Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30086.6ON61613001e-37
TDEL0G046506.6ON62622082e-23
Sklu_YGOB_Anc_6.66.6ON61612064e-23
Klac_YGOB_Anc_6.66.6ON61612012e-22
Kwal_56.223336.6ON62621873e-20
Kthe_YGOB_Anc_6.66.6ON62611865e-20
Smik_6.4796.6ON62621761e-18
TBLA0A072006.6ON65581762e-18
YPL271W (ATP15)6.6ON62621743e-18
Skud_16.66.6ON62621718e-18
Kpol_1045.826.6ON62621718e-18
NDAI0I027406.6ON66591683e-17
ACR021W6.6ON62621657e-17
ZYRO0F00418g6.6ON62511631e-16
Suva_16.346.6ON62621622e-16
KAFR0B064906.6ON66611622e-16
CAGL0A01111g6.6ON69611581e-15
TPHA0J002306.6ON62531482e-14
KNAG0E027906.6ON65631302e-11
NCAS0D022006.6ON85581278e-11
CAGL0I08877g5.166ON34445670.15
NDAI0F018706.123ON100450610.97
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3008
         (61 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...   120   1e-37
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    85   2e-23
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    84   4e-23
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    82   2e-22
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    77   3e-20
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    76   5e-20
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    72   1e-18
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    72   2e-18
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    72   3e-18
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       70   8e-18
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    70   8e-18
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    69   3e-17
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    68   7e-17
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    67   1e-16
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    67   2e-16
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    67   2e-16
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    65   1e-15
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    62   2e-14
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    55   2e-11
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    54   8e-11
CAGL0I08877g Chr9 complement(862629..863663) [1035 bp, 344 aa] {...    30   0.15 
NDAI0F01870 Chr6 (453449..456463) [3015 bp, 1004 aa] {ON} Anc_6....    28   0.97 

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score =  120 bits (300), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 61/61 (100%), Positives = 61/61 (100%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVPLK 60
          MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVPLK
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 84.7 bits (208), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 55/62 (88%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG-AASDAVPL 59
          M+AWRKAGL+YNTY++VAAR VR+ALKPEL++A VL+RS T+A+ + Y+ G AASD+VPL
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 60 KK 61
          ++
Sbjct: 61 QE 62

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 84.0 bits (206), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVPLK 60
          MSAWRKAGL+YN Y+++AA+ VR+ALK E + A VLSRS +EAK I +++G  SD +PLK
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPSDPIPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 82.0 bits (201), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 50/61 (81%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVPLK 60
          MS WRKAGL++N Y++VAA  VR+ALKPEL+  +VL+RS +EAK I +++G AS+ VPLK
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVASEPVPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 76.6 bits (187), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAAS-DAVPL 59
          MSAWRKAGL+YN YMA+AA+ VRSALK E + A VL RS TEA+ + Y++G A+ ++ PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 60 KK 61
          K+
Sbjct: 61 KE 62

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 76.3 bits (186), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 1/61 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGA-ASDAVPL 59
          MSAWRKAGL+YN YMA+AA+ VRSALK +L+ A VL RS TEA+ I Y+ G   ++A PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 60 K 60
          K
Sbjct: 61 K 61

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 72.4 bits (176), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 48/62 (77%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG-AASDAVPL 59
          MSAWRKAG+SY  Y+ VAA+A+RS+LK EL+ A+VLSRS T+A    YK+G AAS+  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 72.4 bits (176), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (77%), Gaps = 1/58 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVP 58
          MSAWRKAG++YN Y+A+AA+ VR+ALKPEL+ AAV+ RS TEA+   Y  G + DA P
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKG-SPDADP 57

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 71.6 bits (174), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG-AASDAVPL 59
          MSAWRKAG+SY  Y+ VAA+A+RS+LK EL+ A+VL+RS T+A    YK+G AAS+  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 70.5 bits (171), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (75%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG-AASDAVPL 59
          MSAWRKAG+SY  Y+ VAA+ +RS+LK EL+ A+VLSRS T+A    YK+G AAS+  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 70.5 bits (171), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVPL 59
          MSAWRKAG++YN Y+ +AA+ VR ALK ELK   VL+RS TEAK +++++GA   + VP+
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 60 KK 61
          ++
Sbjct: 61 QQ 62

