Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30096.7ON1027102746770.0
ACR020C6.7ON1002104925090.0
KLLA0D00792g6.7ON1020105221250.0
Kwal_56.223346.7ON1008103720320.0
KLTH0C11594g6.7ON1006103019230.0
NCAS0F001806.7ON1018106418690.0
Skud_5.346.7ON1019105618600.0
SAKL0E00770g6.7ON104771118470.0
TDEL0G046406.7ON1017105918090.0
CAGL0B03553g6.7ON1021105716620.0
TBLA0A072106.7ON1041108415400.0
Kpol_1045.806.7ON101972614001e-176
ZYRO0F00440g6.7ON103972713911e-175
KAFR0L003306.7ON102874013831e-174
YEL055C (POL5)6.7ON102273313601e-170
NDAI0K029106.7ON106375113591e-170
Smik_5.326.7ON102073213271e-166
KNAG0E009706.7ON100473213061e-163
Suva_5.136.7ON102373412961e-161
TPHA0J002506.7ON102473412281e-151
ZYRO0G19360g8.155ON267491791.4
KLTH0E06424g8.155ON267351763.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3009
         (1027 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...  1806   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   971   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   823   0.0  
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   787   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   745   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   724   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   721   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   716   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   701   0.0  
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   644   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   597   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   543   e-176
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   540   e-175
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   537   e-174
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   528   e-170
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   528   e-170
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   515   e-166
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   507   e-163
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   503   e-161
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   477   e-151
ZYRO0G19360g Chr7 complement(1604406..1612430) [8025 bp, 2674 aa...    35   1.4  
KLTH0E06424g Chr5 (586109..594130) [8022 bp, 2673 aa] {ON} simil...    34   3.3  

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
            Ashbya gossypii ACR020C
          Length = 1027

 Score = 1806 bits (4677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 919/1027 (89%), Positives = 919/1027 (89%)

Query: 1    MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG 60
            MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG
Sbjct: 1    MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG 60

Query: 61   ARLGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQA 120
            ARLGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQA
Sbjct: 61   ARLGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQA 120

Query: 121  LLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTE 180
            LLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTE
Sbjct: 121  LLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTE 180

Query: 181  VGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXXTLRSCWKNNDP 240
            VGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVET             TLRSCWKNNDP
Sbjct: 181  VGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSKITLRSCWKNNDP 240

Query: 241  LSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVPX 300
            LSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVP 
Sbjct: 241  LSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVPK 300

Query: 301  XXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYV 360
                        VRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYV
Sbjct: 301  KRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYV 360

Query: 361  PSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSI 420
            PSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSI
Sbjct: 361  PSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSI 420

Query: 421  NFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAH 480
            NFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAH
Sbjct: 421  NFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAH 480

Query: 481  KLKADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXXXESKKIPVLSRERLFSILG 540
            KLKADMFWTKPLLSSIVKLSFFNDKLSDFE            ESKKIPVLSRERLFSILG
Sbjct: 481  KLKADMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHADADAESKKIPVLSRERLFSILG 540

Query: 541  QLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQE 600
            QLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQE
Sbjct: 541  QLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQE 600

Query: 601  SPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSIDTKPNGLVGITEILLSMV 660
            SPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSIDTKPNGLVGITEILLSMV
Sbjct: 601  SPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSIDTKPNGLVGITEILLSMV 660

Query: 661  AQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALFXXXXXXXXXXXXX 720
            AQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALF             
Sbjct: 661  AQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALFEAADEYVEVDDDE 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXYFEECGSNEEDSGNNGYNEYIDKINKETTSALADAL 780
                                    YFEECGSNEEDSGNNGYNEYIDKINKETTSALADAL
Sbjct: 721  INEDVDISHENCDSSDHNDSHSSSYFEECGSNEEDSGNNGYNEYIDKINKETTSALADAL 780

Query: 781  KLPENMIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKVPTG 840
            KLPENMI                                 GQLSEIFKRRKEALSKVPTG
Sbjct: 781  KLPENMIDENGDVGFEDFDDGDEEEEEEESMDDEAMMELDGQLSEIFKRRKEALSKVPTG 840

Query: 841  NKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQCEASKLLNIHSMIDPLLKC 900
            NKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQCEASKLLNIHSMIDPLLKC
Sbjct: 841  NKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQCEASKLLNIHSMIDPLLKC 900

Query: 901  IQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQ 960
            IQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQ
Sbjct: 901  IQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQ 960

Query: 961  QLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWL 1020
            QLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWL
Sbjct: 961  QLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWL 1020

Query: 1021 ASKRSKN 1027
            ASKRSKN
Sbjct: 1021 ASKRSKN 1027

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1049 (48%), Positives = 693/1049 (66%), Gaps = 72/1049 (6%)

Query: 2    KQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGA 61
            +QVNRDLFY+L SD+ +ERV++A+ ++ EL+E+  ++N +EW+YVLGRL++GLAS+ + A
Sbjct: 3    RQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNKSA 62

Query: 62   RLGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQAL 121
            RLGFS+CL+EV    LE G + S E Y+ +L   L    VKNGKEERG +FG++FGLQA+
Sbjct: 63   RLGFSLCLTEVAAAALENGHIGSAEEYLERLEAALPVDKVKNGKEERGQLFGRMFGLQAM 122

Query: 122  LNEPLFGRIFMDGK-VIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTE 180
            LNEPLF R+F+ G   I   F   FM  LV+LAL+K WLR+PCLFTLYQ+IE+L+ + T+
Sbjct: 123  LNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRATD 182

Query: 181  VGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXXTLRSCWKNNDP 240
               L A+  LLD H LT T+EGLAIYL L  +C E               L   WK ++P
Sbjct: 183  TEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKADNP 242

Query: 241  LSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVPX 300
            L+KGN   L+SVLKD   +E +  KQKG W PRLHFVWD+L+P+L  ++  P    H+  
Sbjct: 243  LAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHIAK 302

Query: 301  XXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYV 360
                            LSF EFWQVVVDESFF+ KASSERKYLG+LI+EKA++ VPSS V
Sbjct: 303  KHKTGKKPKSAE-SGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVPSSLV 361

Query: 361  PSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSI 420
              IFSKN +RTLINQSSE+TR+LHK+S N LK IVS CE+D +KV+PV+ ++WFGPNG+I
Sbjct: 362  QDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGPNGTI 421

Query: 421  NFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAH 480
            NFD LTKSKT DS++  + L +  LA LV L++ +++ E++ +SK++++LD LLH+++AH
Sbjct: 422  NFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEHENTDISKIKFILDTLLHVIRAH 481

Query: 481  KLKADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXXXESKKIPVLSRERLFSILG 540
            K KA + WT PLL ++V+ +FF+                   +S++I  LSRERLFS+LG
Sbjct: 482  KWKAHLSWTNPLLLALVRYAFFS------------APSHLSEQSEEIITLSRERLFSVLG 529

Query: 541  QLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQE 600
            +LIP SK ++  P+W Y TL++++ E+ +  L  +LD EL+    +ALK +  I  KS +
Sbjct: 530  ELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTK 589

Query: 601  SPQAS-ELCGLELLLGVTILQMYSGDAESASILEELTTFYKS-IDTKPNGLVGITEILLS 658
            SP  + +L GLELLL V+ILQ+++GD +SAS LEEL +FY+S      NGLVGITEILLS
Sbjct: 590  SPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEILLS 649

Query: 659  MVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALFXXXXXXXXXXX 718
            +VAQKK++LR+LTL+VWES IDK+  +EL LL + LS RENK GFA LF           
Sbjct: 650  LVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADE------ 703

Query: 719  XXXXXXXXXXXXXXXXXXXXXXXXXXYFEECGSNEEDSGNNGY----------------- 761
                                       +EE GS+E  + N                    
Sbjct: 704  ---------------------------YEELGSDEAGTDNEDQSSESNEDSSDEVSDQED 736

Query: 762  --NEYIDKINKETTSALADALKLPENMIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 819
              +E + KI+KE TSALA AL+LP+N++                                
Sbjct: 737  YSDEDVAKIDKEATSALAHALRLPDNIL---DEDGNVGFEEMDDEEEEEESMDDEAMMEL 793

Query: 820  XGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKS 879
             GQLSEIFKRRK+AL+K+PTGN+RK+E +ESR+SVI+FKHRV+DMLEIYCK V R   K+
Sbjct: 794  DGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKN 853

Query: 880  QQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVS-E 938
            ++  A+   N+ SM +P++K IQQT+DRPLAEK +KLLKN +CK+K   +K    E++ E
Sbjct: 854  KKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEE 913

Query: 939  IVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQS 998
             +  SLEN+H ++L+ KPGQF QL+F ACS++SLFL K+L+  K D  T  ++I IYS +
Sbjct: 914  SILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTT 973

Query: 999  IKNWTVKGKFGPNFFIDFINWLASKRSKN 1027
            +K+W V GKFGPNFFIDFINWLASK+SKN
Sbjct: 974  MKHWNVSGKFGPNFFIDFINWLASKKSKN 1002

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/1052 (43%), Positives = 646/1052 (61%), Gaps = 66/1052 (6%)

Query: 1    MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNE---QEWQYVLGRLIKGLASA 57
            + +VNRDLF+++AS++E+ER++AA+ ++NE+S +  +++E   +EW+YV+GRL+KGLAS 
Sbjct: 7    VSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLASN 66

Query: 58   RQGARLGFSMCLSEVVTLGLEKGR-LESVEVYIGQLFEKLADGHV-KNGKEERGLVFGKL 115
            R GARLGFSMCL+EV+ L LE+   L S+  ++ QL + L  G   KNGKEERG++FG++
Sbjct: 67   RGGARLGFSMCLTEVIALALERRDILPSIYAFLNQLEQTLPAGTAFKNGKEERGVLFGQM 126

Query: 116  FGLQALLNEPLFGRIFM--DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEK 173
            F LQ+LLNEP+F ++F+  D   I+++F + +++ L++LALSKTWLREPCL+++YQ I+K
Sbjct: 127  FALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPCLYSVYQTIQK 186

Query: 174  LSSK-FTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXXTLR 232
              ++ F +   +  I  LLD  KLTLTNEGL+IYL+                        
Sbjct: 187  CETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMF--------NAQRDTYSSSLVIHN 238

Query: 233  SCWKNNDPLSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIP 292
            S WKNNDPLSKGNV +L+SVLKD++PVE + +KQKG+WAPRLH+VWDIL+P+L       
Sbjct: 239  SGWKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQKGTWAPRLHYVWDILLPLLEDDGSFG 298

Query: 293  GAAE-HVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKA 351
             + E H+                  + F +FWQ VVDESFFN K+S+ERKYLG LI+E+A
Sbjct: 299  QSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERKYLGFLILEEA 358

Query: 352  MQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNS 411
            ++      +  + S+N++R +INQS +S R L+KIST  LK+IV+ CE  P KV+P+V  
Sbjct: 359  IKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECERSPAKVVPLVEV 418

Query: 412  LWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSK---VRY 468
             WFG NGSINFD L KSK ++S+I+   L+ EHL  LV L++S++ ++ S        R+
Sbjct: 419  FWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQSTKDSFNLTRF 478

Query: 469  LLDILLHIVQAHKLKADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXXXESKKIP 528
            + D  LHI +AHK + +  W KPLLS+I+K +FFN+                  ++ K+ 
Sbjct: 479  IFDTFLHITRAHKTRLESHWVKPLLSAIIKAAFFNES-----------------DNSKLS 521

Query: 529  VLSRERLFSILGQLIPT-SKQNVDGPTWPYVTLQIVIA-EEHRRSLIFKLDEELQQTKEH 586
             L++ERL+SILG+LI   SK + D  TWPY+ LQI++  E    +L   LDE+L+  ++ 
Sbjct: 522  ELAKERLYSILGELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKS 581

Query: 587  ALKAI--NDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSIDT 644
            A+K++  N    K+  +P+   L GLELLL V ILQ+Y+GD ES SIL++L +FY+  D 
Sbjct: 582  AIKSLKQNHSDNKNNTNPK---LNGLELLLSVAILQLYAGDEESVSILQDLISFYEECDK 638

