Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30076.5ON76976939930.0
ACR022W6.5ON75475823700.0
KLLA0D00748g6.5ON78973623700.0
Kwal_56.223296.5ON77670523510.0
SAKL0E00748g6.5ON77471423410.0
KLTH0C11616g6.5ON74068623300.0
ZYRO0F00396g6.5ON73268721090.0
TDEL0G046606.5ON73967220840.0
CAGL0A01133g6.5ON80166220640.0
TPHA0J002206.5ON74065720480.0
Kpol_1045.836.5ON74867020380.0
TBLA0A071906.5ON79467620350.0
NCAS0D022106.5ON77370320130.0
YPL270W (MDL2)6.5ON77361220080.0
Suva_16.356.5ON76769220070.0
Skud_16.76.5ON77361920000.0
Smik_6.4786.5ON77361219970.0
NDAI0I027306.5ON83261220000.0
KNAG0E028006.5ON74166818260.0
KAFR0B064806.5ON75161917460.0
TPHA0B046201.67ON72064614370.0
NDAI0A005601.67ON71464914350.0
KLLA0C01991g1.67ON70665114190.0
ZYRO0F17050g1.67ON71463414150.0
Kpol_2000.791.67ON70761814030.0
Ecym_10721.67ON68362813970.0
TDEL0C063501.67ON69361913950.0
SAKL0C02244g1.67ON71262413820.0
KLTH0F02024g1.67ON73465013791e-180
NCAS0B087001.67ON71562013761e-180
Skud_12.2531.67ON69269613651e-179
YLR188W (MDL1)1.67ON69570013641e-178
Suva_10.2841.67ON69367413541e-177
Smik_12.2481.67ON69669313451e-176
Kwal_33.133081.67ON70664513461e-176
AFR683C1.67ON67761913241e-173
CAGL0E00385g1.67ON60864212891e-168
TBLA0A053001.67ON70762712391e-160
TDEL0F003401.527ON12575305382e-56
SAKL0H00968g5.20ON7005485201e-55
Kwal_26.94805.20ON7195445034e-53
KLLA0A10131g5.20ON7205425017e-53
KLTH0B09482g5.20ON6945534981e-52
Kpol_1018.1851.527ON12765205044e-52
Suva_11.111.527ON12905355035e-52
NDAI0D015401.527ON12935315027e-52
Smik_13.5185.20ON6875504901e-51
Skud_13.4755.20ON6915484901e-51
YKL209C (STE6)1.527ON12905304982e-51
KNAG0G001901.527ON12755634931e-50
SAKL0A10208g1.527ON13105334912e-50
Suva_13.4915.20ON6935264822e-50
YMR301C (ATM1)5.20ON6905484812e-50
TBLA0B100701.527ON12965504841e-49
KNAG0E013205.20ON6955504723e-49
NCAS0D024305.20ON7025624733e-49
ZYRO0G02244g1.527ON12735244804e-49
Ecym_56495.20ON6965614707e-49
TPHA0L022705.20ON7115514708e-49
TBLA0C070005.20ON7255264682e-48
Skud_11.111.527ON12955174733e-48
KAFR0E002301.527ON12705574724e-48
AGL335W5.20ON6915344627e-48
NDAI0I024405.20ON7304694621e-47
AFR432W1.527ON12845024691e-47
Kpol_513.235.20ON7085504592e-47
CAGL0M13739g5.20ON7273384541e-46
KAFR0I025805.20ON7093344522e-46
ZYRO0D07106g5.20ON7095444512e-46
TDEL0G004305.20ON6963274493e-46
CAGL0K00363g1.527ON12275334484e-45
TPHA0O001601.527ON12535194475e-45
KLTH0B01100g1.527ON12985584466e-45
NCAS0C059304.6ON16575464422e-44
KNAG0E011204.6ON17175474423e-44
KLTH0H16038g4.6ON16495024423e-44
KLLA0B14256g1.527ON12715444395e-44
Kpol_311.34.6ON16575094371e-43
ZYRO0G07612g4.6ON16955554362e-43
TDEL0G018504.6ON16425244352e-43
YLL048C (YBT1)4.6ON16615474334e-43
Smik_11.141.527ON13165324315e-43
Ecym_36121.527ON13155054307e-43
Kwal_34.157704.6ON14365434307e-43
NCAS0J00160singletonON16545574282e-42
NCAS0G035101.527ON12885364272e-42
CAGL0E03982g4.6ON16595704262e-42
SAKL0H26026g4.6ON16535654245e-42
Suva_10.234.6ON16615294235e-42
KLLA0E00529g4.6ON16506424211e-41
Smik_12.114.6ON16615344183e-41
Ecym_84184.6ON16785354131e-40
Skud_12.224.6ON16615344102e-40
NDAI0J011508.303ON15175174102e-40
CAGL0C03289g4.6ON16485384067e-40
NDAI0B006405.10ON14915544059e-40
Kwal_33.155611.527ON12975154041e-39
TBLA0G007104.6ON16915584041e-39
TPHA0F001804.6ON16465134013e-39
CAGL0E03355g4.52ON15355603933e-38
TDEL0E056104.52ON15355443915e-38
KAFR0L001904.6ON16535373915e-38
Smik_8.64.6ON15855193906e-38
Suva_8.164.6ON15995653898e-38
YHL035C (VMR1)4.6ON15925233891e-37
NDAI0H001904.6ON16825233844e-37
Smik_12.484.52ON15575463835e-37
ZYRO0G22176g4.52ON15705433801e-36
Ecym_42658.303ON15055323801e-36
NCAS0E041605.10ON15065513801e-36
YDR135C (YCF1)8.303ON15155393791e-36
KNAG0J027304.52ON15375453791e-36
Skud_4.3958.303ON15165393791e-36
Skud_8.94.6ON15875183782e-36
KAFR0B056308.303ON15155213746e-36
Suva_2.2978.303ON15165393702e-35
TPHA0K023104.6ON16495093702e-35
Skud_12.524.52ON15615563674e-35
CAGL0G00242g5.10ON14775523666e-35
Smik_11.367na 1ON15955193666e-35
KAFR0I013004.52ON15365563631e-34
NCAS0B034708.303ON15124893622e-34
YGR281W (YOR1)5.10ON14775553603e-34
ACL072C4.6ON16274983595e-34
Smik_4.3808.303ON15165403585e-34
Skud_7.6145.10ON14775513585e-34
Kpol_1033.288.303ON15315443586e-34
TPHA0C009608.303ON15235483551e-33
Suva_7.5775.10ON14785473542e-33
Kpol_1060.75.10ON14605603542e-33
Smik_16.275.10ON14775493523e-33
Skud_18.2singletonON15805703514e-33
KAFR0C065105.10ON14575223497e-33
TPHA0A056205.10ON14775703488e-33
KLTH0G12716g8.303ON15004893489e-33
SAKL0H16016g8.303ON14995383471e-32
KLLA0D04059g4.52ON15685423471e-32
Suva_10.60singletonON9905483452e-32
Suva_10.594.52ON15615483443e-32
KNAG0I009908.303ON15354973434e-32
Kwal_56.238448.303ON14944893416e-32
CAGL0L06402g8.303ON15355403408e-32
KNAG0K001705.10ON14425393409e-32
Kwal_56.22747na 2ON15385583354e-31
TPHA0F004104.52ON15705603337e-31
SAKL0H00704g5.10ON14395643301e-30
KLTH0C09240gna 2ON15465293301e-30
TDEL0G003305.10ON14655563282e-30
TDEL0F043008.303ON15145373274e-30
KLLA0C14234g5.10ON14545473255e-30
YLL015W (BPT1)4.52ON15595463212e-29
KLTH0B00396gsingletonON15075333193e-29
KLLA0F20075g8.303ON15165433184e-29
ZYRO0D06160g8.303ON15252603175e-29
AGR047W8.303ON14925003141e-28
Kwal_26.95325.10ON14715393131e-28
YKR104WsingletonON3062362952e-28
SAKL0H23958g4.52ON15585393051e-27
AGL346W5.10ON14005153052e-27
KLTH0B09724g5.10ON14865423052e-27
Zrou_YGOB_Anc_5.105.10ON9925333013e-27
TBLA0A06840singletonON10582622871e-25
Kpol_YGOB_1041.454.52ON15685872862e-25
Kpol_1041.45singletonOFF15965872863e-25
TBLA0C06400singletonON13775172755e-24
TBLA0C071005.10ON14855242755e-24
TBLA0A038008.303ON15464912675e-23
Ecym_56605.10ON15362412113e-16
YKR103W (NFT1)na 1ON12182652076e-16
Kwal_26.87308.661ON8312001824e-13
KAFR0A037908.661ON8762051763e-12
Kpol_175.1singletonON13771901738e-12
ACR128C8.661ON8272011728e-12
KLTH0D10890g8.661ON8301991711e-11
YER036C (ARB1)3.534ON6102441691e-11
SAKL0H21010gsingletonON14472391702e-11
KAFR0C00820na 3ON15173081692e-11
TBLA0I033303.534ON6102351663e-11
Kwal_47.191163.534ON6072411663e-11
Kpol_1049.234.6ON110941503e-11
ZYRO0E08800g3.534ON6102391655e-11
TBLA0D01820singletonON15512931665e-11
Smik_5.1593.534ON6102441655e-11
Skud_5.1453.534ON6102441645e-11
ZYRO0B05588g3.133ON12702121649e-11
KLLA0F11484g8.661ON8452331639e-11
TPHA0D011708.661ON9152091621e-10
Ecym_8014na 4ON15172981631e-10
TBLA0D017805.500ON15952601621e-10
SAKL0H06908g8.661ON8361851602e-10
TDEL0D060203.534ON6101741602e-10
KNAG0A029808.661ON8712001602e-10
NCAS0B015308.661ON8682011602e-10
CAGL0C02343g3.534ON7202871593e-10
Suva_5.1343.534ON6102431583e-10
Skud_14.404na 5ON14243251593e-10
ZYRO0F07018g8.661ON8611981584e-10
KAFR0C008303.220ON14843171584e-10
Ecym_11943.534ON6092361574e-10
Skud_4.6805.500ON14452861584e-10
Skud_4.681na 6ON14452861584e-10
TPHA0A058903.534ON6102311574e-10
YPL147W (PXA1)8.661ON8701961575e-10
SAKL0F01606g3.534ON6082201565e-10
KNAG0B038705.500ON15132401575e-10
NDAI0E012408.661ON8972221566e-10
Smik_6.3448.661ON8701961566e-10
KLTH0G01452g3.534ON6072381557e-10
KLLA0A01452g3.534ON6071821548e-10
Suva_16.1638.661ON8701961559e-10
AFR232C3.534ON6072391541e-09
Ecym_24108.661ON8282151541e-09
SAKL0D10208g1.366ON7522361541e-09
NCAS0E01650singletonON14882691551e-09
TDEL0B057601.427ON10362541541e-09
NCAS0E004803.534ON6102331531e-09
YNR070W (PDR18)na 5ON13333231531e-09
AGL142CsingletonON14972321532e-09
Kpol_1053.483.133ON12882411532e-09
KAFR0C052205.500ON14992551522e-09
KNAG0K009503.133ON12843161522e-09
Kpol_1012.108.661ON8551531513e-09
CAGL0K10472g1.366ON7522111503e-09
ZYRO0G01144g1.366ON7522341503e-09
Skud_16.1358.661ON8702041503e-09
TDEL0A060708.661ON8721861494e-09
NCAS0E01640na 3ON15022391494e-09
KAFR0C05210na 6ON14932731495e-09
NDAI0I030203.534ON6092431485e-09
KNAG0K013503.220ON15012351495e-09
NCAS0A120605.500ON15432161496e-09
KAFR0C045401.366ON7522381476e-09
NCAS0F00410singletonON15312371486e-09
Smik_4.6785.500ON15332851486e-09
YOR328W (PDR10)na 7ON15642411487e-09
NCAS0E016303.220ON15652811487e-09
Kwal_23.51613.220ON14892971478e-09
YDR406W (PDR15)5.500ON15292851479e-09
ZYRO0B14762gsingletonON15152331479e-09
Ecym_36043.220ON14742271461e-08
ZYRO0D11880g5.500ON14982441461e-08
TDEL0D040403.220ON15003051461e-08
KNAG0I005301.427ON10472731451e-08
Kpol_1050.263.534ON6102211441e-08
KAFR0C012003.133ON12732301451e-08
KLTH0G19448gsingletonON14862201451e-08
KLTH0A01914g3.220ON14992861452e-08
Smik_15.508na 7ON15662411452e-08
NCAS0B053003.133ON12732281442e-08
Smik_15.3335.500ON15102391452e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3007
         (769 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...  1542   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   917   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   917   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   910   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   906   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   902   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   816   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   807   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   799   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   793   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   789   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   788   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      780   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   778   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   777   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   775   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   773   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   775   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   707   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   677   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   558   0.0  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   557   0.0  
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   551   0.0  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   549   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   545   0.0  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   542   0.0  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   541   0.0  
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   536   0.0  
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   535   e-180
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   534   e-180
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   530   e-179
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   530   e-178
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   526   e-177
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   522   e-176
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   523   e-176
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   514   e-173
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   501   e-168
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   481   e-160
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   211   2e-56
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   204   1e-55
