRT 311

Query: 332 EKLEIFDLGVSYTNLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQF 391
           E  +    G     ++V+CPL+ I+D+ F+   +  + +   K+D NSP + E LLEYQF
Sbjct: 312 ESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQF 371

Query: 392 KQLTSHVMNSLKEKKQA-WQ-KRRFDMSSLKGKKLRRSNKIIRGKFIEINLVDMGEAQDG 449
           K++T+HVM SL  +    W  KR++    L+ KK+           IEIN+VDMG +   
Sbjct: 372 KRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKKI-----------IEINVVDMGTSPSA 420

Query: 450 QFHTKNVNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLEDLA 507
           +F  KN+NFT SLGS+  +S+SCA++RGVGMN+ MHY E + MD FV+CFQ  L++L+
Sbjct: 421 RFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDELS 478

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  388 bits (997), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 208/514 (40%), Positives = 316/514 (61%), Gaps = 21/514 (4%)

Query: 7   SIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQIS 66
           S R LSSVEK    +   ++RNG++FA  YS+   + E WSD+ TL  ++D RL +  +S
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65

Query: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126
            AL+ +I  NVEL  TI D+ +F P + I +DDVV  +EF +YKDEL+ C +G+PPY+LR
Sbjct: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125

Query: 127 NILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTH 184
           +I + NKFE    +PLW+++IVD TMVI H H+V+FD+FAAANFH  FQ+AL+Q PKD  
Sbjct: 126 HIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDGP 185

Query: 185 ALDILFVYEGNELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTVKKSLNVIRR 243
            L+ LF  +       K+ ++    ++         LQ  S  K  Y  T+KK L+ I  
Sbjct: 186 TLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFINT 245

Query: 244 NFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMTSVL 303
           N   N+ +  Y+S  +D+   +   N LCGTTV G+++AER+ +L ++   EN+C++S +
Sbjct: 246 N--PNSGLKYYQSCYTDI---LLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFV 300

Query: 304 CAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYTNLMVECPLSFINDKDFQH 362
           CAI LL LKPL+  F  S+TF +P+D+R  + +    G+ Y N++VECPL+ I+DK FQ 
Sbjct: 301 CAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQG 360

Query: 363 -TVSDG----NIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDMS 417
             V +G    N K  +K     P+Y E LLEYQF++  +HV N+LK++ +AW++  F+  
Sbjct: 361 LNVYNGYDIRNTKPTNK----DPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDD 416

Query: 418 SLKGKKLRRSNKIIRGKFIEINLVDMGEAQ---DGQFHTKNVNFTSSLGSKCLISVSCAI 474
            +K  K  ++ +    + IE+N V   +     +  F+ K+V FT S   +  +S+SCA 
Sbjct: 417 DIKRMKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAF 476

Query: 475 LRGVGMNIFMHYPESNDMDAFVECFQILLEDLAK 508
               G+N+ +HYP+  +MD FVECFQ  +E+L++
Sbjct: 477 SERSGLNVCIHYPDGYNMDVFVECFQSFMEELSQ 510

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  335 bits (858), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/510 (37%), Positives = 285/510 (55%), Gaps = 20/510 (3%)

Query: 7   SIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQIS 66
           S R L   EK    +     RNG+VF   YS+     E WSDD TL   +DSRL    +S
Sbjct: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT---PEEWSDDATLLTYKDSRLNLSLLS 58

Query: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126
             L  MI ++VEL  TI +  +FAP + I+ ++V+  + F +YKDE + C+ G PPY+LR
Sbjct: 59  RTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLR 118

Query: 127 NILENNKFEFGRP--LWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTH 184
           +I     F+ G    LW++ +VD T+V+ H H+V+FD+F+AANFH  F + L+   K   
Sbjct: 119 HIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGS 178

Query: 185 ALDILFVYEGNEL-QLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTVKKSLNVIR 242
            L  +F  E   L    K+ +D    ++         LQ  S  K  Y   VKK L+ I 
Sbjct: 179 KLSTIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYIN 238

Query: 243 RNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMTSV 302
            N     Q+  Y +  +D+ ++    N LCGTT+ G +  +RL SL  +   +N+C+ S 
Sbjct: 239 SN--PPQQLKEYRTRYADILRT---DNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSF 293

Query: 303 LCAITLLSLKPLIRKFNGSITFVVPIDIREKLEI-FDLGVSYTNLMVECPLSFINDKDFQ 361
           +C IT+L LKP+++ + GSITF VP+D+R  LE   + G+ Y ++ VECPLS I+DK+F 
Sbjct: 294 VCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFN 353

Query: 362 H-TVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDMSSLK 420
             TV +G   S  K+    P Y E LLEYQFKQ+T HV+ +L+++ +AW+K  F+   +K
Sbjct: 354 SLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIK 413

Query: 421 GKKLRRSNKIIRGKFIEIN-----LVDMGEAQDGQFHTKNVNFTSSLGSKCLISVSCAIL 475
             K    +     K I+IN      VD  E   G+FH + +N T SL    L+S+S    
Sbjct: 414 RMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYTHS 473

Query: 476 RGVGMNIFMHYPESNDMDAFVECFQILLED 505
              G++I +HYP+  +M++FVECFQ  +ED
Sbjct: 474 EK-GLDICIHYPDGYNMESFVECFQSFIED 502

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  285 bits (729), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 174/516 (33%), Positives = 277/516 (53%), Gaps = 27/516 (5%)

Query: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQI 65
           +S R L + EK    +    + NGI+F+  Y SN    +  +DD TL    +  L D ++
Sbjct: 2   TSFRQLGTYEKKLVGQALAGQSNGIIFSAKYISNA--QDGLTDDATLLTNSEPLLLDSRL 59

Query: 66  SNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYIL 125
            NAL+ M+ ++ EL  T+ +  +F   + I+  D++  ++F + KDE + C  G PPY+L
Sbjct: 60  VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLL 119