Query: 645  KPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFA 704
            +   LVGITEILLS+VAQ+K++L++L+LIVWES +  I   ELN+L   L+ RENKQGFA
Sbjct: 639  ESTDLVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFA 698

Query: 705  ALFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFEECGSNEEDSGNNGYNEY 764
             LF                                            +E+D      +  
Sbjct: 699  DLFEGDEEEDDEDAVERGTDDDDDEDDEDNDDDDE-------PSAEDSEDDVSEEDKDAA 751

Query: 765  IDKINKETTSALADALKLPENMI---------XXXXXXXXXXXXXXXXXXXXXXXXXXXX 815
            ++KI KE TSALA AL LP++++                                     
Sbjct: 752  LEKIEKEATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDEA 811

Query: 816  XXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRL 875
                  QLSEIFKRRKEAL  VPTGNKRK+EV+ESRE+VISFKHRV+DMLEIY K   R 
Sbjct: 812  MMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDRA 871

Query: 876  AGKSQQC--EASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCV 933
              ++        +  N+ S+I PLLKC+Q T+D+ LA+K AKL+K  +CK+K    K   
Sbjct: 872  VARNNTSIITVEEWNNLSSIILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKEEK 931

Query: 934  DEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIID 993
               SEI  L LE +H  ++  KPGQFQQL+F  CS +SLFL K+ + +     ++  +ID
Sbjct: 932  TVTSEIFHL-LEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGG---SHENLID 987

Query: 994  IYSQSIKNWTVKGKFGPNFFIDFINWLASKRS 1025
            +Y+ + K W   GK   NFFIDF NWL +KR+
Sbjct: 988  LYADTSKAWMKDGKCTVNFFIDFSNWLQTKRA 1019

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1037 (41%), Positives = 624/1037 (60%), Gaps = 47/1037 (4%)

Query: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
            ++NRDLFY+LASD+ EER++A + +V +LS++ E+D+  EWQYVL RLIKGL+S+R GAR
Sbjct: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKL-EKDS-SEWQYVLDRLIKGLSSSRNGAR 62

Query: 63   LGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQALL 122
            LGFS+CL+EVV L LEKG L  V+ Y+  L   L+  +VKNGKEERGL+FGKLFGLQ LL
Sbjct: 63   LGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQVLL 122

Query: 123  NEPLFGRIFM-DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTEV 181
            NEPLF ++F  D   ++++    +M +L+ +AL+KTW+RE  LFTL+Q +EKL+      
Sbjct: 123  NEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLGSR 182

Query: 182  GHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXXTLRSCWKNNDPL 241
              L+A+ +LLD   LT T+EGLAIYL L++ C  T              L++ WKNNDPL
Sbjct: 183  QPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNNDPL 242

Query: 242  SKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVPXX 301
             +GN+  +S+ LKD    +D  + QKG WAPRLHF WDI++  L   +         P  
Sbjct: 243  KRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITTMQPPSK 302

Query: 302  XXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYVP 361
                         A + F EFW+ VVDESFFN K+SSERKYLG+L+ EK  Q  P  Y+P
Sbjct: 303  KRKKEE-----KEAFIKFPEFWKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLP 357

Query: 362  SIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSIN 421
             +FSKN++R LINQ   + RNLHKIS   L  IV +C++ P K  P    L FG  G+IN
Sbjct: 358  QLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTIN 417

Query: 422  FDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAHK 481
            FD LTK+KT++S+++ + L+S+ L  L   ++S +      +S+ R++LD +LH+V+AHK
Sbjct: 418  FDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLVRAHK 477

Query: 482  LKADMFWTKPLLSSIVKLSFF-NDKLSDFEXXXXXXXXXXXXESKKIPVLSRERLFSILG 540
              AD  W KP+L ++V L FF   +L D +                +  ++ ERLFSIL 
Sbjct: 478  AHADEVWLKPVLKALVCLGFFQQSELKDVKDSQESF--------HSLSSIASERLFSILA 529

Query: 541  QLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQE 600
             L+ T +Q+     WP++ +Q++  + ++++L+  +DEEL    + ++  ++ I +K+ E
Sbjct: 530  DLL-TVEQDTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANE 588

Query: 601  SPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSID--TKPNGLVGITEILLS 658
            +   S+  GL+LL  V ILQ Y+G+ ES S+LE+L +F    +   K   L G  EILLS
Sbjct: 589  A-NLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEILLS 647

Query: 659  MVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALFXXXXXXXXXXX 718
            + AQKKA+ R+ +L+ WES +  +   +L +L ++L  RENK+GF+ LF           
Sbjct: 648  LAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFEGGSESEGDSE 707

Query: 719  XXXXXXXXXXXXXXXXXXXXXXXXXXYFEECGSNEEDSGNNGYNE-------YIDKINKE 771
                                        ++   +E +  +N  +E        + KI+KE
Sbjct: 708  EDEEMNDEEEPE----------------KDASDDEIEESDNNVSEDDSSSDDDMGKIDKE 751

Query: 772  TTSALADALKLPENMIXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRR 830
             TSALA AL LP++++                                  GQLSEIFKRR
Sbjct: 752  ATSALAKALNLPDSIVDDKGEVRFEDLGDTDEEEEESEEDLDDEKMMELDGQLSEIFKRR 811

Query: 831  KEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQCEASKLLNI 890
            KEALSK+PTGNKRK EV+ESRE+VI+FKHRV+DMLEI  +++     K    E S L  +
Sbjct: 812  KEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIESKMKKDGHIEKSVLDKV 871

Query: 891  HSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVFLS-LENIHN 949
             ++I PLL CI+ T+D+PLAEK AKLLKN ICKLK   F    ++V +   LS L ++H 
Sbjct: 872  FAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLK-PSFSSTTEKVDKKAVLSLLRSVHE 930

Query: 950  SMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNWTVKGKFG 1009
            +ML KK GQFQ LYF  CST+S+FL +++V T P+  TY  +  IY +++  W V GKFG
Sbjct: 931  AMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTLDGWFVTGKFG 990

Query: 1010 PNFFIDFINWLASKRSK 1026
             + F++F+NWL+ K+++
Sbjct: 991  VSMFVEFLNWLSVKKTQ 1007

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1030 (40%), Positives = 608/1030 (59%), Gaps = 35/1030 (3%)

Query: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
            +V+RDLFY+LASD+ EER++A +G+V +LS++  +   +EW+YVL RLIKGL+S+R GAR
Sbjct: 5    EVDRDLFYKLASDLSEERLQAIIGLVTQLSKV--EKESREWEYVLNRLIKGLSSSRNGAR 62

Query: 63   LGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQALL 122
            LG+ +CL+EVV   LEK  L   + Y+  L   L+  ++KNGKEERG++FGKLFGLQ LL
Sbjct: 63   LGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQVLL 122

Query: 123  NEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTEVG 182
            NEPLF ++F     I+L+F + ++  L+ +AL+KTW+RE  +FTLYQ IEKLS       
Sbjct: 123  NEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMGSQK 182

Query: 183  HLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXXTLRSCWKNNDPLS 242
             L+A+  LLD   LT T+EGLA+YL L ++   T              L S WKNNDPLS
Sbjct: 183  PLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNNDPLS 242

Query: 243  KGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVPXXX 302
            KGN+  +++ LK+I   ED  +KQKG W PRLHFVWDI++       E    A       
Sbjct: 243  KGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDKASE---PA 299

Query: 303  XXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYVPS 362
                          + F EFW+ VVDESFFN K+SSERKYLG L+ EKA    P SY  +
Sbjct: 300  KKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTHT 359

Query: 363  IFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSINF 422
            + SKN+ R LINQ   S RNLHK+S  VL  IV +C++ P K  P   +L    +GSI+F
Sbjct: 360  LLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSISF 419

Query: 423  DILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAHKL 482
            D LTKSKT++ +++ + L  + L  L  ++ + +       S+VR+LLD +LH+V+AHK 
Sbjct: 420  DQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRAHKS 479

Query: 483  KADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXXXESKKIPVLSRERLFSILGQL 542
             AD  W  PLL S+V+  F       FE            E+  +  L+ ERL+SIL  L
Sbjct: 480  AADKVWLAPLLDSLVQQGF-------FELDENDRQPEVGDETFTVSKLAVERLYSILADL 532

Query: 543  IPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQESP 602
            I    ++ +   WP  T++I++++  +  L+  +DEEL +    ++K    I  ++++  
Sbjct: 533  ISADYKS-EKVCWPRFTVEILMSKLKKNKLLNPMDEELTEILNSSIKTFKTICSEAEKGG 591

Query: 603  QASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSIDTKPNG-LVGITEILLSMVA 661
            +  +  G +L+  V ILQ YSG+ +S  +L++L +F+++++   +G   G  EILLS+ A
Sbjct: 592  KQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEILLSLAA 651

Query: 662  QKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALFXXXXXXXXXXXXXX 721
            QKKA+LR+ +L+VWE  + +   D++ +L +IL  RENK+GF+ LF              
Sbjct: 652  QKKALLRKASLLVWELFVGEASQDDIAVLLEILPARENKEGFSKLFEGDDEGGSDEEEIS 711

Query: 722  XXXXXXXXXXXXXXXXXXXXXXXYFEECGSNEEDSGNNGYNEYIDKINKETTSALADALK 781
                                     EE G + +D       E  ++I+KE TSAL  AL 
Sbjct: 712  DELFAEEGASGDNTEE---------EESGPDSDDQD----GEDTEQIDKEATSALVKALN 758

Query: 782  LPENMIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKVPTGN 841
            LPE+++                                 GQLSEIFKRRKEALSK+PTGN
Sbjct: 759  LPESIVNDNGEVHFEDLEDTEDEEISDEDLDDEKMMELDGQLSEIFKRRKEALSKIPTGN 818

Query: 842  KRKLEVRESRESVISFKHRVLDMLEIYCKYV---VRLAGKSQQCEASKLLNIHSMIDPLL 898
            KRK EV+ESRE+VI+FKHRV+DMLEI+ ++    ++  G+ ++   SK+++I   +   +
Sbjct: 819  KRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPEKSVTSKIISIILPL---I 875

Query: 899  KCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVFL-SLENIHNSMLAKKPG 957
             C++ T+D+PLAEK  KLLKN ICKLK+      +D + E +F  SL+++H +ML KK G
Sbjct: 876  SCVRTTLDKPLAEKVTKLLKNKICKLKITT-DTSLDGLEENLFENSLKSVHEAMLLKKCG 934

Query: 958  QFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNWTVKGKFGPNFFIDFI 1017
            QFQ LYF ACST+S+FL K+ V   P   TY  + ++Y +++  W V GKF  N FI+F+
Sbjct: 935  QFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFL 994

Query: 1018 NWLASKRSKN 1027
            NWL+ K+ +N
Sbjct: 995  NWLSIKKQQN 1004

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1064 (41%), Positives = 612/1064 (57%), Gaps = 91/1064 (8%)

Query: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
            +VNRDLFY+LASD++EER +AA+ +V EL+ ++  D  +EW YV+ RLIKGLAS R  AR
Sbjct: 4    KVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRSSAR 63

Query: 63   LGFSMCLSEVVTLGLEKGR-----LESVEVYIGQLFEKLA-DGHV--------KNGKEER 108
            LGFS+CL+EV+ L L         L++++ ++  L + L+ D +         K G++ER
Sbjct: 64   LGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGRDER 123

Query: 109  GLVFGKLFGLQALLNEPLFGRIFM---DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLF 165
            GL+FGK+FGLQA+ NEP+F  +F+   DGK     F   FM+ +V LAL K W++E CLF
Sbjct: 124  GLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKESCLF 183

Query: 166  TLYQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXX 225
            TL+Q I+KL     +  +L +I  LLD H L+LT+EGLA+YL ++Y              
Sbjct: 184  TLFQTIQKLLPYANKDTYL-SILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTSSIE 242