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   198   4e-53
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   197   7e-53
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   196   1e-52
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   198   4e-52
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   198   5e-52
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   197   7e-52
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   193   1e-51
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   193   1e-51
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   196   2e-51
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   194   1e-50
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   193   2e-50
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   190   2e-50
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   189   2e-50
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   191   1e-49
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   186   3e-49
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     186   3e-49
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   189   4e-49
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   185   7e-49
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   185   8e-49
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   184   2e-48
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   186   3e-48
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   186   4e-48
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   182   7e-48
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   182   1e-47
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   185   1e-47
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   181   2e-47
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   179   1e-46
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   178   2e-46
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   178   2e-46
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   177   3e-46
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   177   4e-45
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   176   5e-45
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   176   6e-45
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   174   2e-44
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   174   3e-44
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   174   3e-44
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   173   5e-44
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   172   1e-43
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   172   2e-43
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   172   2e-43
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   171   4e-43
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   170   5e-43
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   170   7e-43
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   170   7e-43
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   169   2e-42
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   169   2e-42
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   168   2e-42
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   167   5e-42
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   167   5e-42
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   166   1e-41
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   165   3e-41
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   163   1e-40
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   162   2e-40
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   162   2e-40
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   160   7e-40
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    160   9e-40
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   160   1e-39
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   160   1e-39
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   159   3e-39
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   155   3e-38
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   155   5e-38
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   155   5e-38
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   154   6e-38
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   154   8e-38
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   154   1e-37
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   152   4e-37
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   152   5e-37
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   150   1e-36
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   150   1e-36
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    150   1e-36
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   150   1e-36
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   150   1e-36
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   150   1e-36
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   150   2e-36
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   148   6e-36
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   147   2e-35
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   147   2e-35
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   145   4e-35
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   145   6e-35
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   145   6e-35
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   144   1e-34
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   144   2e-34
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   143   3e-34
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   142   5e-34
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   142   5e-34
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   142   5e-34
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   142   6e-34
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   141   1e-33
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   140   2e-33
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   140   2e-33
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   140   3e-33
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   139   4e-33
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   139   7e-33
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   138   8e-33
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   138   9e-33
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   138   1e-32
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   138   1e-32
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   137   2e-32
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   137   3e-32
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   136   4e-32
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   135   6e-32
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   135   8e-32
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   135   9e-32
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   133   4e-31
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   132   7e-31
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   131   1e-30
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   131   1e-30
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   130   2e-30
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   130   4e-30
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   129   5e-30
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   128   2e-29
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   127   3e-29
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   127   4e-29
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   126   5e-29
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   125   1e-28
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   125   1e-28
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   118   2e-28
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   122   1e-27
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   122   2e-27
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   122   2e-27
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   120   3e-27
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   115   1e-25
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   114   2e-25
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   114   3e-25
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   110   5e-24
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           110   5e-24
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   107   5e-23
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    86   3e-16
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    84   6e-16
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    75   4e-13
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    72   3e-12
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    71   8e-12
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    71   8e-12
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    70   1e-11
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    70   1e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    70   2e-11
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              70   2e-11
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    69   3e-11
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    69   3e-11
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    62   3e-11
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    68   5e-11
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              69   5e-11
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    68   5e-11
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    68   5e-11
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    68   9e-11
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    67   9e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    67   1e-10
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    67   1e-10
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    67   1e-10
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    66   2e-10
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    66   2e-10
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    66   2e-10
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    66   2e-10
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    66   3e-10
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    65   3e-10
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    66   3e-10
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    65   4e-10
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    65   4e-10
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    65   4e-10
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    65   4e-10
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    65   4e-10