Query: 126 RNILENNKFE--FGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDT 183
           R+I   NKF    G+PLWEL ++D ++V+ H  +V+FD+FAAANFH  F + L+    D 
Sbjct: 120 RHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSM-DDE 178

Query: 184 HALDILFVYE------GNELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTVKK 236
           H  D+ ++Y          +   +T ++    +I    +  + LQ  S  K  Y   +KK
Sbjct: 179 HITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKK 238

Query: 237 SLNVIRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSEN 296
            L++I  N      I      K +    M   + LCGTTV G +  +R   L  +   EN
Sbjct: 239 PLDIITFNSEPMKYI------KPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHEN 292

Query: 297 VCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLE-IFDLGVSYTNLMVECPLSFI 355
           VC+ S +C I LL LK +I+ F GSITF +P+++RE +E   D G+ Y  ++VECPLS I
Sbjct: 293 VCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLI 352

Query: 356 NDKDFQH-TVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRF 414
           +D+ + +  V +G   S  K+    P + E  LEYQFKQ++  V  ++KE+ +AW++  F
Sbjct: 353 DDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNGF 412

Query: 415 DMSSLKGKKLRRSNKIIRGKFIEINLVDMGE-----AQDGQFHTKNVNFTSSLGSKCLIS 469
           +   +K  K    +K    K I+IN  D+ E     ++  +   K +NFT S+ +   +S
Sbjct: 413 NDDDIKKMKFTSDDKASNTKIIQIN--DVSEFKINSSKSSKVSIKELNFTHSISNSDFMS 470

Query: 470 VSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505
           +S    +  G NI +HYP++ DM+ FVE FQ  + D
Sbjct: 471 LSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  280 bits (716), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 179/532 (33%), Positives = 284/532 (53%), Gaps = 43/532 (8%)

Query: 7   SIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESE--RWSDDITLSNLRDSRLFDGQ 64
           SIR LSS EK    +   S+RNGI +   Y S    S     SD  TL   +D RL  G 
Sbjct: 2   SIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIGI 61

Query: 65  ISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYI 124
           ++  LE +IK+++EL  TI ++ +F     I+ +DV+  I F TYKDE I C +G PPY+
Sbjct: 62  VTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPYL 121

Query: 125 LRNILENNKFEFGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQF----- 179
           LR+I    KFE  +PLW+L I+D TM+I H  +++FD+F+AANFH  F   L+ +     
Sbjct: 122 LRHIFNKEKFELNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFLTNT 181

Query: 180 --PKDTHALDILFVYEGNELQLSKTNF-----DGMSQISVSPVQSLP--------LQCIS 224
               ++  LD++F     ++ +S  NF     +    I  +P   LP        LQ  S
Sbjct: 182 FSKSNSKPLDVVF-----KINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKS 236

Query: 225 VLKGAYRTTVKKSLNVIR-RNFVANNQITTY--ESSKSDVFKSMFNPNTLCGTTVSGSLN 281
             K  Y  T+KK +++    N    N IT+   E    +    +   ++LCGTTV G+++
Sbjct: 237 FFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVS 296

Query: 282 AERLASLLELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLE-IFDLG 340
             R   L  +   + +C+ S +C I ++ LKP I+ ++G+I F +PI++R  ++   + G
Sbjct: 297 PTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFG 356

Query: 341 VSYTNLMVECPLSFINDKDFQHT-VSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVM 399
           + Y ++ ++CPLS I+D++F++    D +I      D N  ++ E LLEYQFKQ+T  + 
Sbjct: 357 LFYKDVKIDCPLSLIDDRNFKYNGYKDSSIP-----DENDLEFNEKLLEYQFKQVTEFIE 411

Query: 400 NSLKEKKQAWQKRRFDMSSLKGKKLRRSNKIIR-GKFIEIN-----LVDMGEAQDGQFHT 453
           N + E+ + W+K  F+   +K  K      + +  K I+IN     ++   +  +  F  
Sbjct: 412 NVILERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLGENDNNNKAFTL 471

Query: 454 KNVNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505
            N NFT +L     +SVS AI    G+N+ +HYP+   M+ FVECFQ  +E+
Sbjct: 472 TNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIEE 523

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  273 bits (699), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 175/521 (33%), Positives = 281/521 (53%), Gaps = 37/521 (7%)

Query: 7   SIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQIS 66
           ++R LSS E+    E     RNG++F  +YS++   SE W DD TL  L+DSR     ++
Sbjct: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSAS---SEEWGDDTTLLTLKDSRPTIAILT 58

Query: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126
            A++ +I  +VEL  TI ++ +F   + I+ DD++  +EF +YKDE I C NG PPY+LR
Sbjct: 59  KAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLR 118

Query: 127 NILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFH---LKFQKALSQFPK 181
           +I +NN+F  G  +PLW L I+D ++VI H  +++FD+F+AANFH   LK    ++  P 
Sbjct: 119 HIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPL 178

Query: 182 DTHALDILFVYEG-----NELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTVK 235
           D+   DI+F  E      N L+LSK+ +D     +  +      LQ  S  K  + +TVK
Sbjct: 179 DSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVK 238

Query: 236 KSL-----NVIRRNFVANNQITTYESSKSDVFKSMFNPN-TLCGTTVSGSLNAERLASLL 289
           K +     NV  +   ++N ++   + +   +  +F+ N TL  TTV G +  +R   L 
Sbjct: 239 KPIHYLVANVRTKEVTSDNTLSRVTTVQK--YTDIFDYNTTLNNTTVFGKITRQRYEYLN 296

Query: 290 ELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEI--FDLGVSYTNLM 347
            L +++ +C  S +  I +L LKP I  F GS+ F + I++R  L+    + G+ Y +++
Sbjct: 297 SLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVL 356

Query: 348 VECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQ 407
           ++ PLS I+D           +        N PD  E +LE+QFK++TS V + ++ +  
Sbjct: 357 IDVPLSLIDDNAVM-------LSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRIS 409