Query: 226  XXXXTLRSCWKNNDPLSKGNVTILSSVLKD---IIPVE--DNVMKQKGS-WAPRLHFVWD 279
                     WKNNDPLS+GN+ +L+ VL+D     P E  +N  KQ  S W PRLHFVWD
Sbjct: 243  FK----NPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVWD 298

Query: 280  ILIPILCRQQEIPGA-AEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASS 338
            IL+PIL   +    +  +H+              +  P    EFWQ+VVDESFFN KASS
Sbjct: 299  ILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFP----EFWQMVVDESFFNEKASS 354

Query: 339  ERKYLGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSIC 398
            ERKYLG LI  K ++ V  + + + FS N MR+LINQS++S R LHK+S N L  I+ +C
Sbjct: 355  ERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVC 414

Query: 399  ESDPT-KVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEID 457
            + D + K++  VN++ FGP+GSINFD LTKSKT+  +I++  L  + LA L  L  S I 
Sbjct: 415  QEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNIS 474

Query: 458  KESSPVSKVRYLLDILLHIVQAHK--LKADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXX 515
            ++S    K RY+LD LLHIV+ HK  L+ D   T PLL  +++ +FF             
Sbjct: 475  EKSENKQKNRYVLDTLLHIVRTHKTGLEYDAIVT-PLLDPLIQWAFF------------- 520

Query: 516  XXXXXXXESKKIPVLSRERLFSILGQL---IPTSKQNVDGPTWPYVTLQIVIAEEH--RR 570
                   E++ +  L++ER  SIL +L   IP    +    +W Y  L I++ +E   + 
Sbjct: 521  -----AKENEPLNELAKERFSSILAELTSVIPKEPHH----SWQYYALDIILKKERTGKF 571

Query: 571  SLIFKLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESAS 630
             L+ KLDE L + K  A   I  I K    SPQ+ +L GLE LL + +LQ++SG+ ES S
Sbjct: 572  ELVNKLDENLGKIKNDACDVIVKIIK----SPQSPQLNGLESLLSMCLLQLFSGETESLS 627

Query: 631  ILEELTTFYKSI--DTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELN 688
             +EEL  FYK    DT+   LVGITEILLS++AQKKAVLR+L+L+VWE  I  +  +ELN
Sbjct: 628  TIEELIEFYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELN 687

Query: 689  LLFDILSVRENKQGFAALFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFEE 748
            +L D+L  RENKQGFA LF                                       +E
Sbjct: 688  ILLDVLKARENKQGFAHLFEGADEYEEIEDEQEGESNQSEEKDVSGEESEESEESEIDDE 747

Query: 749  CGSNEEDSGNNGYNEYIDKINKETTSALADALKLPENMIX-------XXXXXXXXXXXXX 801
              S +    NN        I+KE TSALA AL LPEN++                     
Sbjct: 748  DDSLDTAEVNN--------IDKEATSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDD 799

Query: 802  XXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRV 861
                                QLSEIFKRRKEALS   TGN+RK+E +ESRE+VI+FK RV
Sbjct: 800  DDDDSDEESMDDEKMMLLDDQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRV 859

Query: 862  LDMLEIYCKYVVRLAGKSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHI 921
            +D+L +Y KYV +L        + K +N+ S ++P++ C+Q+T+D+ LA+K +KLLK  I
Sbjct: 860  VDLLTVYVKYVEKLQTADH---SQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRI 916

Query: 922  CKLKLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVT 981
             K+K   FK   + V  + +  L+ +H  +L +KPGQ  QLY+   S++SLF  KI V +
Sbjct: 917  FKIKSSTFKNSANPVEVLEY--LKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVAS 974

Query: 982  KPDEV-TYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024
              DE   YN++ID YS + K+W  K KFGPNFF DF NWLAS++
Sbjct: 975  STDETNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1056 (41%), Positives = 625/1056 (59%), Gaps = 81/1056 (7%)

Query: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
            +VNRDLF++LASD++EER+ AAV ++ +LS +    + +EW YVL RLIKGLAS R  AR
Sbjct: 4    KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRNSAR 63

Query: 63   LGFSMCLSEVVTLGLE-------KGRLESVEVYIGQLFEKL----ADGHVK--NGKEERG 109
            LGFS+CL+EVV LG+        KG LES   ++  L   L     DG  K   GK+ERG
Sbjct: 64   LGFSLCLTEVVNLGINMPSGQRPKG-LESKNEFLDTLSSILDIYVNDGSKKPVKGKDERG 122

Query: 110  LVFGKLFGLQALLNEPLFGRIFMDG-KVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLY 168
            ++FGKLFGL++LLNEPLF  IF+D  K  + +F + FM+ L+ LAL K W+REPCLF+L+
Sbjct: 123  ILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFSLF 182

Query: 169  QLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXX 228
            Q I+ L     E   ++ I  + D + LTLTNEGL+ YL+L YE  E+            
Sbjct: 183  QTIKMLLPFMNESTAVK-ILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLR--- 238

Query: 229  XTLRSCWKNNDPLSKGNVTILSSVLKD--IIP-----VEDNVMKQKGSWAPRLHFVWDIL 281
                S WKNNDPL++GN+ +L+ VL+D  ++P     ++D   ++  +W PRLHFVWD+L
Sbjct: 239  ---NSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVL 295

Query: 282  IPILCRQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERK 341
            +P+        G  E+               V+  + F EFW++ VDESFFN KASSERK
Sbjct: 296  LPLFGS-----GKLENTEHITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERK 350

Query: 342  YLGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESD 401
            YLG LII+   + VP S + S FS+N+MRTLINQS +S R L+KI+   L++IV  CE D
Sbjct: 351  YLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEED 410

Query: 402  PT-KVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKES 460
            P  K++P +N++ FGP+GSINFD LTKS  +  +IA++ L S  LA L++  + ++ ++ 
Sbjct: 411  PIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKR 470

Query: 461  SPVSKVRYLLDILLHIVQAHKLK-ADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXX 519
              +    ++LD LLHI++AHK++  D+   KP+L+ I+ ++FF     +           
Sbjct: 471  GDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDE----------- 519

Query: 520  XXXESKKIPVLSRERLFSILGQLIPTSKQNVDGP---TWPYVTLQIV--IAEEHRRSLIF 574
               E +++  L++ERL+SILG+L    + N + P   +W Y+TL ++  I + ++  LI 
Sbjct: 520  --QEFEQLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLIN 577

Query: 575  KLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEE 634
             LDE L++ K  A+ ++ +I K +      ++  GL  LL + ++Q+Y+G+ +S S++EE
Sbjct: 578  PLDESLEKIKNEAISSLAEISKSN-----TTQSWGLSTLLSMCLIQLYAGETDSISVIEE 632

Query: 635  LTTFYKSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDIL 694
            L  F K  +   N +VGITEILLS +AQKKA+LR+L+LI+W+  I+ +  +EL +L D+L
Sbjct: 633  LCEFTKHDN---NSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVL 689

Query: 695  SVRENKQGFAALFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFEECGSNEE 754
              RENKQGFA LF                                            +EE
Sbjct: 690  KARENKQGFAQLFEGEGEFEEINEEENANEGDSKSESESESESDSDESNE------KDEE 743

Query: 755  DSGNNGYNEYIDKINKETTSALADALKLPENMIXXXXXXXXXXX--XXXXXXXXXXXXXX 812
            D      NE +  I+KE T AL  AL LP+N++                           
Sbjct: 744  DEA----NEDVVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGGLSDDDDDEDEESMD 799

Query: 813  XXXXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYV 872
                     QLSEIFKRRKEALS + TGN+RK+EV+ESRE+VISFKHR++DML +Y KY 
Sbjct: 800  DEKMMELDDQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYC 859

Query: 873  VRLAGKSQQCEASKLLNIHS----MIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEP 928
             +LA  ++   +S L    S     I P+LKCI++T+D+PLA+K +KLLK  I K+K   
Sbjct: 860  EKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANT 919

Query: 929  FKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTY 988
            FK  +D+  E++ L L++ H  ML  KPGQ   ++F ACSTSSLFL K+      +    
Sbjct: 920  FK-ILDKNIELMNL-LKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNN-AL 976

Query: 989  NRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024
            + +ID+Y+ + K W +KGKF  N FIDF NWL+SK+
Sbjct: 977  DELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKK 1012

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/711 (50%), Positives = 497/711 (69%), Gaps = 12/711 (1%)

Query: 1   MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG 60
           ++++NRDLFY+LASD++EERV+AA+ ++ EL+ +  ++N+ EW+YVL RLIKGL+S R  
Sbjct: 2   VEKINRDLFYKLASDLQEERVQAAISLIKELASL--ENNDSEWEYVLNRLIKGLSSNRNS 59

Query: 61  ARLGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQA 120
           ARLGFS+CL+EV+++ LEKG L S+E YI  L   L    VKNGKEERGL+FG++FGLQA
Sbjct: 60  ARLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQA 119

Query: 121 LLNEPLFGRIFMDGKV-IDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFT 179
           LLNEPL  +IF+D    ++  F V FM  LV++ALSKTW+REPCLFTL+Q++EKLS    
Sbjct: 120 LLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLN 179

Query: 180 EVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXXTLRSCWKNND 239
           +   +E+IFKLLD +KL+LTNEGLAIYL LI+ C  T              L S WKNND
Sbjct: 180 DTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNND 239

Query: 240 PLSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVP 299
           PL+KGN+  LS+VLKD+ PVED+ +KQKGSWAPRLHFVW+I++PIL R  +  G+++   
Sbjct: 240 PLTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHI 299

Query: 300 XXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSY 359
                        V+  + F EFW+ VVDESFFN K+S ERKYLG LI+E A + VP S 
Sbjct: 300 TKKRKKEKAKDVQVKM-IEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLSL 358

Query: 360 VPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGS 419
           V  +FSKN+MRTLINQSS+S R LHKIS  VL +I+ +CES P K +P + ++ F  NG+
Sbjct: 359 VSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENGT 418

Query: 420 INFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEI-DKESSPVSKVRYLLDILLHIVQ 478
           INFD LTK+KT+D ++A   +  +HL+SLV L VS + D  +   +  R+LLD +LH+V+
Sbjct: 419 INFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVVR 478

Query: 479 AHKLKADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXXXESKKIPVLSRERLFSI 538
            HK  +D  W KPL++S++ + FF    +  +            E +     +RERL+SI
Sbjct: 479 THKTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQ-----ARERLYSI 533

Query: 539 LGQLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKS 598
           L  LIP SKQ++   +WPY+TLQ+++++E  + LI  LD+ L + K  AL  +  IR++ 
Sbjct: 534 LADLIPLSKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRREL 593

Query: 599 QESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSI--DTKPNGLVGITEIL 656
           +  P AS+  GLELLL +T+LQ+Y GD ES S+LE+L TFY S+   ++ N L+G+ EIL
Sbjct: 594 ENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEIL 653

Query: 657 LSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALF 707
           L+++AQKKA+LRRL+L+VWE  +DK+   EL +LFDILS RENK+GF ALF
Sbjct: 654 LALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDILSARENKEGFTALF 704

 Score =  249 bits (635), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 177/278 (63%), Gaps = 7/278 (2%)

Query: 753  EEDSGNNGY-NEYIDKINKETTSALADALKLPENMIXXX-----XXXXXXXXXXXXXXXX 806
            ++ S +N Y NE I+KI+KETTSALA AL LP+ +I                        
Sbjct: 766  DDQSEDNDYSNEDINKIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDE 825

Query: 807  XXXXXXXXXXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLE 866
                           QLS+IF+RRKEALSK+ TGNKRKLE +ESRE+VI+FKH+V+DMLE
Sbjct: 826  DEESMDDEKMMELDDQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLE 885

Query: 867  IYCKYVVRLAGKSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKL 926
            ++ K+V R   K+++C  ++L ++ SM  PL+KC+QQT D+ LA+K +KL+KN +CKLKL
Sbjct: 886  VFVKFVER-TSKNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKL 944

Query: 927  EPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEV 986
                   D++ E+   +L  +H  MLA K GQF  LYF  CS  SLFL K+LV    ++ 
Sbjct: 945  PKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDS 1004