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    65   4e-10
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    65   5e-10
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    65   5e-10
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    65   5e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     65   6e-10
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    65   6e-10
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    64   7e-10
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    64   8e-10
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    64   9e-10
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    64   1e-09
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    64   1e-09
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    64   1e-09
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    64   1e-09
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    64   1e-09
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 64   1e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    64   1e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    64   2e-09
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    64   2e-09
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    63   2e-09
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    63   2e-09
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    63   3e-09
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    62   3e-09
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    62   3e-09
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    62   3e-09
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    62   4e-09
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    62   4e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            62   5e-09
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    62   5e-09
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    62   5e-09
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    62   6e-09
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    61   6e-09
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                62   6e-09
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    62   6e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    62   7e-09
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    62   7e-09
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    61   8e-09
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    61   9e-09
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    61   9e-09
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    61   1e-08
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    61   1e-08
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    61   1e-08
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    60   1e-08
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    60   1e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    60   1e-08
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    60   1e-08
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    60   2e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    60   2e-08
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    60   2e-08
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    60   2e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    60   2e-08
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    60   2e-08
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    60   2e-08
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    60   2e-08
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    60   3e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    60   3e-08
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    60   3e-08
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    59   3e-08
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    59   3e-08
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    59   3e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    59   3e-08
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    59   3e-08
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    59   3e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    59   3e-08
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    59   3e-08
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    59   3e-08
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    59   3e-08
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    59   4e-08
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    59   4e-08
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    59   4e-08
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    59   5e-08
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    59   5e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    59   5e-08
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    59   5e-08
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    59   6e-08
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    58   6e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    59   6e-08
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    59   7e-08
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    58   7e-08
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    58   7e-08
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    58   7e-08
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             58   8e-08
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    57   9e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    58   9e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            58   9e-08
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    58   1e-07
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    58   1e-07
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    58   1e-07
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    58   1e-07
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    57   1e-07
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    57   1e-07
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    57   1e-07
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    57   1e-07
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    57   1e-07
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    57   2e-07
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    57   2e-07
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    57   2e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    57   2e-07
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    57   2e-07
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    57   2e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    57   2e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    57   2e-07
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    57   2e-07
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    57   2e-07
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    57   2e-07
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    56   2e-07
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    57   2e-07
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    56   3e-07
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    56   3e-07
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    56   3e-07
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       56   3e-07
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    56   3e-07
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    56   4e-07
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    56   4e-07
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    55   4e-07
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    56   4e-07
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    56   4e-07
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    55   5e-07
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    55   5e-07
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    55   5e-07
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    55   5e-07
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    55   5e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    55   6e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    55   6e-07
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    55   8e-07
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    55   9e-07
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    55   9e-07
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    54   1e-06
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    54   1e-06
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    54   1e-06
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    54   1e-06
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    54   1e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    54   1e-06
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    54   1e-06
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    53   1e-06
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    54   1e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    54   2e-06
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    54   2e-06
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    53   2e-06
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    53   2e-06
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    53   2e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    53   3e-06
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    53   3e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    53   3e-06
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    53   3e-06
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    53   3e-06
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    53   3e-06
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    53   3e-06
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    52   4e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    53   4e-06
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    52   4e-06
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    52   4e-06
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    52   4e-06
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    53   4e-06
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    52   4e-06
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    52   4e-06
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    52   4e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    52   4e-06
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    52   4e-06
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    52   5e-06
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    51   5e-06
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    52   5e-06
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    52   5e-06
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    52   5e-06