Query: 408 AWQKRRF---DMSSLKGKKLRRSNKIIRGKFIEINLVDMGEAQ-DGQFHTKNVNFTSSLG 463
            +    F   D+  +K  K     KIIR    + + V +G  + DG++   N NFT SL 
Sbjct: 410 KFSTMGFNDDDIRQMKYGKPAEDTKIIR--LFDTSEVSLGSGKRDGKYILHNTNFTKSLR 467

Query: 464 SKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504
                SVS  +    G+N+ + +P+  DM+AFVECFQ  +E
Sbjct: 468 KNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  273 bits (699), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 175/515 (33%), Positives = 276/515 (53%), Gaps = 26/515 (5%)

Query: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQISNA 68
           R L+S E+    E Y ++ NG +F+  Y+  +  S    D  TL    +      +  NA
Sbjct: 4   RPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFINA 63

Query: 69  LEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRNI 128
           L  +I EN EL  TI    +F P   I+ DDV+  I+F + KDE + C+NG PPY+LR+I
Sbjct: 64  LATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLRHI 123

Query: 129 LENNKF--EFGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTHAL 186
              +KF    G+PLW L IVD ++VI H  +V+FD+++AA+FH KF  AL      +  L
Sbjct: 124 FNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTSEKL 183

Query: 187 DILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCISV--------LKGAYRTTVKKSL 238
             +F    ++L  S   +     I  SP+  LP + I +        LK     T+ K L
Sbjct: 184 TTIF--RLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVKPL 241

Query: 239 NVIRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVC 298
           N+I  N       T      SD    +   ++LCGTTV G+++ ER   L  +   ENVC
Sbjct: 242 NIIMFNDEPMKSFT-----NSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVC 296

Query: 299 MTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYTNLMVECPLSFIND 357
             S++C IT+L LKPLI+ F+ +ITF + +++R+ + E  + G+ Y N+ +E PLSFI+D
Sbjct: 297 TKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDD 356

Query: 358 KDFQ-HTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKRRFDM 416
             F+  T  +G   S   I   +P+Y E L+ YQF Q+ + +  +LK++ +AW++  F+ 
Sbjct: 357 NVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWRRNGFND 416

Query: 417 SSLKGKKLRRSNKIIRGKFIEIN-LVDMG---EAQDGQFHT---KNVNFTSSLGSKCLIS 469
             +K  K    +K    K I+IN + D+      ++G+ ++   K+++FT SL     +S
Sbjct: 417 DDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTHSLVPDQFMS 476

Query: 470 VSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504
           +S    +  G NI +H+PE  D++ FVE FQ  ++
Sbjct: 477 LSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  270 bits (690), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 175/521 (33%), Positives = 283/521 (54%), Gaps = 37/521 (7%)

Query: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDD-ITLSNLRDSRLFDGQ 64
           SS+R LSS EK    +     +NG  F   YS+ K   E WSD+  TL  ++DSRL  G 
Sbjct: 2   SSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFK---EGWSDEEATLLTVKDSRLCLGL 58

Query: 65  ISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYI 124
           ++ ALE +IK+++EL +TI +  +F   + I+  DV+  I+F ++KDE I CQ G PPY+
Sbjct: 59  LTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYL 118

Query: 125 LRNILENNKF--EFGRPLWELIIVDYTMVILHCHEVMFDLFAAANFH---LKFQKALSQF 179
           LR+I  +++F    G+PLW+L ++D ++   H  + +FD+F+ ANFH   LK    LS  
Sbjct: 119 LRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSR 178

Query: 180 PKDTHALDILFVYEGNEL----QLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYRTTV 234
           P+    LD +F +  + +    QL K+ +D     I         LQ  S  K  Y  TV
Sbjct: 179 PQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTV 238

Query: 235 KKSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNT-LCGTTVSGSLNAERLASLLELTS 293
           KK +      F+ N  ++    + +  +  + + N+ LCG TV G ++ ER   L  + +
Sbjct: 239 KKPI-----EFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIIN 293

Query: 294 SENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYTNLMVECPL 352
            E +C+ S +  I +L LKP+++  +G++TF +P+D+R  + E  D G+ Y ++ VECPL
Sbjct: 294 QEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPL 353

Query: 353 SFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKR 412
           S I+D   +  +   ++        +  D+ E L+EYQFK +T  V N L+++   + K 
Sbjct: 354 SLIDDDKSKDCMKGASV--------SEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKT 405

Query: 413 RFDMSSLKGKKLRRSNKII----RGKFIEI---NLVDMGE-AQDGQFHTKNVNFTSSLGS 464
            F+   ++  K    N +      G FI+I   +L+++ E  +   F  +  N T SL S
Sbjct: 406 GFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNS 465

Query: 465 KCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505
           + L+S+S       G+NI +HYPE+  M++FVECFQ  LE+
Sbjct: 466 EELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  254 bits (649), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 162/523 (30%), Positives = 283/523 (54%), Gaps = 33/523 (6%)

Query: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSS--NKCESERW-SDDITL---SNLRDSR 59
           ++ R LSS EK    +    +RNG +F+  YS   N+     W SD++TL   S+  DSR
Sbjct: 2   TTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSR 61

Query: 60  LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNG 119
           L    I+  L+ +IK    L  T+ ++ +F P + ++  D+V  IEF+T KD+ + C  G
Sbjct: 62  LTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWG 121

Query: 120 IPP-YILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKAL 176
           +PP Y+LR+     +F  G  +PLW L ++D  +++ H H+V+FD+F+AANFH  F K L
Sbjct: 122 VPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKEL 181

Query: 177 SQFPKDTHALDILFVYEGNELQLSKTNF------DGMSQISVSPVQSLPLQCISVLKGAY 230
           +    + H+ D + +++ +++ +S  NF           +     Q    Q  S  K  +
Sbjct: 182 NNISLEAHSDDRV-LFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 231 RTTVKKSLNVIRRNFVANNQITTYESSK-SDVFKSMFNPNTLCGTTVSGSLNAERLASLL 289
             T+K+    +          +T +  K +D+  +    ++LCGTTV G +N +R   L 
Sbjct: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAH---SSLCGTTVFGIVNNQRFNYLK 297

