Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_3010na 1ON28727413280.0
ACR019Wna 1ON2882067106e-93
KLLA0C00396gsingletonON8971001158e-06
NDAI0J001607.543ON457130684.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3010
         (287 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3010 Chr3 complement(21352..22215) [864 bp, 287 aa] {ON} si...   516   0.0  
ACR019W Chr3 (390552..391418) [867 bp, 288 aa] {ON} NOHBY317; No...   278   6e-93
KLLA0C00396g Chr3 complement(26146..28839) [2694 bp, 897 aa] {ON...    49   8e-06
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      31   4.4  

>Ecym_3010 Chr3 complement(21352..22215) [864 bp, 287 aa] {ON}
           similar to Ashbya gossypii ACR019W
          Length = 287

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/274 (91%), Positives = 252/274 (91%)

Query: 14  IALSINTNSDVCMRFDNSENQAICDGTKHGDEDEDRMNTVTGISERTPPYSVSTRNTLVD 73
           IALSINTNSDVCMRFDNSENQAICDGTKHGDEDEDRMNTVTGISERTPPYSVSTRNTLVD
Sbjct: 14  IALSINTNSDVCMRFDNSENQAICDGTKHGDEDEDRMNTVTGISERTPPYSVSTRNTLVD 73

Query: 74  ANSSVLDSEILSLGKRQRILKGQLQSMSPQEXXXXXXXXXXXXXXXXXXXXXXTELTVDP 133
           ANSSVLDSEILSLGKRQRILKGQLQSMSPQE                      TELTVDP
Sbjct: 74  ANSSVLDSEILSLGKRQRILKGQLQSMSPQERLERQRAMRRRRDNAYRARKRATELTVDP 133

Query: 134 DLEQLFTTLDTSKQFHSISVKYDAASLSQEFFPRVLLNKSETDDPAPYKAPFDSFIEGLR 193
           DLEQLFTTLDTSKQFHSISVKYDAASLSQEFFPRVLLNKSETDDPAPYKAPFDSFIEGLR
Sbjct: 134 DLEQLFTTLDTSKQFHSISVKYDAASLSQEFFPRVLLNKSETDDPAPYKAPFDSFIEGLR 193

Query: 194 NKIKNVCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSKDIQKSHNLDNAKQYQCQS 253
           NKIKNVCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSKDIQKSHNLDNAKQYQCQS
Sbjct: 194 NKIKNVCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSKDIQKSHNLDNAKQYQCQS 253

Query: 254 YMRVNYSFKTHVLSIKFRHTKHNEQAILPSSTRI 287
           YMRVNYSFKTHVLSIKFRHTKHNEQAILPSSTRI
Sbjct: 254 YMRVNYSFKTHVLSIKFRHTKHNEQAILPSSTRI 287

>ACR019W Chr3 (390552..391418) [867 bp, 288 aa] {ON} NOHBY317; No
           homolog in Saccharomyces cerevisiae
          Length = 288

 Score =  278 bits (710), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 156/206 (75%)

Query: 79  LDSEILSLGKRQRILKGQLQSMSPQEXXXXXXXXXXXXXXXXXXXXXXTELTVDPDLEQL 138
           L  ++ +LGKRQRILK QLQSMSPQE                      TELTVDP+L QL
Sbjct: 72  LGHDMHALGKRQRILKDQLQSMSPQERLERQRAMRRKRDNAYRARKRATELTVDPELRQL 131

Query: 139 FTTLDTSKQFHSISVKYDAASLSQEFFPRVLLNKSETDDPAPYKAPFDSFIEGLRNKIKN 198
           F  LD +K+FHSIS KYDAA+L+ EFFPRVLL K+ETDD A YKAPFDSFIE LRNKI++
Sbjct: 132 FMALDKNKKFHSISAKYDAAALTPEFFPRVLLTKAETDDAALYKAPFDSFIECLRNKIRS 191

Query: 199 VCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSKDIQKSHNLDNAKQYQCQSYMRVN 258
             G KLSKERTSVH+TSVSCVLYCSQDKSHQRL+Q+K+ +K+ NLDN KQY CQSYMRVN
Sbjct: 192 FSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLKQYHCQSYMRVN 251

Query: 259 YSFKTHVLSIKFRHTKHNEQAILPSS 284
           YSFKT VLSIKFRH +H +  +L  S
Sbjct: 252 YSFKTQVLSIKFRHIQHGDSPLLIGS 277

>KLLA0C00396g Chr3 complement(26146..28839) [2694 bp, 897 aa] {ON}
           uniprot|Q9HDS6 Kluyveromyces lactis HMLALPHA3 Mating-
           type protein ALPHA3
          Length = 897

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 190 EGLRNKIKNVCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSKDIQKSHNLDNAKQY 249
           E L   I+   G    +  T   + ++    +C QDK HQ L    +++K H+ DN KQ+
Sbjct: 149 ERLLELIREGTGYIFVRGWTGYRVNTIILKCHCKQDKCHQILKPRCNVKKHHDPDNLKQF 208

Query: 250 QCQSYMRVNYSFKTHVLSIKFRHTKHNEQ---AILPSSTR 286
            C S   V+++ K + + I F H   +E     I+P+S R
Sbjct: 209 NCFSSFSVHFNVKLNTIKICFCHKSKHETLPITIIPASLR 248

>NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543
          Length = 457

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 52/130 (40%), Gaps = 13/130 (10%)

Query: 149 HSISVKYDAASLSQEFFPRVLLNKSETDDPAPYKAPFDSFIEGLRNKIKNVCGIKLSKER 208
           HS+   +      +    R  L + E      +  P+++  E            +L    
Sbjct: 120 HSLEKPFHCQHCGKGVTTRQQLKRHEITHTKSFHCPYENCQESFYK------HPQLRSHI 173

Query: 209 TSVHITSVSCVLYCSQDKSHQRLIQ-SKDIQKSHNLDNAKQYQCQSYMRVNYSFKT---H 264
            S H+  + C  YC  +K+ QR  + +  I+K HN D    YQC   +  N +FKT   +
Sbjct: 174 LSFHLEKLKCK-YC--NKNFQRPYRLANHIKKHHNPDTENPYQCSVSIDCNLTFKTWTKY 230

Query: 265 VLSIKFRHTK 274
            L IK  H K
Sbjct: 231 QLHIKNDHPK 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.128    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,883,755
Number of extensions: 1050824
Number of successful extensions: 3433
Number of sequences better than 10.0: 13
Number of HSP's gapped: 3540
Number of HSP's successfully gapped: 13
Length of query: 287
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 179
Effective length of database: 41,097,471
Effective search space: 7356447309
Effective search space used: 7356447309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)