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    52   5e-06
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    50   6e-06
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    52   6e-06
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    52   6e-06
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    51   6e-06
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    52   7e-06
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    52   7e-06
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    50   8e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    52   9e-06
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    51   9e-06
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    51   9e-06
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    51   1e-05
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    51   1e-05
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    51   1e-05
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    51   1e-05
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    50   1e-05
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    50   2e-05
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    50   2e-05
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    50   3e-05
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    49   3e-05
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    50   3e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    49   3e-05
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    49   3e-05
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    48   3e-05
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    49   4e-05
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    49   4e-05
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    49   4e-05
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    49   4e-05
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    49   4e-05
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    49   5e-05
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    49   5e-05
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    49   6e-05
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    49   6e-05
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    48   8e-05
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    48   1e-04
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    48   1e-04
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    48   1e-04
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    48   1e-04
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    48   1e-04
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    48   1e-04
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    47   1e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    47   2e-04
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    46   2e-04
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    47   2e-04
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    47   2e-04
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    47   2e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    47   2e-04
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    46   3e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    46   3e-04
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    46   3e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    46   3e-04
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    46   4e-04
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    46   4e-04
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     46   4e-04
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    46   4e-04
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    46   4e-04
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              46   4e-04
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     46   4e-04
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    46   5e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    46   5e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    46   5e-04
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    46   5e-04
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    45   5e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    45   5e-04
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    45   5e-04
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    45   6e-04
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    45   6e-04
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    45   6e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    45   6e-04
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     45   9e-04
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    45   0.001
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    45   0.001
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    45   0.001
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    44   0.001
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    44   0.001
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    44   0.001
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    45   0.001
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    45   0.001
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    45   0.001
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    45   0.001
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    44   0.001
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    44   0.001
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    44   0.001
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    44   0.001
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    44   0.001
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    43   0.002
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    43   0.002
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    44   0.002
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    44   0.002
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              44   0.002
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    44   0.002
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    43   0.002
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    44   0.002
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    43   0.003
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    43   0.003
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    43   0.003
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    43   0.003
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    43   0.003
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    43   0.003
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    42   0.003
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    43   0.004
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    43   0.004
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.004
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    43   0.004
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    43   0.004
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    43   0.004
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    42   0.005
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.006
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    42   0.009
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    41   0.010
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    41   0.010
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    41   0.011
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    41   0.011
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    41   0.012
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    41   0.012
NDAI0A08370 Chr1 complement(1924865..1929079) [4215 bp, 1404 aa]...    41   0.012
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    41   0.013
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    40   0.014
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    41   0.015
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    41   0.015
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    41   0.016
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    40   0.017
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    40   0.020
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    40   0.020
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    40   0.025
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    40   0.025
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    40   0.027
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    40   0.028
Kpol_364.12 s364 (26116..27537) [1422 bp, 473 aa] {ON} (26116..2...    39   0.032
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    39   0.042
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    38   0.053
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    38   0.065
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    39   0.070
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    38   0.11 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    38   0.11 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    38   0.11 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    38   0.12 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    37   0.14 
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    37   0.19 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.20 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    37   0.23 
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          36   0.24 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    37   0.26 
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             37   0.26 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    37   0.30 
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    37   0.32 
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    36   0.32 
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    36   0.36 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    36   0.52 
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    35   0.65 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    34   1.4  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    34   1.4  
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    34   1.4  
KAFR0E00340 Chr5 complement(77112..80087) [2976 bp, 991 aa] {ON}...    34   2.1  
TPHA0N00810 Chr14 complement(179351..180937) [1587 bp, 528 aa] {...    33   3.1  
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    33   3.2  
SAKL0F04312g Chr6 complement(342711..346727) [4017 bp, 1338 aa] ...    33   3.4  
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    32   3.6  
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    32   5.1  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    32   6.3  
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    32   7.5  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    32   7.8  