Query: 290 ELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-LGVSYTNLMV 348
            + + E++C+ S +C I ++ LKPL++ F G+I F +PID+R+ L++ + LG+ +  L +
Sbjct: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRI 357

Query: 349 ECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQA 408
           ECPLS I+D+     +S     +      +  ++ E L+EYQF ++T HV + +  K ++
Sbjct: 358 ECPLSLIDDE-----LSADEFLANRNDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKS 412

Query: 409 WQKRRFDMSSLKGKKLRRSNKIIRG---KFIEINLV-DMGEAQDGQ---FHTKNVNFTSS 461
           W+K  F+   ++  K    +  I+    K I+IN V D+  + +     F   +  FTSS
Sbjct: 413 WEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSS 472

Query: 462 LGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504
           +    L+S+S      +G+NI +HYP+S ++++FVECF+  +E
Sbjct: 473 INRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  252 bits (644), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 167/542 (30%), Positives = 293/542 (54%), Gaps = 55/542 (10%)

Query: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNY---SSNKCESERWSDD-ITLSNLR-DSR---- 59
           R LSS E+    E+  + +NG VF  +Y    S   +   W DD  TL+  R +SR    
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 60  ----LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIE 115
               L    ++ AL+++I++N E+  T+ D  +FAP + IR  DV+  + F   KDE + 
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 116 CQNG-IPPYILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKF 172
           C +G  PPY++R+IL+N+ F+ G  +PLW L ++D + ++ HC +++FD+F+AANFH  F
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 173 QKALSQF--PKDTH--ALDILFVYEG---NELQLSKTNFDGMS-QISVSPVQSLPLQCIS 224
            K L     P+ ++   L+ LF  +    N   + K+ +D +   +  +  + L LQ  S
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242

Query: 225 VLKGAYRTTVKKSLNVIR----------RNFVANNQITTYESSKSDVFKSMF-----NPN 269
             K  +   VKK L+ I+           N   +  + + E ++  +F++ +     +  
Sbjct: 243 FFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTSAT 302

Query: 270 TLCGTTVSGSLNAERLASLLELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPID 329
           + CG T+ GS++ ER   L  +  +E +C+ S + AIT+L LKP+++ FNG++ F +P++
Sbjct: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362

Query: 330 IREKL-EIFDLGVSYTNLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLE 388
           +R+ + E  D G+ Y ++ VECPLS I+DK            S+  ++ + P+Y E LLE
Sbjct: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQC----------SVPGLNESDPEYNEKLLE 412

Query: 389 YQFKQLTSHVMNSLKEKKQAWQKRRFDMSSLKGKKLRRSNKII--RGKFIEINLVDMGEA 446
            QF+Q+ ++V  S++++   W+K  ++ + +K  K  + ++      + I+IN V     
Sbjct: 413 IQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSF 472

Query: 447 QDGQF---HTKNVNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILL 503
            D      H K+  FT+SL    L+S+S       G+NI +HYP+  +M+ FV+CF+  +
Sbjct: 473 DDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFM 532

Query: 504 ED 505
           E+
Sbjct: 533 EE 534

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  247 bits (631), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 168/523 (32%), Positives = 281/523 (53%), Gaps = 32/523 (6%)

Query: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSN--KCESERW-SDDITL---SNLRDSR 59
           ++ R LSS EK    +    +RNG +F+  YS +  K     W SD++TL   S+  DSR
Sbjct: 2   TTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSR 61

Query: 60  LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNG 119
           L    I+  L+ +IK    L  TI ++ +F P E ++  D+V  IEF+T KD+ + C  G
Sbjct: 62  LTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWG 121

Query: 120 IPP-YILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKAL 176
           +PP Y+LR+     +F  G  RPLW L ++D T+++ H H+V+FD+F+AANFH  F K L
Sbjct: 122 VPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKEL 181

Query: 177 SQFPKDTHALDILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCISVLKGAYRTTVKK 236
           +     TH  D + +++ N + +S  NF     I  S    LP     +     ++  K 
Sbjct: 182 NNISSVTHYEDRI-LFDINNVSISDLNFP--KSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238

Query: 237 SL-NVIRRNFVANNQITTYESSKSDVFKSMFNP-----NTLCGTTVSGSLNAERLASLLE 290
              N ++R F      T+  S  S      +N      ++LCGTTV G ++ +R   L  
Sbjct: 239 IFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKS 298

Query: 291 LTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-LGVSYTNLMVE 349
           + + E++C+ S +C I ++ LKPL++ F+G+I F +PID+R+ L + + LG+ +  L + 
Sbjct: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIA 358

Query: 350 CPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAW 409
           CPLS I+D+     +S     +    +    ++ E L+EYQF  +T HV + +  K ++W
Sbjct: 359 CPLSLIDDE-----LSVNEFLANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSW 413

Query: 410 QKRRFDMSSLKGKKLRRSNKI----IRGKFIEINLV-DMGEA---QDGQFHTKNVNFTSS 461
           +K  F+   ++  K    ++      + K ++IN V D+  +    D  F   +  FTSS
Sbjct: 414 EKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSS 473

Query: 462 LGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504
           +    L+S+S    + +G+NI +HYP+S ++++FVECF+  +E
Sbjct: 474 INRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  247 bits (630), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 168/523 (32%), Positives = 286/523 (54%), Gaps = 31/523 (5%)

Query: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYS---SNKCESERWSDDITL---SNLRDSR 59
           ++ R LSS EK    +    +RNG +F+  YS   S + +++  SD++TL   S+  DSR
Sbjct: 2   TTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSR 61

Query: 60  LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNG 119
           L    I+  L+ +IK    L  T+ ++ +F P + ++  D+V  IEF+T KD+ + C  G
Sbjct: 62  LTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWG 121

Query: 120 IPP-YILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKAL 176
           +PP Y+LR+     +F  G  +PLW L ++D  +++ H H+V+FD+F+AANFH  F K L
Sbjct: 122 VPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKEL 181