Query: 987  TYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024
             Y+R+IDIY  ++K W  KGKFG +FF DFINWLASK+
Sbjct: 1005 IYDRLIDIYLSTMKKWFSKGKFGTSFFFDFINWLASKK 1042

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1017

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1059 (39%), Positives = 607/1059 (57%), Gaps = 82/1059 (7%)

Query: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
            +VNRD FY+LASD++EERV+AAV ++ ELS +   D   EW YVL RLI GL+S+R  AR
Sbjct: 4    RVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRNSAR 63

Query: 63   LGFSMCLSEVVTLGL--EKGR---LESVEVYIG--------QLFEKLADGHVKNGKEERG 109
            LGFS+CL+EV+ L L  E  R   L S++ ++         Q   + +   +K GK+ERG
Sbjct: 64   LGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIK-GKDERG 122

Query: 110  LVFGKLFGLQALLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQ 169
            L+FGK+FGLQALL+EPLF ++F+  +     F + FMD L +LA+ K+WLREPCLFTL+Q
Sbjct: 123  LLFGKMFGLQALLSEPLFEKVFISKEKGISDFALRFMDELCQLAVFKSWLREPCLFTLFQ 182

Query: 170  LIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXX 229
              E++     ++   + + +LLD ++LTLTNEGLAIYLLL+Y+                 
Sbjct: 183  AYERILP-LADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQMDFESK 241

Query: 230  TLRSCWKNNDPLSKGNVTILSSVLKDI-IPVEDNVMKQKGSWAPRLHFVWDILIPILCRQ 288
            +    WK+NDPL++GN+ +LS VL+D  +  ED    +  +W PRLHFVWDIL+PI+ + 
Sbjct: 242  S----WKSNDPLARGNLPLLSQVLRDSSVATEDESSPKASNWTPRLHFVWDILLPIITQD 297

Query: 289  QEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLII 348
                  +                     + F EFWQ+ VDES FN KAS+ERK+LGL+I 
Sbjct: 298  N-----SRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIF 352

Query: 349  EKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPT-KVLP 407
            +KA++  P   V   FS+N+MRTLIN +S+S R L KIS  VL +IV IC+  P  K++P
Sbjct: 353  QKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVP 412

Query: 408  VVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSK-- 465
             ++++ FGP+GSINFD LTKSKT  +++AV GL    L  L  L+ S +  ESS V +  
Sbjct: 413  CLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNL-IESSLVEQKN 471

Query: 466  VRYLLDILLHIVQAHK--LKADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXXXE 523
             +++LD +LH V++HK  L  D+  T  +L  I+ L+FF  K                  
Sbjct: 472  QQFILDTMLHAVRSHKSELNKDIIVTS-ILRPIISLAFFTVK------------------ 512

Query: 524  SKKIPVLSRERLFSILGQLIPTSKQNVDGPTWPYVTLQIVIAE-EHRRSLIFKLDEELQQ 582
             +    L++ER +SIL ++   +  N +GP++  + L I+  E    + L  KLD+ L+ 
Sbjct: 513  DEHTSNLAKERFYSILSEI---THLNNEGPSYQNMALDIIRDEIAAGKELTTKLDDTLED 569

Query: 583  TKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSI 642
             K  AL+ +  I   ++++PQ   L GLE+L+ + +LQ+YSG++E+ S++EEL  FY+  
Sbjct: 570  VKSEALRTLQAI-SNNEKNPQ---LRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQDT 625

Query: 643  DTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQG 702
            D     LVGITEILLS++AQKKAVLR+L+L  W+  + +I   EL  L D+L  RENK+G
Sbjct: 626  DENSTSLVGITEILLSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKG 685

Query: 703  FAALFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFEECGSNEEDSGNNGYN 762
            F+ LF                                           + E+ + N    
Sbjct: 686  FSQLFEGEDDFEEAEEEFDEDAEKDNEEDNEEESEEDEESEEDDLSSSTGEDSNEN---Q 742

Query: 763  EYIDKINKETTSALADALKLPENMIXXX----------------XXXXXXXXXXXXXXXX 806
            + + KI+KE TSALA AL LP+N++                                   
Sbjct: 743  DDVAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDE 802

Query: 807  XXXXXXXXXXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLE 866
                           QLS+IFKRRK+ALS + TGN+RK E +ESRE VI+FK RV+DMLE
Sbjct: 803  DEDSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLE 862

Query: 867  IYCKYVVRLAGKSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKL 926
            IY K+V + + K +    SK+ +   +++P++KCIQQT D+ LA + AKLL+  + KLK 
Sbjct: 863  IYVKFVEKQSLKEEN--YSKISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKT 920

Query: 927  EPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVV-TKPDE 985
              F G  D+   +  L +   H  +   KPGQ Q +Y+  CST+SLFL KI++  +   +
Sbjct: 921  SAFCGSCDQDELMEMLRM--THEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSKD 978

Query: 986  VTYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024
               + IID+Y++++K W   GKFGPN FIDF NWL+S++
Sbjct: 979  AAVHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5 DNA
            polymerase V
          Length = 1021

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1057 (39%), Positives = 600/1057 (56%), Gaps = 75/1057 (7%)

Query: 1    MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG 60
            M +VNRD FY+LASD+ EER++AAVG++ +LS +      +EW Y + RL+KGL S+R  
Sbjct: 1    MAKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNS 60

Query: 61   ARLGFSMCLSEVVTLGLEKGR-----LESVEVYIGQLFEKLA----DGHVKNGKEERGLV 111
            ARLGFSMCLSE + L L  G      L S+E Y+  L E L     +G  + GK+ERG++
Sbjct: 61   ARLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEGKKRKGKDERGIL 120

Query: 112  FGKLFGLQALLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLI 171
            FGKLFGLQALLNEPLF  +F+    I   F  +F+  ++ L+  K W+REP LF+LYQ +
Sbjct: 121  FGKLFGLQALLNEPLFSNVFVTKDGIS-NFVPVFVQEMINLSKCKNWIREPALFSLYQTL 179

Query: 172  EKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXXTL 231
            EKL SK ++   +  +   LD + LT+TNEGLAIYLLL+ E  +                
Sbjct: 180  EKLISKVSK-SDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQ---- 234

Query: 232  RSCWKNNDPLSKGNVTILSSVLKD---IIPVEDNVM-KQKG--SWAPRLHFVWD-ILIPI 284
               WK+NDPL+KGN+  L+ VL D   +   EDN   KQKG  +W PRLHFVW+ +L  I
Sbjct: 235  NQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTI 294

Query: 285  LCRQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLG 344
            +     +    +HV                A + F EFWQ+VVDE++FN KASSERKYLG
Sbjct: 295  INGSHSLNVEDKHVSKKRKKNNTI------ASIKFHEFWQMVVDETYFNDKASSERKYLG 348

Query: 345  LLIIEKAMQCVPS-SYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPT 403
             LI ++A   + S   V     +N +R+LINQ SE  R+L+KI+   ++ IV  CE+D T
Sbjct: 349  FLIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT 408

Query: 404  KVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPV 463
            K+LPV  +L FG +GSI FD L+K+K +  ++ ++ ++ E L+ L  ++  ++  +S   
Sbjct: 409  KILPVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEK 468

Query: 464  SKVRYLLDILLHIVQAHKLKAD-MFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXXX 522
            S  +++LD +LH+V+  K + D +  T+ +L  IVKL+FF                    
Sbjct: 469  SFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTG------------------ 510

Query: 523  ESKKIPVLSRERLFSILGQLIPTSKQNVDGPTWP-YVTLQIVIAE-EHRRSLIFKLDEEL 580
            +++ +  +S+ERLFSIL +L   S    +    P YV +++V    E    +  +LD+EL
Sbjct: 511  DNETLQEMSKERLFSILSEL--NSLHLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDEL 568

Query: 581  QQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYK 640
            ++T+  AL+ + +I  K+ + P    L GL  L    +LQ+Y+GD+ES   L+EL   Y+
Sbjct: 569  RETESSALRILAEI-AKATDKPY---LRGLGSLFATCLLQLYTGDSESVGTLQELKDIYE 624

Query: 641  ---SIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVR 697
               S D +P  L  ITEILLS++AQKKA+L++ ++ VWE ++  +  DELNLL DIL  R
Sbjct: 625  KLISDDERP--LSSITEILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLAR 682

Query: 698  ENKQGFAALFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFEECGSNEEDSG 757
            ENKQGFA LF                                       E+   + ED+ 
Sbjct: 683  ENKQGFAQLFEGIDEYEEDEDDEQLEDEEQIKEVTDDSSSNSESDSEEDEDNSDSHEDTS 742

Query: 758  NNG---YNEYIDKINKETTSALADALKLPENMIXXX---XXXXXXXXXXXXXXXXXXXXX 811
            ++    +N+ ++ I+KETTSALA AL LP ++I                           
Sbjct: 743  SDSVEDHNDAVNNIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESM 802

Query: 812  XXXXXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKY 871
                      QLSEIFKRRKEALS +PTGNKRK EV+ESRESVI+FKHR++D+L +Y K+
Sbjct: 803  DDEQMMDLDDQLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKH 862

Query: 872  VVRLAGKSQQCEASKLLNIHSMID---PLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEP 928
            V ++  +    E SK   ++ ++    P++KCI+QT+D+ LAEK AKLLK  + K+++  
Sbjct: 863  VEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTG 922

Query: 929  FKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKP-DEVT 987
             K    +V E      + IH   L  KPGQF  LY+  CS++SL+  KILV      +  
Sbjct: 923  IKLDTADVVE----DFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGV 978

Query: 988  YNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024
            Y  ++D YS +IK W    KF  + F+DF+NWLASK+
Sbjct: 979  YETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKK 1015

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1084 (36%), Positives = 600/1084 (55%), Gaps = 108/1084 (9%)

Query: 1    MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQ-------EWQYVLGRLIKG 53
            M+ VNRD+FYRLASD+EEER+++ V +V EL E+   ++++       EW YV+ RLI G
Sbjct: 1    MQVVNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLING 60

Query: 54   LASARQGARLGFSMCLSEVVTLGLEKG-------RLESVEVYIGQLFEKLADGHVKNG-- 104
            LAS R+GARLGFS+CL+EV+ L L +         L  +  ++  + + L+    K G  
Sbjct: 61   LASNRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEP 120

Query: 105  ------KEERGLVFGKLFGLQALLNEPLFGRIF-MDGKVIDLQFTVLFMDHLVKLALSKT 157
                  K+ERGL+FGKLF LQ+LLN+P+FG+IF  D K I  +F       L+ L+  K 
Sbjct: 121  RKLLKGKDERGLLFGKLFALQSLLNDPIFGKIFNKDNKAILFEFIY----ELIALSNLKN 176

Query: 158  WLREPCLFTLYQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETX 217
            W++EP LFTL+  I+K+  +F +   +  +  +L  + LTLTNEGL+IY+ LIY    T 
Sbjct: 177  WIKEPTLFTLFNFIQKII-EFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIY----TN 231

Query: 218  XXXXXXXXXXXXTLRSCWKNNDPLSKGNVTILSSVLKDIIPV-EDNVMKQKGSWAPRLHF 276
                           + WKNNDP  K N+ +LS VL +     +        +W PRLH+
Sbjct: 232  PHISPEDIQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSEKHTSNANWTPRLHY 291

Query: 277  VWDILIPILCRQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKA 336
            VWD+++PIL      P +++ +               R  + F+EFW+ V+DESFFN KA
Sbjct: 292  VWDVILPILLN----PKSSDKL---LNKNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKA 344

Query: 337  SSERKYLGLLIIEKAMQCVPSSY-VPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIV 395
            S ERKYLG LII+K    + ++  + SIF+ N++R++INQ ++S R L+KIS   +  IV
Sbjct: 345  SHERKYLGFLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIV 404

Query: 396  SICESDPT-KVLPVVNSLWFGP--NGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALI 452
            S C+S+   +++PV+N   F    + SINFD LTK+KT+  +I +Q L ++ L+ L  L 
Sbjct: 405  SQCQSNSELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLF 464