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score = 1542 bits (3993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 757/769 (98%), Positives = 757/769 (98%)

Query: 1   MLRGVLVLPSRSCSRLFMVVPRRLNSYLAPAAVSIQAPRRYNVSLLAVIERREVVIYRPK 60
           MLRGVLVLPSRSCSRLFMVVPRRLNSYLAPAAVSIQAPRRYNVSLLAVIERREVVIYRPK
Sbjct: 1   MLRGVLVLPSRSCSRLFMVVPRRLNSYLAPAAVSIQAPRRYNVSLLAVIERREVVIYRPK 60

Query: 61  RGYSSLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGL 120
           RGYSSLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGL
Sbjct: 61  RGYSSLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGL 120

Query: 121 LSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPP 180
           LSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPP
Sbjct: 121 LSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPP 180

Query: 181 IVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFD 240
           IVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFD
Sbjct: 181 IVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFD 240

Query: 241 RNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPP 300
           RNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPP
Sbjct: 241 RNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPP 300

Query: 301 LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQL 360
           LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQL
Sbjct: 301 LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQL 360

Query: 361 FYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSS 420
           FYVGKRE            ILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSS
Sbjct: 361 FYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSS 420

Query: 421 VFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPS 480
           VFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPS
Sbjct: 421 VFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPS 480

Query: 481 NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSL 540
           NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSL
Sbjct: 481 NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSL 540

Query: 541 RRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIG 600
           RRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIG
Sbjct: 541 RRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIG 600

Query: 601 PRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTII 660
           PRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTII
Sbjct: 601 PRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTII 660

Query: 661 SIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTS 720
           SIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTS
Sbjct: 661 SIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTS 720

Query: 721 DIPPDSPKNDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNSSTLRP 769
           DIPPDSPKNDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNSSTLRP
Sbjct: 721 DIPPDSPKNDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNSSTLRP 769

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/758 (62%), Positives = 567/758 (74%), Gaps = 49/758 (6%)

Query: 28  LAPAAVSIQAP-RRYNVSL-LAVIERRE-------------VVIYRPKRGYSSL------ 66
           L P AV  + P  R+NV++ L V+ R               V + R  R YS+       
Sbjct: 11  LGPVAVLQRLPGPRHNVAVRLQVMSRARCGWQCVRATSRLTVPVCRQSRAYSAARVGGEG 70

Query: 67  --SKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVS 124
             S   K+++   +   +    ++ Q     GW EV RL  L K DWKLL  A+GLL++S
Sbjct: 71  TPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTIS 130