Query: 177 SQFPKDTHALD-ILF-VYEGN--ELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYR 231
           ++    TH+ D ILF V + N  EL+  K+ +D     +     Q    Q  S  K  Y 
Sbjct: 182 NEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYY 241

Query: 232 TTVKKSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNT-LCGTTVSGSLNAERLASLLE 290
            T+K+    +      ++ ++  +  K   +  + N +T LCGTTV G +N +R   L  
Sbjct: 242 NTLKRPFGYLTNQTSLSSSVSATQLKK---YNDILNAHTSLCGTTVFGIVNNQRFNYLKS 298

Query: 291 LTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFDLGVS-YTNLMVE 349
           + + E++C+ S +C I ++ LKPL++ F+G+I F +PI++R  L +       +  L VE
Sbjct: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVE 358

Query: 350 CPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAW 409
           CPLS I+D+      ++  + + +  + N  ++ E L+EYQF ++T HV   +  K ++W
Sbjct: 359 CPLSLIDDE----LSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSW 414

Query: 410 QKRRFDMSSLKGKKLRRSNKI----IRGKFIEINLV-DMGEAQDG---QFHTKNVNFTSS 461
           +K  F+   ++  K    +       R K I+IN V D+  + +G    F   +  FTSS
Sbjct: 415 EKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSS 474

Query: 462 LGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504
           +    L+S+S      +G+NI +HYP+S ++++FVECF+  +E
Sbjct: 475 INRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  247 bits (630), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 165/523 (31%), Positives = 294/523 (56%), Gaps = 30/523 (5%)

Query: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSN---KCESERWSDDITL---SNLRDSR 59
           ++ R LSS EK    +    +RNG +F+  YS +   + +++  SD++TL   S+  DSR
Sbjct: 2   TTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSR 61

Query: 60  LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNG 119
           L    I+  L+ +IK    L  T+ +D ++AP + ++  D+V  IEF+T KD+ + C  G
Sbjct: 62  LTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWG 121

Query: 120 IPP-YILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKAL 176
           +PP Y+LR+     +F  G  +PLW L ++D T+++ H H+V+FD+F+AANFH  F K L
Sbjct: 122 VPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKEL 181

Query: 177 SQFPKDTHALD-ILF-VYEGN--ELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYR 231
           +     + + D +LF + + N  EL   K+ +D    ++     Q L  Q  S  K  + 
Sbjct: 182 NSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIFY 241

Query: 232 TTVKKSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNT-LCGTTVSGSLNAERLASLLE 290
            T+K+    +      ++   T +  +   +  + N N+ LCGTTV G +N +R + L  
Sbjct: 242 NTLKRPFGYLTNQTSFSSPAPTSQLKR---YNDILNTNSSLCGTTVFGIVNNQRFSYLKS 298

Query: 291 LTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-LGVSYTNLMVE 349
           + + E++C+ S +C I ++ LKPL++ F+G+I F +PID+R+ L + + LG+ +  L +E
Sbjct: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIE 358

Query: 350 CPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAW 409
           CPLS I+D   + ++++  + S    + ++ ++ E L+EYQF ++T HV N +  K ++W
Sbjct: 359 CPLSLIDD---ELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSW 415

Query: 410 QKRRFDMSSLKGKKLRRSNKI----IRGKFIEINLV-DMGEA---QDGQFHTKNVNFTSS 461
           ++  F+   ++  K    +       + K I+IN V D+  +    D  F   +  FT+S
Sbjct: 416 ERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNS 475

Query: 462 LGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504
           +    L+S+S      +G+NI +HYP+S ++++FVECF+  +E
Sbjct: 476 INRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  235 bits (600), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 160/533 (30%), Positives = 272/533 (51%), Gaps = 43/533 (8%)

Query: 1   MATIASSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRL 60
           M+++    R+L+  EK    E  T  +NG++F+  Y  N   ++  SD+ TL +  + RL
Sbjct: 1   MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKN-FPNKDLSDNETLRSDMNQRL 59

Query: 61  FDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGI 120
            D  I  AL  +IKE+ EL   ++ + +F P + I ++DVV  IEF  Y DE + C NG+
Sbjct: 60  SDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGV 119

Query: 121 PPYILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQ 178
           PPY+LR+I +   F  G  +PLW+L ++D TMV+ H H+V+FD FAAANFH  F +AL+ 
Sbjct: 120 PPYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNS 179

Query: 179 FPKDTHALDILFVYEGNEL--QLSKTNFDGM-SQISVSPVQSLPLQCISVLKGAYRTTVK 235
             +   +     V++G ++   L +  F     Q + S   +   Q  ++L+  Y   +K
Sbjct: 180 LSESCTSPRP--VFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIK 237

Query: 236 KSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSE 295
           K L      F+ + +I       S   + +  PN LCGT V G+++  R   L  + +  
Sbjct: 238 KPL-----RFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDH 292

Query: 296 NVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-LGVSYTNLMVECPL-- 352
            + M + + + TL  L+P++      ITF +PI++R+ +     LG+ + N+++ECPL  
Sbjct: 293 KISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGT 352

Query: 353 ----------SFINDKDFQH--TVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMN 400
                     S++++ +     T+SD N  +  + DP S           F++  +HV N
Sbjct: 353 AGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPES----------LFERTVTHVSN 402

Query: 401 SLKEKKQAWQKRRF-DMSSLKGKKLRRSNKIIRG-KFIEIN---LVDMGEAQDGQFHTKN 455
            LK+  Q  +  +F DM  +K ++  +      G K IEIN    +D+      Q+  ++
Sbjct: 403 ELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVED 462

Query: 456 VNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLEDLAK 508
           +  T S  +   +S+S +     G+N+ +HY E  +M+ FVE F+  LE+  K
Sbjct: 463 ICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLENYPK 515

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  233 bits (593), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 167/519 (32%), Positives = 261/519 (50%), Gaps = 41/519 (7%)