Query: 453  VSEIDKESSPVSKVRYLLDILLHIVQAHKLK--ADMFWTKPLLSSIVKLSFFNDKLSDFE 510
             S++D  ++  +++++LLD +LHI+++HK +      +  P+L  I+ L+FF +      
Sbjct: 465  TSKLDSFTT-TTELQFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKE------ 517

Query: 511  XXXXXXXXXXXXESKKIPVLSRERLFSILGQLIPTSKQNVDGPTWPYVTLQIVIA--EEH 568
                            I  + ++RL SIL  L    +   +  +  Y+TL +++   E+ 
Sbjct: 518  -----------TADVSISNILKDRLISILNDLTTVGE---NSSSIQYLTLNLIVNLNEDP 563

Query: 569  RRSLIFKLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAES 628
            +  L FK D+ L + K+    AI  +++  + S + S L  L  LL ++++Q+Y  D +S
Sbjct: 564  KNVLNFKFDDSLLEVKD---SAITTLKRAIEHSKRDSRLKSLVSLLSLSVIQLYLADIDS 620

Query: 629  ASILEELTTFY---------KSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLI 679
             + +++L  FY         K+   +P+  +GI EILL++ AQKK++L++L L +WES I
Sbjct: 621  IATIQDLCDFYDRYKSNTIMKNDKNRPS--LGIIEILLALFAQKKSILKKLGLAMWESFI 678

Query: 680  DKIEGDELNLLFDILSVRENKQGFAALFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 739
            D IE +E + +FD+L  RENK+GFA LF                                
Sbjct: 679  DLIELNEFDEIFDVLLTRENKEGFARLFEGDDEYEEIDSHDDEEKDEDKNIDDISTENSD 738

Query: 740  XXXXXYFEECGSNEEDSGNNGYNEYIDKINKETTSALADALKLPENMIXXX--------- 790
                   ++  S+EE+      N+ I++I+KE TSALA ALKLP+N+I            
Sbjct: 739  -------DDNSSDEENDSIVESNDDINRIDKEATSALAKALKLPDNIINDKGEVDLGKLE 791

Query: 791  --XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVR 848
                                            GQLS+IF RRKEALS + TGNKRKL+V+
Sbjct: 792  DISDNEVHFSSSDDDADMSDESMDDEQMMELDGQLSQIFSRRKEALSNIQTGNKRKLDVK 851

Query: 849  ESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQCEAS---KLLN-IHSMIDPLLKCIQQT 904
            ESRE+VI+FKHR++DM+E+Y K++  +   S+  E +   K+LN I  +I  LL CIQQT
Sbjct: 852  ESRENVIAFKHRIVDMIEVYLKHIEIITKSSENIERTYFNKILNSIPLIIKSLLLCIQQT 911

Query: 905  IDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVFLSLENIHNS-MLAKKPGQFQQLY 963
            +DR LAEK +KLLKN + K+KL  FK C D  SE +   +  +H   +L KK GQ+Q LY
Sbjct: 912  LDRNLAEKISKLLKNKLFKIKLVEFKDCGDLTSENILEWISTLHTECILVKKSGQYQPLY 971

Query: 964  FGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNW--TVKGKFGPNFFIDFINWLA 1021
            F  CS SSLF  +I   T  +   Y+ +ID+Y Q+ K W    + K     F DF NWL+
Sbjct: 972  FKLCSGSSLFYCRIFAETSTNADLYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLS 1031

Query: 1022 SKRS 1025
            SKRS
Sbjct: 1032 SKRS 1035

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  543 bits (1400), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 303/726 (41%), Positives = 459/726 (63%), Gaps = 63/726 (8%)

Query: 1   MKQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQG 60
           M++VNRD FY+LASD+ EERV++AV ++ +LS +   + E+E++YVL RLI GL+S R  
Sbjct: 1   MEKVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNS 60

Query: 61  ARLGFSMCLSEVVTLGLEKGR-----LESVEVYIGQL-----FEKLADGH-VKNGKEERG 109
           ARLGFS+CL+EVV L L++       L S++ ++  +      + +A G  +K GK+ERG
Sbjct: 61  ARLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120

Query: 110 LVFGKLFGLQALLNEPLFGRIFMD--GKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTL 167
           ++FG++F LQALLNEPLF ++F+D  GK+   +F + F   LV+LA+ K WLREPCLFTL
Sbjct: 121 IMFGRMFALQALLNEPLFAKVFIDKNGKIS--KFAIRFQTQLVELAVLKNWLREPCLFTL 178

Query: 168 YQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXX 227
           YQ +EK    + +  ++E++ +LLD +KLTLTNEGLAIYL LI+                
Sbjct: 179 YQTVEKFMP-YIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIH--------TNGKKIAS 229

Query: 228 XXTLRS-CWKNNDPLSKGNVTILSSVL-KDIIPVEDNVMKQKGSWAPRLHFVWDILIPIL 285
              L S  WK NDPL+KGN+  L+ VL    I   +       +W+PRLHFVWDIL+PIL
Sbjct: 230 SLPLESQGWKLNDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPIL 289

Query: 286 CRQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGL 345
             Q       EHV                  + F  FW++VVDESFFN K+SSERKYLG 
Sbjct: 290 LGQDSTTND-EHVSKKQKSKTTSS-----TSIKFQSFWKMVVDESFFNEKSSSERKYLGF 343

Query: 346 LIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKV 405
           LII+K+++ VP+  V S+F +N++R++INQS+++ R LHKIS  VL +I+  CE D TK+
Sbjct: 344 LIIQKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKI 403

Query: 406 LPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSK 465
            P+V  + FG NG+ NFD LTK+KT++ I++++ L+ E L+ +  ++ +EI   S  + K
Sbjct: 404 TPIVKVILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQK 463

Query: 466 VRYLLDILLHIVQAHKLKADM-FWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXXXES 524
            +++LD +LH+V+ HKL+ ++      LL+ ++ L+FF                    E+
Sbjct: 464 DQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF------------------LKEN 505

Query: 525 KKIPVLSRERLFSILGQL--IPTSKQNVDGPTWPYVTLQIVIAEEHRRS-LIFKLDEELQ 581
           ++I  +++ER FS+L +L  I TS +     +W Y  L+++  +E   S L  ++D++L 
Sbjct: 506 ERISNIAKERFFSLLSELAAITTSTR-----SWQYTALELISNKEASGSPLNQEMDQDLI 560

Query: 582 QTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYKS 641
             KE  ++ + ++ KKS       +L GLE LL +++LQ+Y+GD +S SI+E+L TFY  
Sbjct: 561 AIKEKGIECLKEVTKKS----DTVQLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDE 616

Query: 642 IDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQ 701
            +     LVGITEILL+++AQ+KAVL+++ L+ WE  +  I  +E+ +L D+L+ RENK+
Sbjct: 617 REDDSVSLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKE 676

Query: 702 GFAALF 707
           GFA LF
Sbjct: 677 GFAQLF 682

 Score =  213 bits (541), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 163/277 (58%), Gaps = 18/277 (6%)

Query: 767  KINKETTSALADALKLPENMIXX-----------XXXXXXXXXXXXXXXXXXXXXXXXXX 815
            KINKETTSALA AL LP+N+I                                       
Sbjct: 738  KINKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEK 797

Query: 816  XXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRL 875
                  QLSEIFKRRKEALS V +GN+RKL+V+ESRE+VI+FKHR++D+LE Y KYV ++
Sbjct: 798  MMELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857

Query: 876  AGK---SQQCEASKLLN-IHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKG 931
              +    Q     +LLN +  M++ +++CIQ T+DRPLA+K +KLLK  + K+ L  F  
Sbjct: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917

Query: 932  CVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILV-VTKPDEVTY-- 988
                  E V   L+ IH  ++  KPGQ   LYF  CSTSSLFL K+L+  T  DE +Y  
Sbjct: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977

Query: 989  NRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKRS 1025
            +++IDIY +  K W +KG+FGP  F+DF NWL SK++
Sbjct: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKN 1014

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  540 bits (1391), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 322/727 (44%), Positives = 442/727 (60%), Gaps = 61/727 (8%)

Query: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
           +VNRD FYRLASD+++ERVKAAV ++ ELS +      +EW YVL RLI GLAS R  AR
Sbjct: 4   KVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSAR 63

Query: 63  LGFSMCLSEVVTLGLEKGRL-----ESVEVYIGQLFEKLADGHVKN------GKEERGLV 111
           LGFS+CLSEVV + L+KG L      S + Y+  L   L+   V        GK+ERG++
Sbjct: 64  LGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGIL 123

Query: 112 FGKLFGLQALLNEPLFGRIFMD--GKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQ 169
           FGK+FGLQA+LNEPLF  IF D  GKV    F + F   L +LA+ K WLRE CL+TL+Q
Sbjct: 124 FGKMFGLQAILNEPLFTSIFFDQEGKVS--PFALRFAQELAELAVKKNWLRESCLYTLFQ 181

Query: 170 LIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXX 229
            +++L     E   + +I  LLD ++LT+TNEGLAIYLLL +                  
Sbjct: 182 TVQRLVPAM-ESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLAL 240

Query: 230 TLRSCWKNNDPLSKGNVTILSSVLKDIIP----VEDNVMKQKGSWAPRLHFVWDILIPIL 285
              + WKNNDPLSKGN+  LS VL+D       V D    +  +W PRLHFVWDILIPIL
Sbjct: 241 EF-AAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPIL 299

Query: 286 CRQQEIPGAA-EHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLG 344
                 PG + E +P                 + F EF+Q  VDE+FF+ KASSERKYLG
Sbjct: 300 A-----PGKSDEEIPSKKSHKKKKKDTV--EGIEFPEFFQAAVDETFFSEKASSERKYLG 352

Query: 345 LLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPT- 403
            L+  +A++ V S ++ S F++N MRTLINQSS+S R L+KIS   L  IV  CE D + 
Sbjct: 353 FLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASE 412

Query: 404 KVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPV 463
           K+   + ++ FGP+G+I+FD LTKSKT   ++A++ + S  L  L  ++ +++ +E  P 
Sbjct: 413 KIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPN 472

Query: 464 SK-VRYLLDILLHIVQAHKLK-ADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXXX 521
            +  +++LD +LH V+ H+L+ +      PLL SIV L+FF+ K  D             
Sbjct: 473 KQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGED------------- 519

Query: 522 XESKKIPVLSRERLFSILGQLIPTSKQNVDGPTWPYVTLQIVIAEEHR-RSLIFKLDEEL 580
                I  L+RERLFSIL +L        DG +W + TL++++++E      I KLDE+L
Sbjct: 520 -----ISDLARERLFSILSELTIQK----DGQSWQHYTLKLILSKEAEGNEPINKLDEDL 570

Query: 581 QQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFYK 640
           +  +  AL  + +I   S +SPQ+    GLE LL   +LQ+YSGD+ES SI+EEL  FY+
Sbjct: 571 KAIETEALDILQNI---SSDSPQSR---GLEWLLSNCLLQLYSGDSESLSIVEELCIFYR 624

Query: 641 SIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENK 700
               + N LVGITEILLS++AQKKA+LR+L+L+VWE  + ++   EL +L ++L  RENK
Sbjct: 625 EGLNESNSLVGITEILLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENK 684

Query: 701 QGFAALF 707
           +GFA LF
Sbjct: 685 EGFAKLF 691

 Score =  216 bits (550), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 167/282 (59%), Gaps = 24/282 (8%)

Query: 765  IDKINKETTSALADALKLPENMIXXXXXXXXXXXXXXXXXXXXXXXXXXX---------- 814
            + KI++E TSALA AL LPEN++                                     
Sbjct: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEE 814

Query: 815  -------XXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEI 867
                          QLS+IFKRRKEALS V TGN+RK+EV+E+RE+VI+FKHR++DMLE 
Sbjct: 815  EESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874

Query: 868  YCKYVVRLAGKSQQCEASK---LLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKL 924
            Y K+  R+A +    EA+      N+   ++P+++C+Q T+D+PLA+K +KLLK  + K+
Sbjct: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934