Query: 125 CTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGT 184
           C+IGMAVPKVIGLVLDATK+               V + +++    P++ LD +P I+G 
Sbjct: 131 CSIGMAVPKVIGLVLDATKD--------------AVAQAEKNETGAPMSLLD-MPSIIGN 175

Query: 185 LSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            ++   +  FAGAL+VG+ ANFGR+ LLK++GERLV+RLR+QVIK+T+HHD EFFDRNKV
Sbjct: 176 FTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKV 235

Query: 245 GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
           GDLISR GSDAY+VSRSMT N+SDG KA +CGGVG+GMMFHISSTLTS M++FAPPLL+ 
Sbjct: 236 GDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIA 295

Query: 305 AFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364
           A IYGK+I AISR+LQQS+GNLTRV+EEQ NGI+TIKSFVAE KE+RRYN A+R+LF V 
Sbjct: 296 ATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVA 355

Query: 365 KREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGL 424
           KRE            +LGD+SF++VL YG++LVLQG LS+G LTAFMLYTEYTGSSVFGL
Sbjct: 356 KREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGL 415

Query: 425 STFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIF 484
           S FYSELMKGAGAASRLFEL D+K SV S +     P  G+IEF+DVSFSYPTRP++QIF
Sbjct: 416 SNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIF 475

Query: 485 KHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHL 544
           K +  TI PGSNVCIVGPSG+GKSTI SLLLRFYD N G+ILID  DISK + KSLR+HL
Sbjct: 476 KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHL 535

Query: 545 GVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGA 604
           GVVQQEP LMSGTIRDNITYGLSYTP+MDEIR V+K+CFCH FITKFPDGYDTVIGPRGA
Sbjct: 536 GVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGA 595

Query: 605 SLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAH 664
            LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG LMRSKE+TI+SIAH
Sbjct: 596 LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655

Query: 665 RLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPP 724
           RLSTIRRSENI+V+GNDGSV+E GKF  LYR+E+SELFKLLNE        SE       
Sbjct: 656 RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH------ASEPAKPEAS 709

Query: 725 DSPKNDDASGLEHL-VAEDVAS----INDKVVKNVLND 757
            +P  ++AS  +   +  D+      +N++V+K+VL D
Sbjct: 710 PAPAQEEASAPQAADIPRDIEGGNLRLNEEVIKHVLED 747

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/736 (62%), Positives = 564/736 (76%), Gaps = 34/736 (4%)

Query: 59  PKRGYSSLSKTKKDND------GNGRGLLKDDN--DTQVQKETSV---GWREVLRLCSLA 107
           P  G  S S T ++ +      GNG+    +D   D +  K +S    G  +V RL  LA
Sbjct: 63  PSAGIRSFSITLRNRNEASDVGGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLA 122

Query: 108 KHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESL 167
           +HDWK+L +A+ LL+VSCTIGMAVPKVIGLVLDATKN L  S            ED +SL
Sbjct: 123 RHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNGNGGL---EDSKSL 179

Query: 168 IAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQV 227
                 +LD LPPIVG + +  F  +F GAL++G  ANFGRVVLLKI+GERLV+RLRS V
Sbjct: 180 ------TLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARLRSNV 233

Query: 228 IKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHIS 287
           IK+TMHHD+EF+DRNKVGDL+SR G+DAY+VSRSMTQN+SDGFKA+ICGGVG+GMMFHIS
Sbjct: 234 IKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHIS 293

Query: 288 STLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEK 347
           STL SV+ LFAPPLLVGA IYG KI AISR+LQQ+SGNLT+VAEEQL+GI+T++SFVAE 
Sbjct: 294 STLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG 353

Query: 348 KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDL 407
           KE+ RYN+A+RQ+F VGK+E            +LGD SF++VL YG++LVLQG L+IGDL
Sbjct: 354 KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDL 413

Query: 408 TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIE 467
           TAFMLYTEYTGS+VFGLSTFYSELMKGAGAA+RLFEL+D+K +++S    A  P  GK+E
Sbjct: 414 TAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVE 473

Query: 468 FRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI 527
           F+ VSFSYPTR +NQIFK ++FTIEPGSNVCIVGPSG+GKSTI SLLLR+Y+P  G IL+
Sbjct: 474 FQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV 533

Query: 528 DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGF 587
           D  DI+K ++KSLRR LGVVQQEP LMSGTIR+NITYG+S  P+M+EIR V+K+CFCH F
Sbjct: 534 DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF 593

Query: 588 ITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYT 647
           I+KFP+GY+T+IGPRGA LSGGQ+QRIAIARAL+ KPKILILDEATSALDVESEGAINYT
Sbjct: 594 ISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYT 653

Query: 648 LGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
           LG LM+SKELTIISIAHRLSTIRRSEN+IV+G DGSVVE+GKF  LY N +S L KLL E
Sbjct: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTE 713

Query: 708 KDHDLV--------------SKSENTSDIPPDSPKNDDASGLEHLVAEDVASINDKVVKN 753
                               S+ +   +   DS ++ ++   E+   ++   + ++V+  
Sbjct: 714 PSEQQHSQHQQYAPPAITQESEPQTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQ 773

Query: 754 VLNDITHDKNSSTLRP 769
           VL DI+HD+ +STLRP
Sbjct: 774 VLEDISHDQKTSTLRP 789

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/705 (63%), Positives = 548/705 (77%), Gaps = 41/705 (5%)