Query: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLR--DSRLFDGQIS 66
           R L   EK    +    RRNG+VF+   + NK   E   D+ TL   R  +       + 
Sbjct: 4   RALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVLC 63

Query: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126
            AL+ +I  +VEL  TI D   F P   I  +DV+  I +   KD+ +  ++ I   +LR
Sbjct: 64  AALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLLR 122

Query: 127 NILENNKFEF----GRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKD 182
           +I   NK +F    G+PLW+  I + + +I H H+V+FD+F+ ANF     K ++     
Sbjct: 123 HIF--NKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNS 180

Query: 183 THALDILFVYEGNELQLSKTNFDGMSQISVSPVQSLP--------LQCISVLKGAYRTTV 234
              L  +      + + S TN+     I  +P   LP        LQ  S  K  Y+ T+
Sbjct: 181 NQKLKTVKTLFKFDAERSLTNYP--RSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTL 238

Query: 235 KKSLNVIRR-NFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTS 293
           KK +++I   N   NNQ++ Y +  +D+       N+LCG TV G ++ ER   L  L  
Sbjct: 239 KKPIDLITSANSNNNNQLSEYRTRNTDILSG---ANSLCGRTVLGEISLERYQHLKMLVE 295

Query: 294 SENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYTNLMVECPL 352
            EN+ + S + AIT++ LKP+++ F+GSI F +P+++R  + +  D G+ Y N+ VECPL
Sbjct: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355

Query: 353 SFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAWQKR 412
             IND+ +       N + LH +  NS      LLE QF++++ HV + + ++ +AW+K 
Sbjct: 356 ELINDEKYY-----TNPEVLHSMQNNS------LLEIQFERISRHVSDVISQRMKAWEKF 404

Query: 413 RFDMSSLKGKKLRRSNKIIRGKFIEINLV-----DMGEAQ-DGQFHTKNVNFTSSLGSKC 466
            F+   +K  K     K      I+IN V     D G       F   N+NFT SL    
Sbjct: 405 GFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNE 464

Query: 467 LISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505
            +S+  +     G+NI +HYP+  +M+AFVECFQ  +E+
Sbjct: 465 FMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  211 bits (538), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 154/526 (29%), Positives = 266/526 (50%), Gaps = 43/526 (8%)

Query: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNYSSN-KCESERWSDDITLSNLRDSRLFDGQISN 67
           R LS  E    ++    +RNG+ FA  Y  N    S   SD+ TL +L+D RL    I+ 
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSVITR 63

Query: 68  ALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRN 127
            L+ +I +++EL   I++D +++    IR  DV+  I F + KDE I C  G PPY+LR+
Sbjct: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123

Query: 128 ILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQF------ 179
           I   + F+ G  +PLW+L I+D T +I H  +++FD F+AA FH  F   ++ +      
Sbjct: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183

Query: 180 PKDTHALDILFVYEG--------NELQLSKTNFDGMSQISVSPVQSLPL--QCISVLKGA 229
            K    LD LF            +E+  S  ++D       +P+ ++    Q  S  K  
Sbjct: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSS---PFAPLTAVMFNDQTKSFFKSL 240

Query: 230 YRTTVKKSLNVIRRNFVANNQITTYESSKSDVFKSMFNP----NTLCGTTVSGSLNAERL 285
           Y   VKK +  I      ++Q+ TY+  K    +   NP     +LCG T+ G++++ R 
Sbjct: 241 YLNAVKKPIEFITN---TSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRF 297

Query: 286 ASLLELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYT 344
             L E  + E + + S++C + ++SLKP +  F+ ++ F + +++R+ + +    G+ Y 
Sbjct: 298 NELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYR 357

Query: 345 NLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKE 404
           ++++ECPLS I+D+  Q +    ++     I     +  E + E QFK +T+++ N + E
Sbjct: 358 DIIIECPLSLIDDRAIQFSGYRDHV----GITAQELETYEKVYEQQFKDVTTYIQNVMNE 413

Query: 405 KKQAWQKRRFDMSSLKGKKLRRSNKIIRGKFIEIN---LVDMGE--AQDGQFHTKNVNFT 459
           K   W K   D+  +K       +K    + I+IN    +D+ E  +Q+  +  K+ +  
Sbjct: 414 KIGYW-KTDNDIKMMKMMDDMHQSK---DEIIQINDLTEIDINENLSQNDPYCVKSSSMV 469

Query: 460 SSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505
           +SL  K + SVS       G+ I +H P+   M++FVE FQ  L++
Sbjct: 470 TSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  195 bits (495), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 148/525 (28%), Positives = 249/525 (47%), Gaps = 42/525 (8%)

Query: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQISNA 68
           R+L++ EK    E     +NG++F+  Y       +  S  ++   +    L D  +  A
Sbjct: 9   RNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKG-LPDAIMWQA 67

Query: 69  LEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRNI 128
           L  +IKEN EL  +I    +F   + I +DDVV  IEF    DE + C NG+PPY+LR+I
Sbjct: 68  LSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHI 127

Query: 129 LENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPK-DTHA 185
            +   F  G  +PLW++ ++D +MV+ H H+V+FD FAAA FH  F +AL+ F       
Sbjct: 128 FDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFRNVKGQK 187

Query: 186 LDILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCI----SVLKGAYRTTVKKSLNVI 241
            D++F    + + L ++     ++ +VS + S+  Q +    + LK  Y   +KK L  I
Sbjct: 188 SDLIFKTREDLIPLCQSL---AAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRFI 244

Query: 242 RRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSENVCMTS 301
               + ++ I       S+ +        LCGT V G++N ER+  L  L +   +   S
Sbjct: 245 ESGRLEHSGIPA-----SNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRS 299

Query: 302 VLCAITLLSLKPLIRKFNGSITFVVPIDIREKLE-IFDLGVSYTNLMVECPLSFIN---- 356
            + ++T+  L P++      I F VPI++RE +    DLGV   N++ ECPL  I     
Sbjct: 300 FIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIE 359