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 69.3 bits (168), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (79%), Gaps = 1/59 (1%)

Query: 4  WRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGA-ASDAVPLKK 61
          WRKAG++Y+ Y+++AAR +R+ALKPEL+ A V++RS+T+A    YKDGA AS+   L+K
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 68.2 bits (165), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (88%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINY-KDGAASDAVPL 59
          MSAWRKAGL+YN+Y+AVAAR VR+ALK EL++ AVL+RS TEAKVI+Y   G+A++AVPL
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 60 KK 61
          +K
Sbjct: 61 RK 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 67.4 bits (163), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 40/51 (78%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG 51
          MSAWRKAGL+YN Y++VAA+ VRSALKPE + AAVLSR   ++K   ++ G
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKG 51

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 67.0 bits (162), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG-AASDAVPL 59
          MSAWRKAG+SY  Y+ VAA+ +RS+LK EL+ A VLSRS T+A    YK+G AAS+ V +
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 67.0 bits (162), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (73%), Gaps = 1/61 (1%)

Query: 2  SAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVPLK 60
          S WRKAGL+Y +Y+++A++ +R  LK E + AAV SRS TEA V NYK+G+  SD  PL+
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 61 K 61
          K
Sbjct: 63 K 63

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 65.5 bits (158), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (73%), Gaps = 1/61 (1%)

Query: 2  SAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVPLK 60
          +AWRKAGLSY++++A+AAR VR +LK EL+  AV+ R  T+A    Y+ G+  SD +PL+
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 61 K 61
          +
Sbjct: 69 E 69

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 61.6 bits (148), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 39/53 (73%)

Query: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA 53
          MS WRKAGL+Y+ Y+AVAA+ VR +LK +LK  +VLSRS T+ K   ++ G A
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTA 53

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 54.7 bits (130), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 1  MSA-WRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVP 58
          MSA W+KAG++Y TY+ V A+ +RSALK EL+   VLSR  T+A    Y+ G   +D  P
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 59 LKK 61
          L++
Sbjct: 61 LQE 63

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 53.5 bits (127), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (68%), Gaps = 1/58 (1%)

Query: 4  WRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVPLK 60
           RKAG++Y  Y+ VA+R +R++LK EL+   V++RSNT+A    Y+ G+  +D  PL+
Sbjct: 24 LRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQ 81

>CAGL0I08877g Chr9 complement(862629..863663) [1035 bp, 344 aa] {ON}
           similar to uniprot|P53292 Saccharomyces cerevisiae
           YGR165w
          Length = 344

 Score = 30.4 bits (67), Expect = 0.15,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 12  NTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDA 56
           NTY AV    V + +KP+++    L   NT  ++    DGA  DA
Sbjct: 74  NTYFAVPNNHVPNYIKPDIERGQALRDPNTGKRLTERYDGALVDA 118

>NDAI0F01870 Chr6 (453449..456463) [3015 bp, 1004 aa] {ON} Anc_6.123
           YBR225W
          Length = 1004

 Score = 28.1 bits (61), Expect = 0.97,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 1   MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKD 50
           +S W +AG S NT    A + V+  L+ E  +  +   +NT+    ++KD
Sbjct: 512 ISPWSEAGTSNNTSNLKAEKNVKKQLESEFNDRFIQPDANTDKSGPSFKD 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.120    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,226,214
Number of extensions: 119225
Number of successful extensions: 329
Number of sequences better than 10.0: 22
Number of HSP's gapped: 329
Number of HSP's successfully gapped: 22
Length of query: 61
Length of database: 53,481,399
Length adjustment: 34
Effective length of query: 27
Effective length of database: 49,582,755
Effective search space: 1338734385
Effective search space used: 1338734385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)