Query: 65  SLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVS 124
           S +KT  D +    G ++D+      +  ++G++EV+RL  LA HDWKLL  AIGLL++S
Sbjct: 113 SQAKTPADKESQKSGTMEDE------ESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAIS 166

Query: 125 CTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGT 184
             IGM++PKVIG+VLDA KNT  S+                    GP+  LD LPPIV  
Sbjct: 167 SVIGMSIPKVIGMVLDAIKNTYSSA-------------------TGPVG-LDDLPPIVND 206

Query: 185 LSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
           LS+ +F+GIFAGALV+G  ANFGR+VLL+++GE+LV+RLRS VI++ +H D EFFDRNKV
Sbjct: 207 LSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKV 266

Query: 245 GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
           GDLISR  SDAYVVSRSMTQNVSDGFKAIICGGVG+GMM +IS +LTS +L+FAPPLL+G
Sbjct: 267 GDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPPLLIG 326

Query: 305 AFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364
           A IYGK+I  ISR LQ+S+GNLTRV+EEQL+G++TI+SFVAE KE++RYN AIR++F  G
Sbjct: 327 ALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYG 386

Query: 365 KREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGL 424
           K+E            +LGD+SF+IVL YG++LVLQG L++GDLTAFMLYTEYTGS+VFGL
Sbjct: 387 KKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGL 446

Query: 425 STFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIF 484
           S FYSELMKGAGAASRLFE+ DH  S++        P  GKI F+DVSFSYPTRP NQIF
Sbjct: 447 SNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIF 506

Query: 485 KHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHL 544
             ++FTIEPGSNVCIVGPSG+GKSTITSLLLR+Y+P+ G I ID+ DIS+ + KSLRRHL
Sbjct: 507 NKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHL 566

Query: 545 GVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGA 604
           GVVQQEP LMSG+I+ N+TYGL    +MDEIR V+K+CFCHGF+TKFP+GYDT+IGPRGA
Sbjct: 567 GVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGA 626

Query: 605 SLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAH 664
           SLSGGQ+QRIAIARAL+KKPKILILDEATSALDVESEGAINYTLG LM+SKELTIISIAH
Sbjct: 627 SLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAH 686

Query: 665 RLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPP 724
           RLSTIRRSEN+IV+GNDGSVVEVGKF  LY +++SEL+KLLN+K  D     + T  +  
Sbjct: 687 RLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRD-----KPTPRVQS 741

Query: 725 DSPKNDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNSSTLRP 769
           D  K+ +    EH        I+++V + V ND   D+ SS L P
Sbjct: 742 DPEKDREQ---EH-------QIDNQVREQVANDFNLDQKSSKLTP 776

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/714 (62%), Positives = 552/714 (77%), Gaps = 24/714 (3%)

Query: 57  YRPKRGYSSLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAV 116
           Y  KR YS+  +       +     +          +  G++E+ RL  LA+HDWKLL V
Sbjct: 84  YNFKRSYSTTEEKSTATTTSTPTPEQKKEQESTSGNSGAGYKEIFRLFRLARHDWKLLLV 143

Query: 117 AIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLD 176
           AI LL++SC+IGMAVPKVIG+VLD  KN + S  ++  +DL                   
Sbjct: 144 AISLLTISCSIGMAVPKVIGMVLDVAKNAITS--DEKPKDLRD----------------- 184

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDI 236
            LPP+V  L +  F+ +FAGALV+   ANFGRVVLL+I+GE+LV+RLRS VIK+T+H D 
Sbjct: 185 -LPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243

Query: 237 EFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLL 296
           EFFDRNKVGDLISR  SDAYVVSRSMTQN+SDGFKAIICGGVG+GMMFHISSTL + + L
Sbjct: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTLATALFL 303

Query: 297 FAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDA 356
           FAPPLLVGA IYG+KI +ISR LQQS+GNLT+VAEEQL+G++T++SFVAE+KEI+RYN A
Sbjct: 304 FAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363

Query: 357 IRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEY 416
           IR++F VGKRE            +LGD SF+IVL YG++LVLQG+LSIGDLTAFMLYTEY
Sbjct: 364 IRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423

Query: 417 TGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYP 476
           +GS+VFGLS FYSELMKGAGAASRLFEL DH+ S+ +       P +G+I+F +VSFSYP
Sbjct: 424 SGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYP 483

Query: 477 TRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFT 536
           TR +NQIF +++FTI+ GSNVC+VGPSG+GKSTI SLLL++Y+P  G I ID  DISK +
Sbjct: 484 TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543

Query: 537 TKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYD 596
            KSLRRHLGVVQQEP LMSG+IRDNITYG+ YTPT+DEIR VSK+CFCH FITKF DGY+
Sbjct: 544 AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYE 603

Query: 597 TVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKE 656
           TVIGP+GA LSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAINYTLG LM+S++
Sbjct: 604 TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRD 663

Query: 657 LTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSK- 715
           +TIISIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +LY ++ES+L+KLLNEK  D  SK 
Sbjct: 664 ITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKM 723

Query: 716 SENTSDIPPDSPKNDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNSSTLRP 769
           +  T +    SPK +  +  E    E+   I ++V+  VL+D+ +D+ S++LRP
Sbjct: 724 NAETVEKNDPSPKTEKLNDEEK---EEQRRIEEQVLNQVLDDMNYDQKSTSLRP 774