Query: 357 --------DKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQA 408
                   +++F    +  ++  +++ D N P       +  F+++ +HV   L+     
Sbjct: 360 PCSGISTFNQEFLEGSTLTDVGGVNE-DQNDP-------QTVFRRILTHVTTELELAAMR 411

Query: 409 WQKRRFDMSSL--KGKKLRRSNKIIRGKFIEIN---LVDMGEAQDGQFHTKNVNFTSSLG 463
            +K       L    ++ R      R K +EIN    VD+      ++   +V  TSS  
Sbjct: 412 LEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRK 471

Query: 464 SKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLEDLAK 508
           S   +S+S       G+N+ +HY E  +M+ FVE F+  L+   +
Sbjct: 472 SDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPE 516

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  181 bits (458), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 151/532 (28%), Positives = 259/532 (48%), Gaps = 68/532 (12%)

Query: 8   IRDLSSVEKIF-HKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQIS 66
           +R LSSVEK F    + +  R+G V +  + SN  +    SDD TL + +D  L    +S
Sbjct: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLD---ISDDATLLSSKDKPLTISLVS 68

Query: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126
            AL+ +I  ++E+  TI  + +F   + I   DV+  I F+  KDEL+ C +G PPY++ 
Sbjct: 69  RALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLIN 128

Query: 127 NILENNKFE--FGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTH 184
            I     F+    +PLW+L IV+ ++V+ +  + +FD+FA ANF     + ++  P +  
Sbjct: 129 YIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENK 188

Query: 185 AL--DILFVYEGNELQLSKTNFDGMSQISVSPVQSLP--------LQCISVLKGAYRTTV 234
            +  DI+F    N   +SK NF     I  +P+  LP        LQ  S  K  Y  T 
Sbjct: 189 EIQDDIIFKLP-NIRNISKINFP--KSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTF 245

Query: 235 KKSLNVIRRNFVANNQITTYESSK-SDVFKSMFNPNTLCGTT-VSGSLNAERLASLLELT 292
           KKS + +  NF     I    +   S  +  + + N++  +  V+G+++ ER   LL+L 
Sbjct: 246 KKSFDYL--NFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLI 303

Query: 293 SSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-------------- 338
            +E + + S  C+I ++ LK +I  F+GSI F +P ++R    + D              
Sbjct: 304 DAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSA 363

Query: 339 --LGVSYTNLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTS 396
             LG+ Y ++ VE PL  I           GN               E ++E QFK + +
Sbjct: 364 NELGIIYKDIYVEVPLKLIE--------KIGN---------------EDVVEEQFKIVCN 400

Query: 397 HVMNSLKEKKQAWQKRRFDMSSLKGKKLRRSNKIIRGKFIEIN---LVDMGEAQDGQFHT 453
           ++  S++++ +AW+K  F+   +K  K         G  IE+N    +D+  ++D  FH 
Sbjct: 401 YINESIQKRIKAWEKNGFNDDDIKRMKFGYEQ---VGNIIEVNDLTSLDLSCSKDSLFHI 457

Query: 454 KNVNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505
           ++++ T +L    ++S+S A     G+N+ ++Y     M  F++CFQ  +E+
Sbjct: 458 EDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score = 95.1 bits (235), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 119/240 (49%), Gaps = 32/240 (13%)

Query: 278 GSLNAERLASLLELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EI 336
           G++ AER   L  L     +C+ SV+C I +L  KP I+ F+G+I F + +D++  + + 
Sbjct: 27  GTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPIVDDS 86

Query: 337 FDLGVSYTNLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTS 396
              G+   N++V+CPL  I+DK ++ T S+    S+   D         +LE QF+++T 
Sbjct: 87  SQFGILKKNIIVDCPLKLIDDKHYKDTDSE----SIKNGD---------ILEIQFRKVTD 133

Query: 397 HVMNSLKEKKQAWQKR------RFDMSSLKGKKLRRSNKIIRGKFIEIN-LVDM----GE 445
            V   L  K Q+  K        F+ SS+       +++I   K I+IN L D+     E
Sbjct: 134 FVTEELSNKLQSMAKHFKRNNCPFNFSSI-------NSQISDSKVIQINDLTDIPFTTTE 186

Query: 446 AQDGQFHTKNVNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505
                +   ++  T  L     +S+S        M+I +HY E+  MD+FVECF+  +E+
Sbjct: 187 QNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFRTFIEN 246

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 114/259 (44%), Gaps = 43/259 (16%)

Query: 93  EIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRNILENNKFEFG--RPLWELIIV-DYT 149
           E I++DDVV ++++ TY +E I            ++     FE+G  +PLW++I+V    
Sbjct: 71  EPIKFDDVVDYMDWDTYGEEEI-----------NSVFRKYNFEYGVDKPLWKVIVVPKAN 119

Query: 150 MVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTHALDILFVYEGNELQLSKTNF-DGMS 208
            +I     + FD  A   F  +  K+L +  +D            N+L + +  +  G S
Sbjct: 120 KMIFATDHLFFDGIATVLFWTELLKSLEELKQD------------NDLDVDEIIYRPGGS 167

Query: 209 QISVS---PVQSLPLQCISVLKGAYRTTVKKSLNVIRRNFVANN-QITTYESSK--SDVF 262
             S+    P + LP+     +K   R  VK    +     V+ +  I  ++  K   D  
Sbjct: 168 TDSIDQCHPYEKLPIPFSWKVK---RPIVKALFTIAPGAVVSQDASIIQFDEYKIPEDYL 224

Query: 263 KSMFNPNTL-----CGTTVSGSLNAERLASLLELTSSENVCMTSVLCAITLLSLKPLIR- 316
           K   N +           +S  +++ +L  +++     +V  T+ L A+  L+L  + + 
Sbjct: 225 KKNSNDDGCYQIKNTNRQISLKMSSNKLKVIMKDCKQHHVSFTAYLTAVLYLALGKIPKE 284