Query: 925  KLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPD 984
            K+  FKG +D  S+ +   LE  H ++L  KPGQF  LYF  CST+SLFLGK+LV    +
Sbjct: 935  KISAFKGAID--SKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSE 992

Query: 985  E--VTYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024
            +  ++Y ++ID+Y+ + K W + GKFG N F DF NWL S++
Sbjct: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRK 1034

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1028

 Score =  537 bits (1383), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 324/740 (43%), Positives = 457/740 (61%), Gaps = 56/740 (7%)

Query: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
           +VNRDLFY+LAS++ EER++AAV I+ ELS +   D+ +EW YVLGRLIKGL+S R GAR
Sbjct: 7   KVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRTGAR 66

Query: 63  LGFSMCLSEVVTL-------GLEKGRLESVEVYIGQLFEKLA--DGHVKN-----GKEER 108
           LGFS+CL+EV+ L       G+E   L +++ Y+  L E L+   G+ +N     GK+ER
Sbjct: 67  LGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGKDER 126

Query: 109 GLVFGKLFGLQALLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLY 168
           GL+FGK+FGL+ALLNEPLF + F+  K +   F   FM  L+ LA  K W+REPCLFTL+
Sbjct: 127 GLLFGKMFGLKALLNEPLFSKTFLPNKKVASNFCERFMVELLDLASRKNWIREPCLFTLF 186

Query: 169 QLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXX 228
           Q +EKL   F +   ++ +  LLD HK TLTNEGLAIYLLL+++  E             
Sbjct: 187 QTVEKLLP-FADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKIKLLV 245

Query: 229 XTLRSCWKNNDPLSKGNVTILSSVLKD--IIPVEDNVMKQKGSWAPRLHFVWDILIPILC 286
               S WK NDPL++GN+  L+ VL++  +   E  V     +W PRLHFVWDIL+P + 
Sbjct: 246 LK-NSSWKLNDPLARGNLPRLTQVLRESSLASEEKKVEVMSANWQPRLHFVWDILLPTVS 304

Query: 287 RQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLL 346
             +                       +R P    EFWQ+ VDESFFN KASSERKYLG  
Sbjct: 305 TIESNSDEKHMSKRRKKNKGPETNTYIRFP----EFWQMTVDESFFNEKASSERKYLGFS 360

Query: 347 IIEKAMQCVPSS-YVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDP-TK 404
           I E+A+  V +  +  + FS+N MR+LINQSS+++R LHKIST V+  IV  CE  P TK
Sbjct: 361 IFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEESPSTK 420

Query: 405 VLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEID-KESSPV 463
           ++PV++S+ F  NGS NFD LTKSKT+  +I++ GL    L  L  ++ S+I    S   
Sbjct: 421 LIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGTSEDF 480

Query: 464 SKVRYLLDILLHIVQAHKLKADMFWT-----------KPLLSSIVKLSFFNDKLSDFEXX 512
            K +++LD LLHIV++H  K D+F +           K  ++ +V+L+FF          
Sbjct: 481 KKTQFILDSLLHIVRSH--KQDIFDSCTGSTETELIIKHAIAPLVRLAFF---------A 529

Query: 513 XXXXXXXXXXESKKIPVLSRERLFSILGQLIPTSKQNVDGPTWPYVTLQIVIAEEHR--R 570
                        ++  L++ERLFS+L +L  T+ + +   +W Y TL  +I  E+    
Sbjct: 530 QTDIAKKEDESDNQVDELAKERLFSVLSELTTTTNKQLH--SWQYYTLLEIIDRENENPN 587

Query: 571 SLIFKLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESAS 630
           SLI K+D++L+  +++A+K I  I  K++++  + E  GLE LL + +LQ+YSGDA+S +
Sbjct: 588 SLINKMDDDLKTVRDNAIKVIKGIASKNEKTTSSGER-GLESLLSMCLLQLYSGDADSVA 646

Query: 631 ILEELTTFY---KSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDEL 687
            +EEL TFY   + ++ K   +VGITEILLS++AQKKAVL++L+L+VWE  + +I+ D L
Sbjct: 647 TIEELITFYNASRDVEEK-RTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVL 705

Query: 688 NLLFDILSVRENKQGFAALF 707
           NLL D+L  RENKQGFA LF
Sbjct: 706 NLLLDVLPARENKQGFAELF 725

 Score =  215 bits (548), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 166/268 (61%), Gaps = 17/268 (6%)

Query: 762  NEYIDKINKETTSALADALKLPENMIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG 821
            NE I KI+KE TSALA AL LP+++I                                  
Sbjct: 772  NEAIAKIDKEATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKMMELDD 831

Query: 822  QLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQ 881
            QL+EIFKRRKEALS V TGN+RK+EV+ESRESVI+FKHRV D+L IY K+          
Sbjct: 832  QLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKH---------- 881

Query: 882  CEASKLLNIHSM--IDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEI 939
             E S+L   +++  I+P++KC+QQT+D+ LA+K +KLLK  + KLK    K   +  +E 
Sbjct: 882  AEDSELPAKYAILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKT---KNMEEITAEQ 938

Query: 940  VFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPD-EVTYNRIIDIYSQS 998
            VF  + ++H ++L  KPGQ+Q  ++  CS++S+FL K+L++   D E  Y +I+DIYS++
Sbjct: 939  VFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIVDIYSET 998

Query: 999  IKNWTVK-GKFGPNFFIDFINWLASKRS 1025
             K W +K  KFG N FIDF NWL+SK+S
Sbjct: 999  TKKWVLKDSKFGSNIFIDFYNWLSSKKS 1026

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
           POL5DNA Polymerase phi; has sequence similarity to the
           human MybBP1A and weak sequence similarity to B-type DNA
           polymerases, not required for chromosomal DNA
           replication; required for the synthesis of rRNA
          Length = 1022

 Score =  528 bits (1360), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 309/733 (42%), Positives = 448/733 (61%), Gaps = 62/733 (8%)

Query: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
           +VNRDLF++LASD+ EER+ AAV ++ +LS +   D+ +EW YVL RLIKGL+S R  AR
Sbjct: 4   KVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRNSAR 63

Query: 63  LGFSMCLSEVVTL------GLEKGRLESVEVYIGQLFEKLA----DGHVKN--GKEERGL 110
           LGFS+CL+EV+ L      G     LES   ++  L   L     +G  K+  GK+ERG+
Sbjct: 64  LGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDERGI 123

Query: 111 VFGKLFGLQALLNEPLFGRIFM-DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQ 169
           +FGKLFGL++LLNEPLF  IF+ D +  + +F + F + L+ LAL K W++EPC FTL+Q
Sbjct: 124 LFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFTLFQ 183

Query: 170 LIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXX 229
            + K+   F +    E I  + D + LTLTNEGL+ YLLL YE  E+             
Sbjct: 184 TM-KMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLK---- 238

Query: 230 TLRSCWKNNDPLSKGNVTILSSVLKD--IIPVEDNVMKQ-----KGSWAPRLHFVWDILI 282
                WK+NDPL++GN+ +L+ VL++  +IP  +  +K+       +W PRLHFVW +L+
Sbjct: 239 --NPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLL 296

Query: 283 PILCRQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKY 342
           P+        G  E+               V+  + F EFW++ VDESFFN KASSERKY
Sbjct: 297 PLFGN-----GKLENTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKY 351

Query: 343 LGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESD- 401
           LG LII+ A + VP SY+   FS+N+MRTLINQS +S R L+KIS   L +IV  CE D 
Sbjct: 352 LGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDS 411

Query: 402 PTKVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESS 461
             +++P +N++ FGP+GSINFD LTKS T+  +IA++ L S  LA L+ +   ++  +  
Sbjct: 412 ANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKKG 471

Query: 462 PVSKVRYLLDILLHIVQAHKLK-ADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXXX 520
            +S   + LD +LHIV+AHK++  DM   KP+L  IV ++FF     D +          
Sbjct: 472 VLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKL--------- 522

Query: 521 XXESKKIPVLSRERLFSILGQLIPTSKQNVDGP---TWPYVTLQIV--IAEEHRRSLIFK 575
               +++  L++ERL+SILG+L    +     P   +W Y+TL+++  I   H   LI  
Sbjct: 523 ----EQLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINP 578

Query: 576 LDEELQQTKEHALKAINDI-RKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEE 634
           LDE L+  K  A+  ++ + R ++ +S       GL  LL + ++Q+Y+GD +S S++EE
Sbjct: 579 LDENLENIKNEAISCLSKVCRSRTAQS------WGLSTLLSMCLVQLYAGDTDSISVIEE 632

Query: 635 LTTFYKSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDIL 694
           L  F K    + N +VGITEILLS++AQKKA+LR+L+LI+W+  I+++  +EL +L DIL
Sbjct: 633 LCEFSKH---ENNSMVGITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDIL 689

Query: 695 SVRENKQGFAALF 707
             RENKQGFA LF
Sbjct: 690 KARENKQGFAQLF 702

 Score =  202 bits (514), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 157/264 (59%), Gaps = 10/264 (3%)

Query: 768  INKETTSALADALKLPENMIXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXGQLS 824
            I+KE TSAL  AL LP+N++                                     QLS
Sbjct: 755  IDKEATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDDQLS 814

Query: 825  EIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYV--VRLAGKSQQC 882
            EIFKRRKEALS + TGN+RK EV++SRE+VISFKHRV+DML +Y KY   + LA KS+  
Sbjct: 815  EIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHS 874

Query: 883  E--ASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIV 940
                  L  +   I P+LKC+ +T+DRPLA+K +KLLK  I K+K+  FK    ++ E++
Sbjct: 875  NNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDI-ELM 933

Query: 941  FLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIK 1000
             L L+  H  ML  KPGQ   +++  CSTSSLFL K+ V    ++   + +ID+Y+ + K
Sbjct: 934  DL-LKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGND-KLDELIDLYTATTK 991

Query: 1001 NWTVKGKFGPNFFIDFINWLASKR 1024
             W  KGK GPN FIDFINWL+SK+
Sbjct: 992  EWMQKGKCGPNIFIDFINWLSSKK 1015

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  528 bits (1359), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 316/751 (42%), Positives = 453/751 (60%), Gaps = 69/751 (9%)

Query: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
           +VNRDLFY+LASD+EEER+++AV ++ ELS++   D+ +EW YVL RLIKGLAS R  AR
Sbjct: 4   KVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRNSAR 63

Query: 63  LGFSMCLSEVVTLGLEKGR-----LESVEVYIGQLFEKLA-DGHV-----------KNGK 105
           LGFS+CL+E + L L  G      ++S+  ++  L + L  D +            K G+
Sbjct: 64  LGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKKKGR 123

Query: 106 EERGLVFGKLFGLQALLNEPLFGRIFM--DGKVIDLQFTVLFMDHLVKLALSKTWLREPC 163
           +ERG++FGKLF LQALLNEPLF  IF+  D K ID    + ++D L  L   K W+RE C
Sbjct: 124 DERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIRESC 183

Query: 164 LFTLYQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXX 223
            FTLYQ IEKL   + ++   + +  LLD ++LTL+ EGLAIYLL+IY            
Sbjct: 184 FFTLYQTIEKLLP-YADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEKTL 242

Query: 224 XXXXXXTLRSCWKNNDPLSKGNVTILSSVLKDI---------IPVEDNVMKQKGSWAPRL 274
                    S WK+N+PL++GN+  L+++L+D           P   N  +   +WAPRL
Sbjct: 243 SDIQLSN--SHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPRL 300

Query: 275 HFVWDILIPILCRQQEIPGA-AEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFN 333
           HFVWDIL+PIL          ++                    + F EFWQ+ +DESFFN
Sbjct: 301 HFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDESFFN 360

Query: 334 AKASSERKYLGLLIIEKAMQCV---PSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNV 390
            KASSERKYLG LI +K +Q +    +  + + F++N MR+LINQSS++ R LHK+S   
Sbjct: 361 EKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQIA 420