Query: 317 KFNGS-ITFVVPIDIREKL 334
           K++GS I + VP++ R ++
Sbjct: 285 KYSGSTIKYEVPMNTRNRI 303

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 69/138 (50%), Gaps = 4/138 (2%)

Query: 8   IRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQISN 67
           +R L+  EK   K+      NGI+F+V  S  KCE +  SDD TL    +S      +  
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISK-KCE-DNLSDDATLHTTGESGNLQLLLLK 59

Query: 68  ALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRN 127
           +L+ +I +  ELC T+ ++  F   + ++  DVV  I +   K ++ E  +G    ++ +
Sbjct: 60  SLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINS 119

Query: 128 ILENNKFE--FGRPLWEL 143
           I  ++ F+   G+P  +L
Sbjct: 120 IYYHSNFQPGSGKPYGKL 137

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 61/139 (43%), Gaps = 24/139 (17%)

Query: 95  IRYDDVVIHIEFKTYKDELIECQNGIPPYILRNILENNKFEFG--RPLWELIIVDYTMVI 152
           IR DDV+    F    D L E           +IL+N+ F++   RPLW+LI +      
Sbjct: 73  IRLDDVLEETGF----DSLDESAAN-------SILKNSTFQYDQQRPLWKLISLKAGTQF 121

Query: 153 LHCHE-VMFDLFAAANFHLKFQKALSQF-PKDTHALDILFVYEGNELQLSKTNFDGMSQI 210
           L C +   FD  +A  F   F  AL+   P++   +D+      NE+ L K   D   +I
Sbjct: 122 LFCFDHAFFDGMSAVIFWNDFISALNSIKPENRRGMDL------NEV-LYKAAAD--PEI 172

Query: 211 SVSPVQSLPLQCISVLKGA 229
            V P    P+  +  +K A
Sbjct: 173 RVHPFDLWPIPWVWSMKRA 191

>Kwal_33.15041 s33 (927424..928992) [1569 bp, 522 aa] {ON} YGR177C
           (ATF2) - 1:1 [contig 96] FULL
          Length = 522

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 15/89 (16%)

Query: 138 RPLWELIIV-----------DYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTHAL 186
           RP W L+              +  +  HC     D  +AANF    Q+ L+Q P D    
Sbjct: 159 RPNWRLVCFPEEGEEKAIWRKFLFLSNHCSS---DGISAANFFHDLQRHLNQLPSDAAEN 215

Query: 187 DILFVYEGNELQLSKTNFDGMSQIS-VSP 214
           D++F Y+ +  +L++       QIS VSP
Sbjct: 216 DVIFDYDRDHEKLAELPSPIEKQISYVSP 244

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 65/310 (20%), Positives = 125/310 (40%), Gaps = 53/310 (17%)

Query: 64  QISNALEAMIKENVELCVTITDDRK-----FAPTEIIRYDDVVIHIEFKTYKDELIECQN 118
           QI++AL + I  + +L   +  D +         + I++DDVV ++ +  + D  I C  
Sbjct: 40  QIAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVEYVSWDGFDDNTI-C-- 96

Query: 119 GIPPYILRNILENNKFEFG--RPLWE-LIIVDYTMVILHCHEVMFDLFAAANFHLKFQKA 175
                   +I +   F +   +PLW+ L+      ++L     +FD  +A  F   F  +
Sbjct: 97  --------HIFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHALFDGMSAVIFWKSFMSS 148

Query: 176 LSQFPKDTHALDILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCISVLKGAYRTTVK 235
           LS   +D    D+L+   G          D M Q      ++ P    S L  A    + 
Sbjct: 149 LSSDARDD--FDLLYELTG----------DPMVQEDSHVYENWPTSWSSTLTKAIAGVIF 196

Query: 236 KSL---------NVIRRN-FVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERL 285
           K +         + +R N +   + + T++      ++   N   L     +  +  + L
Sbjct: 197 KFMPSVITSVGKDQLRFNGYSFPDSLLTHKPDDDSSYEIRNNNRQL-----NLQVQPDHL 251

Query: 286 ASLLELTSSENVCMTSVLCAITLLSLKPLIR--KFNGS-ITFVVPIDIR----EKLEIFD 338
             ++    S  V +TS + A+  +SL+  I    ++GS I   +P++ R    + L+I D
Sbjct: 252 NGIISACKSHQVSLTSFITALISMSLQLKIEDGDYSGSKIMIDIPMNTRGACADVLDIPD 311

Query: 339 LGVSYTNLMV 348
             V+  N + 
Sbjct: 312 TSVTMGNFVA 321

>ZYRO0F07634g Chr6 (618348..620582) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12083 Saccharomyces cerevisiae YPL164C MLH3
           Protein involved in DNA mismatch repair forms a complex
           with Mlh1p to promote meiotic crossing-over mammalian
           homolog is implicated mammalian microsatellite
           instability
          Length = 744

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 17/129 (13%)

Query: 241 IRRNFVANNQI-TTYESSKSDVFKSM-FNPNTLCGTTVSGSLNAERLASLLELTSSENVC 298
           +RR  +AN+ +  T  + + D+F+ +   P+     +       ++L  L EL SS N+ 
Sbjct: 169 VRRRILANDPLFKTLHTLREDLFQVLILRPDISLKVSY-----LDQLGKLKELISSTNI- 222

Query: 299 MTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFDLGVSYTNLMVECPLSFINDK 358
            T  +     LS     + F+     V PID+  K+ +   G S T L+ +CP   +  K
Sbjct: 223 -TKDMNHFMKLS-----QSFSNIFGSVTPIDMFTKVSVKFKGCSVTGLISKCP---VRPK 273

Query: 359 DFQHTVSDG 367
           +FQ    +G
Sbjct: 274 EFQFIYLNG 282

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,892,543
Number of extensions: 2469747
Number of successful extensions: 7596
Number of sequences better than 10.0: 46
Number of HSP's gapped: 7749
Number of HSP's successfully gapped: 46
Length of query: 509
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 395
Effective length of database: 40,409,475
Effective search space: 15961742625
Effective search space used: 15961742625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)