Query: 391 LKNIVSICESDPT-KVLPVVNSLWFGPN--GSINFDILTKSKTMDSIIAVQGLKSEHLAS 447
           +  IV +CE DP+ K++P +++L F  N  GSINFD LTKSKT+  +I+++ L S  L  
Sbjct: 421 IDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSSTLRQ 480

Query: 448 LVALIVSEIDKESS--PVSKV-RYLLDILLHIVQAHKLKADM-FWTKPLLSSIVKLSFFN 503
           L+ L +S+I+  S+   ++ V ++ LD +LH+V++HK + D     +PLL+ +VKL+FF+
Sbjct: 481 LIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFFS 540

Query: 504 DKLSDFEXXXXXXXXXXXXESKKIPVLSRERLFSILGQLIPTS---KQNVDGPTWPYVTL 560
                              +++ +  L++ERL+SIL +L   +   K +    +W Y TL
Sbjct: 541 ------------------KDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTL 582

Query: 561 QIVIAEEH--RRSLIFKLDEELQQTKEHALKAINDIR-KKSQESPQASELCGLELLLGVT 617
           Q+++  E    + L+ KLD +L+  K + LK +N+I    + E  Q S+  GLELLL + 
Sbjct: 583 QLILELEKSGNQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSK--GLELLLSMC 640

Query: 618 ILQMYSGDAESASILEELTTFY-KSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWE 676
           ILQ++SGD ES S +EEL  FY  S   +   LVGITEILLS++AQKKA+LR+L+L VWE
Sbjct: 641 ILQLFSGDTESLSTIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWE 700

Query: 677 SLIDKIEGDELNLLFDILSVRENKQGFAALF 707
             I  I  +ELN+L  +L VRENKQGFA LF
Sbjct: 701 HFISDIGKNELNVLLAVLPVRENKQGFAHLF 731

 Score =  206 bits (523), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/283 (42%), Positives = 163/283 (57%), Gaps = 26/283 (9%)

Query: 762  NEYIDKINKETTSALADALKLPENMIXXXXXXXXXXXXXXXXXXXXXXXXXXX------- 814
            N  I  I+KE TSALA AL LPEN++                                  
Sbjct: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEE 843

Query: 815  -----XXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYC 869
                        QLSEIFKRRKEALS + TGN+RK+EV+ESRE+VI+FKHRV+DML IY 
Sbjct: 844  SMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903

Query: 870  KYVVRLAGKSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLK---- 925
            KYV  L   ++  E  K  N+   I+P++KC++QT+D+ LA+K  KL+K  + K+K    
Sbjct: 904  KYVEGLTLTTENGE--KFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSNF 961

Query: 926  -LEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPD 984
             +E      D V E+    L+  H S+L  K GQF  LY+  CST S+FLGKILV  + +
Sbjct: 962  QIESLNADDDRVMEL----LQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESN 1017

Query: 985  --EVTYNRIIDIYSQSIKNWTV-KGKFGPNFFIDFINWLASKR 1024
              E+ Y ++ID+Y ++ K+W + KGKFG N F DF NWL+S+R
Sbjct: 1018 DKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
           YEL055C (REAL)
          Length = 1020

 Score =  515 bits (1327), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 310/732 (42%), Positives = 457/732 (62%), Gaps = 62/732 (8%)

Query: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
           +VNRDLF++LASD++EER+ AAV ++ +LS +    + +EW YVL RL+KGLAS R  AR
Sbjct: 4   KVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRNSAR 63

Query: 63  LGFSMCLSEVVTLGLE-------KGRLESVEVYIGQLFEKL----ADGHVKN--GKEERG 109
           LGFS+CL+EV+ L +        KG LES   ++  L   L     DG  K+  GK+ERG
Sbjct: 64  LGFSLCLTEVINLAINMPSGQRPKG-LESTNDFLNTLSSVLDVNVNDGGKKSVKGKDERG 122

Query: 110 LVFGKLFGLQALLNEPLFGRIFMDG-KVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLY 168
           ++FGKLFGL++LLNEPLF  IF+   +  +  F + F + L+ LAL K W++EPC FTL+
Sbjct: 123 ILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFTLF 182

Query: 169 QLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXX 228
           Q I K+   F +      I  + D + +TLTNEGL+ YLLL Y   +             
Sbjct: 183 QTI-KMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYGGDKNLIPSTLDLKNL- 240

Query: 229 XTLRSCWKNNDPLSKGNVTILSSVLKD--IIPVED----NVMKQKGS-WAPRLHFVWDIL 281
                 WK++DPL++GN+ +L+ VL+D  +IP  D    +  KQK + W PRLHFVWDIL
Sbjct: 241 -----GWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWDIL 295

Query: 282 IPILCRQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERK 341
           +P+        G  E+               V+  + F EFW++ +DESFFN KASSERK
Sbjct: 296 LPLFGS-----GKLENTEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERK 350

Query: 342 YLGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESD 401
           YLG LII+ A + VP SY+ S FS+N+MRTLINQS +S R L+KI+   L +IV  CE D
Sbjct: 351 YLGFLIIDAAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEED 410

Query: 402 PT-KVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKES 460
            T K++P +NS+ FGP+GS+NFD LTKS T+  +IA++ L S  L  L+ + + ++ +  
Sbjct: 411 LTNKLVPCLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSK 470

Query: 461 SPVSKVRYLLDILLHIVQAHKLK-ADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXXXX 519
             ++   ++LD +LHI++AHK++  DM   KP+L+ I+ ++FF D   D           
Sbjct: 471 RDLTHTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDD----------- 519

Query: 520 XXXESKKIPVLSRERLFSILGQLIPTSKQNVDGP---TWPYVTLQIVIAEE--HRRSLIF 574
              E +++  L++ERLFSILG+L    + + + P   +W ++TL++++  E  HR  LI 
Sbjct: 520 --QELEQLHELAKERLFSILGELTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILIN 577

Query: 575 KLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEE 634
            LDE L++TKE A+ ++ +I + S      ++  GL  LL + ++Q+Y+G+ +S S++EE
Sbjct: 578 PLDENLEKTKEEAISSLAEISRSS-----TAQAWGLSTLLSMCLIQLYAGETDSISVIEE 632

Query: 635 LTTFYKSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDIL 694
           L  F K    K N +VGITEILLS++AQKKA+L++L+LI+W+  I+ +  +EL +L D+L
Sbjct: 633 LCEFSKD---KNNSMVGITEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVL 689

Query: 695 SVRENKQGFAAL 706
             RENKQGFA L
Sbjct: 690 KARENKQGFAQL 701

 Score =  211 bits (537), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 121/264 (45%), Positives = 165/264 (62%), Gaps = 10/264 (3%)

Query: 768  INKETTSALADALKLPENMIXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXGQLS 824
            I+KE TSAL  AL LP+N++                                    GQLS
Sbjct: 753  IDKEATSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDGQLS 812

Query: 825  EIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYV--VRLAGKSQQC 882
            EIFKRRKEALS + TGN+RK+EV+ESRE+VISFKHR++DML +Y KY   + LA KS+  
Sbjct: 813  EIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLALANKSEDS 872

Query: 883  EA--SKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIV 940
             +  S L  +   I P+LKCI +T+DRPLA+K +KLLK  I K+K+  FK  +D+  E++
Sbjct: 873  SSIGSPLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIKVNAFKE-MDKNIEVM 931

Query: 941  FLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIK 1000
             L L++ H  +L  KPGQ   +++ ACSTSSLFL K+ V    ++   + +ID+Y+ + K
Sbjct: 932  DL-LKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGND-KLDELIDLYAATTK 989

Query: 1001 NWTVKGKFGPNFFIDFINWLASKR 1024
             WT +GKFG N FIDFINWL+SK+
Sbjct: 990  EWTNRGKFGANVFIDFINWLSSKK 1013

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
           YEL055C
          Length = 1004

 Score =  507 bits (1306), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 309/732 (42%), Positives = 454/732 (62%), Gaps = 64/732 (8%)

Query: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
           +VNRD FY+LASD+ EER++AAV ++ ELS +    ++ EW YV+ RLIKGL+S R GAR
Sbjct: 4   KVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRNGAR 63

Query: 63  LGFSMCLSEVVTLGLEKG------RLESVEVYIGQLFEKLA-----DGHVKNGKEERGLV 111
           LGFS+CL+EVV L ++         L+S++ ++  L +  +     +   + GKEERGL+
Sbjct: 64  LGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKEERGLM 123

Query: 112 FGKLFGLQALLNEPLFGRIFM-DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQL 170
           FGKLF LQALLNEPLF  IF+ DGK+   +FT  F+D LV LA  K W+++PCLFTLYQ 
Sbjct: 124 FGKLFALQALLNEPLFSDIFIKDGKIT--KFTTKFIDELVNLASRKNWIKQPCLFTLYQT 181

Query: 171 IEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXXXXT 230
           IE+L   +++   ++ +  +LD +K TLTNEGLAIYLL I +   +              
Sbjct: 182 IERLLP-YSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVT------ 234

Query: 231 LRSCWKNNDPLSKGNVTILSSVLKD-IIPVEDNVMK-QKGSWAPRLHFVWDILIPILC-- 286
               WK N+PL KGN++++S V+++  + V+DN  K    +W P+LHFVWDIL+PIL   
Sbjct: 235 -NKGWKYNNPLLKGNLSLVSEVVRESAVVVDDNETKTNNANWHPKLHFVWDILLPILYND 293

Query: 287 -RQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGL 345
            R++ +    +H                   + F EFW+ +VDE++F+ KASSERK+LGL
Sbjct: 294 PREEPLKKKKKH-----NNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGL 348

Query: 346 LIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPT-K 404
           LI  KA+  VPS ++   FS+N+MR LINQ S+S R+LHKI+   L +IV  CE+DP  K
Sbjct: 349 LIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHK 408

Query: 405 VLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVS 464
           ++PVV +L FG NGSINFD LTKSKT+  +IA +GL+ + +  L AL  SE++ + +  +
Sbjct: 409 LVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNE-A 467

Query: 465 KVRYLLDILLHIVQAHK--LKADMFWT---KPLLSSIVKLSFFNDKLSDFEXXXXXXXXX 519
            + ++LD LLHI+++HK  LK +   T     LL  +VKL FF+   +  E         
Sbjct: 468 VLHFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATETSPE--------- 518

Query: 520 XXXESKKIPVLSRERLFSILGQL--IPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLD 577
              +   +  ++RER++SIL +L  +PT     D  +W +  L  +   E+  +L   LD
Sbjct: 519 ---DKINVSEIARERIYSILSELSSVPTG----DAHSWQFHILNELTTVENELTLTNALD 571

Query: 578 EELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTT 637
           E+L   K+  L  I+ +  K+ +S +     G+E LL + +LQ+YSG+A+S + ++E+  
Sbjct: 572 EDLTTVKDTGLSVIHSLSVKNDKSSR-----GIESLLAMCLLQLYSGEADSVATIKEICD 626

Query: 638 FYKSIDTKPN--GLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILS 695
           +     +  N   LVGITEILL ++AQKK VL + +L+VWE LI+ +  DELNL+ D+LS
Sbjct: 627 YLTEEKSSKNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLS 686

Query: 696 VRENKQGFAALF 707
            RENK+GF+ LF
Sbjct: 687 ARENKEGFSYLF 698

 Score =  213 bits (541), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 166/267 (62%), Gaps = 6/267 (2%)

Query: 762  NEYIDKINKETTSALADALKLPENMIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG 821
            N+ +  I+++T  ALA ALKLPEN++                                 G
Sbjct: 741  NKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEIDDLEDESSDDESMDDEAMMALDG 800

Query: 822  QLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQ 881
            QL++IFKRRK+ALS VPTGN RK+EVR+SRESVI+FK R++DML IY KYV +L  + + 
Sbjct: 801  QLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKD 860

Query: 882  CEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVF 941
                KL  + + ++P+LKC+Q+T+DRPLA+K  KLLK  I K+K+ P      E  E   
Sbjct: 861  VMKEKLQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKI-PVSA---EDGERFV 916

Query: 942  LSLENIHNS-MLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPD-EVTYNRIIDIYSQSI 999
             SL+ IH + +LA+K GQ+Q +Y+  CS++S+F  K+L+ ++ + +  +N +IDIY+++ 
Sbjct: 917  ESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETT 976

Query: 1000 KNWTVKGKFGPNFFIDFINWLASKRSK 1026
            K W  K KF  + F DF NWL+SKR +
Sbjct: 977  KKWMDKKKFPTSVFFDFYNWLSSKRQQ 1003

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
           YEL055C (REAL)
          Length = 1023

 Score =  503 bits (1296), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 308/734 (41%), Positives = 448/734 (61%), Gaps = 65/734 (8%)

Query: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62
           +VNRDLF++LASD++EER+ AAV ++ +LS +    + +EW YVL RLIKGLAS R  AR
Sbjct: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRNSAR 63

Query: 63  LGFSMCLSEVVTLGLE-------KGRLESVEVYIGQL-------FEKLADGHVKNGKEER 108
           LGFS+CL+EV+ L +        KG LES+  ++  L         +     VK GK+ER
Sbjct: 64  LGFSLCLTEVINLAMNMPSGQRPKG-LESMNDFLDTLSFILDINVNETGKKPVK-GKDER 121

Query: 109 GLVFGKLFGLQALLNEPLFGRIFM-DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTL 167
           G++FGKLFGL++LLNEPLF  IF+ D K  + +F + FM+ L+ LAL K W++EPCL++L
Sbjct: 122 GILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYSL 181

Query: 168 YQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXX 227
           +Q I+ L     E    E I    D + LTLTNEGL+ YLLL YE  +            
Sbjct: 182 FQTIKMLLPTMNESTAAE-ILLTYDKYDLTLTNEGLSTYLLLKYESDKDLVPSTLGLKNL 240

Query: 228 XXTLRSCWKNNDPLSKGNVTILSSVLKD--IIP-----VEDNVMKQKGS-WAPRLHFVWD 279
                  WKNNDPL++GN+ +L+ VL+D  + P      +DN  KQK + W PRLHFVW+
Sbjct: 241 ------GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWN 294

Query: 280 ILIPILCRQQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSE 339
           IL+P+        G  E+               V + + F EFWQ+ VDESFFN KASSE
Sbjct: 295 ILLPLFGS-----GKLENAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSE 349

Query: 340 RKYLGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICE 399
           RKYLG LII+   + VP S +   FS+N+MRTLINQS +S R L+KI+   L +I+  CE
Sbjct: 350 RKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACE 409

Query: 400 SDP-TKVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDK 458
            DP  K++P ++++ FGP+GSINFD LTK+     +IA++ L +  L  L  L V ++ +
Sbjct: 410 EDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQE 469

Query: 459 ESSPVSKVRYLLDILLHIVQAHKLK-ADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXX 517
           +   +    ++LD LLHI++AHK +  D+   KP+LS IV ++FF     D         
Sbjct: 470 KKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDD--------- 520

Query: 518 XXXXXESKKIPVLSRERLFSILGQLIPTSKQNVDGP---TWPYVTLQIVIAEE--HRRSL 572
                ES+++  L++ERL+SILG+L    +   + P   +W ++TL++++  E  H+  L
Sbjct: 521 ----KESEQLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDL 576

Query: 573 IFKLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASIL 632
              LDE L++TK  A+ ++ +I K +      S+  GL  LL + ++Q+Y+G+ +S S++
Sbjct: 577 TNPLDEGLEKTKNEAISSLTEISKSN-----TSQSWGLSTLLSMCLIQLYAGETDSISVI 631

Query: 633 EELTTFYKSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFD 692
           EEL  F K  ++    +VGITEILLS++AQKKA+L++L+LI+W+  I  +   EL +L D
Sbjct: 632 EELCEFAKDENS---SMVGITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLD 688

Query: 693 ILSVRENKQGFAAL 706
           +L  RENKQGFA L
Sbjct: 689 VLKTRENKQGFALL 702

 Score =  208 bits (530), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 119/267 (44%), Positives = 163/267 (61%), Gaps = 13/267 (4%)

Query: 768  INKETTSALADALKLPENMIX------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG 821
            I+KE TSAL  AL LP+N++                                        
Sbjct: 754  IDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMMELDD 813

Query: 822  QLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLA----G 877
            QLSEIFKRRKEALS + TGN+RK+EV+ESRE+VI+FKHR++DML IY K+  +LA    G
Sbjct: 814  QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKG 873

Query: 878  KSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVS 937
            +        L N+   I P++KCI++T+DRPLA+K +KLLK  I K++   FK  +D+  
Sbjct: 874  ELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKD-LDKTI 932

Query: 938  EIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQ 997
            E++ L L++ H  ML  KPGQ   ++F ACSTSSLFL K+ V    ++  ++ +ID+Y+ 
Sbjct: 933  ELLDL-LKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGND-KFDDLIDLYAS 990

Query: 998  SIKNWTVKGKFGPNFFIDFINWLASKR 1024
            + K WT KGKFG N FIDFINWL+SK+
Sbjct: 991  TTKQWTQKGKFGANIFIDFINWLSSKK 1017

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  477 bits (1228), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 293/734 (39%), Positives = 443/734 (60%), Gaps = 80/734 (10%)

Query: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEI-VEQDNEQEWQYVLGRLIKGLASARQGA 61
           +V+RDLFY+LASD+ EER+ + VG+V  L ++ V  + E+EW YV+ RL+KGL S R  A
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 62  RLGFSMCLSEVVTLGL-----EKGR-LESVEVYIGQLFEKLADGHVKNGK--------EE 107
           RLGFSMCL+E + L L     E+ R L+ V  Y+  +  +     V  GK        +E
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 108 RGLVFGKLFGLQALLNEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTL 167
           RG +FG+LF  + LLNEPLF  +F      D +F + F + +++L   K WL EPC F+L
Sbjct: 122 RGTLFGRLFAYKVLLNEPLFSLLF------DQKFLIEFQERVIQLGSMKNWLLEPCFFSL 175

Query: 168 YQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETXXXXXXXXXXX 227
           YQ IEKL     +  + +A    +D HKLT+TNEGL++YLLL  +   +           
Sbjct: 176 YQAIEKLLPGLDQ-EYAQATVAQIDEHKLTMTNEGLSVYLLLAKKFTLSDFTLE------ 228

Query: 228 XXTLRSCWKNNDPLSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCR 287
                S WK NDPL KGN+++++ V+ D   V+        +WAPRLH++WDI++     
Sbjct: 229 ----NSAWKANDPLQKGNLSVMAKVMLDT-NVDGANSNTNKNWAPRLHYIWDIILREFFD 283

Query: 288 QQEIPGAAEHVPXXXXXXXXXXXXXVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLI 347
            ++    A+HV              V     F  FWQ VVDESFFN KAS ERKY G LI
Sbjct: 284 NEQHGSDAKHVYQKKKHDKSKNPQRVE----FKSFWQAVVDESFFNDKASPERKYQGYLI 339

Query: 348 IEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLP 407
            +KA++ VP+S V   F++NIMR++INQ+S+S R L+K+S   L  +VSICES+P K+ P
Sbjct: 340 FQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTP 399

Query: 408 VVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEID--------KE 459
           V+ +L F   GS+NFDILTKSKT+  ++A +     +LA+L+ L  S ++        +E
Sbjct: 400 VLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEE 459

Query: 460 SSPVSKVRYLLDILLHIVQAHK--LKADMFWTKPLLSSIVKLSFFNDKLSDFEXXXXXXX 517
            +P  +++++LD LL+++++ K  L+ D      +L S ++L+FF               
Sbjct: 460 LNP--RLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ-------------- 503

Query: 518 XXXXXESKKIPVLSRERLFSILGQLI--PTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFK 575
                +++ I  +++ERL S+L +LI  P++    DG +WPY+ L+I++ +E   +LI  
Sbjct: 504 ----KDNEYINNIAKERLSSMLAELIVLPST----DG-SWPYLALEIIVTKEKSETLIDS 554

Query: 576 LDEELQQTKEHALKAINDIRKK-SQESPQASELCGLELLLGVTILQMYSGDAESASILEE 634
           LD+ L   K  +L    DI KK S+   ++S+L G+E L+ + ++Q+YSGDAES  I+E+
Sbjct: 555 LDDSLVAVKAESL----DILKKISELKSKSSQLLGIESLMSMNLIQLYSGDAESIGIIED 610

Query: 635 LTTFY-KSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDI 693
           LTTFY ++ + +     G+TEILLS++AQ+K++LR+L+L+VWE  ID+I  +E+NLL + 
Sbjct: 611 LTTFYHETSNHETANFTGVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNF 670

Query: 694 LSVRENKQGFAALF 707
           L  RENK+GF+ LF
Sbjct: 671 LHARENKEGFSVLF 684

 Score =  195 bits (495), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/287 (39%), Positives = 164/287 (57%), Gaps = 21/287 (7%)

Query: 759  NGYNEYIDKINKETTSALADALKLPENMIX--------XXXXXXXXXXXXXXXXXXXXXX 810
            N  +E I +I+KETTSALA AL LP+N+I                               
Sbjct: 738  NADDEKISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDES 797

Query: 811  XXXXXXXXXXGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCK 870
                       QLSEIFKRRK+ALS V TGN+RKL+V+ESRE+VI+FKHR++DMLEIY K
Sbjct: 798  MDDEKMMELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIK 857

Query: 871  YVVRLA------GKSQQCEASK--LLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHIC 922
            ++ +L+      GK    E ++  L  + +++D    C+QQT+D+PL EK  KL K    
Sbjct: 858  HIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFS 917

Query: 923  KLKLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTK 982
            K++   F+    E S  +  SLE IH  +   KPGQF   Y+  CS++SL+L + L+ T 
Sbjct: 918  KIRFTLFEDI--ETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTT 975

Query: 983  PD-EVT--YNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKRSK 1026
             + E T  + +++D+Y+ + K W  +GK+G   F+DF NWLASK+ +
Sbjct: 976  VEAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQR 1022

>ZYRO0G19360g Chr7 complement(1604406..1612430) [8025 bp, 2674 aa]
            {ON} similar to uniprot|P33892 Saccharomyces cerevisiae
            YGL195W GCN1 Positive regulator of the Gcn2p kinase
            activity forms a complex with Gcn20p proposed to
            stimulate Gcn2p activation by an uncharged tRNA
          Length = 2674

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 13/91 (14%)

Query: 39   NEQEWQYVLGRLIKGLASARQGARLGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLAD 98
            +++    V+GRL+  L +     +   S CLS +V L  +     +VE YI QL +KL D
Sbjct: 1287 DDERIHIVIGRLLSTLETPSTEVQHAVSACLSPLVPLFKQ-----NVEQYINQLMDKLLD 1341

Query: 99   ----GHVKNGKE--ERGLVFGKLFGLQALLN 123
                 +V+ G      GLV G  +G+ AL N
Sbjct: 1342 VSAPTYVQKGAAWGIAGLVKG--YGISALSN 1370

>KLTH0E06424g Chr5 (586109..594130) [8022 bp, 2673 aa] {ON} similar to
            uniprot|P33892 Saccharomyces cerevisiae YGL195W GCN1
            Positive regulator of the Gcn2p kinase activity forms a
            complex with Gcn20p proposed to stimulate Gcn2p
            activation by an uncharged tRNA
          Length = 2673

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 31   LSEIVEQDNEQEWQYVLGRLIKGLAS-ARQGARLGFSMCLSEVVT-LGLEK 79
            L  +VE+  E+++ +++ RL+  L+  +R G RLG +  L+EV++ LGL K
Sbjct: 1634 LGALVERLGEEQFPHLIPRLMSTLSDESRAGDRLGSAQALAEVISGLGLSK 1684

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,474,913
Number of extensions: 3587644
Number of successful extensions: 12075
Number of sequences better than 10.0: 30
Number of HSP's gapped: 12141
Number of HSP's successfully gapped: 65
Length of query: 1027
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 907
Effective length of database: 39,721,479
Effective search space: 36027381453
Effective search space used: 36027381453
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)