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/686 (64%), Positives = 539/686 (78%), Gaps = 40/686 (5%)

Query: 85  NDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKN 144
           N+   ++++   +RE+LRL  LA+HDWKLL+VAIGLL++S T+GM +PKVIG+VLDA KN
Sbjct: 94  NNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKN 153

Query: 145 TLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATA 204
                                   +GP+ +L+ LPPI+  L +  F+ IFAG LV G  A
Sbjct: 154 A-------------------SGGFSGPM-TLEDLPPIIYGLGMFDFLAIFAGILVFGTIA 193

Query: 205 NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQ 264
           NFGR+VLL+++GE+LV+RLRS VIK+ +H D EFFDRNKVGDLISR  SDAYVVSRSMTQ
Sbjct: 194 NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ 253

Query: 265 NVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSG 324
           NVSDGFKAIICGGVG+GMM +IS++LTS + LFAPPLLVGA IYGKKI  ISR+LQ+S+G
Sbjct: 254 NVSDGFKAIICGGVGIGMMINISASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTG 313

Query: 325 NLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDM 384
           NLT+V+EEQL+G++TI++FVAE KE+ RYN+AIR++F  GK+E            ILGD+
Sbjct: 314 NLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDL 373

Query: 385 SFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFEL 444
           SF+IVL YG++LVLQG LS+GDLTAFMLYTEYTGS+VFGLS FYSELMKGAGAASRLFE+
Sbjct: 374 SFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM 433

Query: 445 MDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSG 504
            DH + ++ +      P+ G+I+F DVSFSYPTRP NQIF  ++FTIEPGSNVC+VGPSG
Sbjct: 434 TDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSG 493

Query: 505 KGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITY 564
           +GKSTI SLLLR+YDPN G I+ID  +ISK + KSLRRHLGVVQQEP LMSG+IR N+TY
Sbjct: 494 RGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTY 553

Query: 565 GLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624
           G++   TMDEIR V+K+CFCHGFITKFP+GY+TVIGPRGASLSGGQ+QRIAIARALIKKP
Sbjct: 554 GMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKP 613

Query: 625 KILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSV 684
           KILILDEATSALDVESEGAINYTLG LMRS+ELTIISIAHRLSTIRRSEN+IV+GNDGSV
Sbjct: 614 KILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSV 673

Query: 685 VEVGKFDKLYRNEESELFKLLNEKD-HDLVSKSENTSDIPPDSPKNDDASGLEHLVAEDV 743
           VE+GKF +LY N++SELFKLLN+K    L S+S N+ +   +                  
Sbjct: 674 VEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKEN------------------ 715

Query: 744 ASINDKVVKNVLNDITHDKNSSTLRP 769
             ++D+V++ V ND   D+ SS L P
Sbjct: 716 -EVDDQVLEQVANDFNLDQKSSKLTP 740

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/687 (58%), Positives = 507/687 (73%), Gaps = 30/687 (4%)

Query: 89  VQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKS 148
           +QK+ S  +++ +RL SLAK DW+LL  AI LL++SC IGM++PKVIGLVLD  +  ++ 
Sbjct: 70  IQKKES-SYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEG 128

Query: 149 SYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGR 208
                 +DL+ VN             +D L PI   L+I QF+G+FAG L+VG  ANF R
Sbjct: 129 ------KDLQNVN-------------MDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFAR 169

Query: 209 VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSD 268
           +V+L+I+ ER+V+RLRS V+ +T+H D EF+D +KVGDLISR GSDAYVVSRSMTQ VSD
Sbjct: 170 IVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSD 229

Query: 269 GFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTR 328
           GFKA+ICGGVG+GMM  IS  L+ V+L FAPP+L  A ++GKKI   S+ LQ+++G LTR
Sbjct: 230 GFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTR 289

Query: 329 VAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           VAEEQL+G++T++SFVAE++E+ RYN AIR ++ VG++             +LGDMSF++
Sbjct: 290 VAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIV 349

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           VLLYG+ LVLQG+L+IGDLTAFMLYTEYTGSSVFGL+TFYSELM+G GAASRLF+L DH 
Sbjct: 350 VLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHI 409

Query: 449 NSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKS 508
           +S+         P +G IEF++VSFSYPTRP NQIFK ++  + PGSNVCIVGPSG+GKS
Sbjct: 410 SSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKS 469

Query: 509 TITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSY 568
           TI  LLLR+Y+P  G IL+D  DISK   K+LRRH+G+VQQEP LMSGTIRDNITYGL+ 
Sbjct: 470 TIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAE 529

Query: 569 TPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI 628
             T +EIR V+KQCFCH FITKFPDGYDT+IG +GA LSGGQRQRIAIARALIKKP IL+
Sbjct: 530 PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV 589

Query: 629 LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           LDEATSALDVESEGAINYT G LM+S  +TI+SIAHRLSTI+RSEN+IV+G DGSV+E G
Sbjct: 590 LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649

Query: 689 KFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEHLVAE------D 742
           KF +L+ N  SEL KLL EK     S+S+    +PP  P       +E +  +      +
Sbjct: 650 KFKELFANPNSELCKLLTEKS----SRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPE 705

Query: 743 VASINDKVVKNVLNDITHDKNSSTLRP 769
                D  VK +  D++ +     + P
Sbjct: 706 AGQSPDATVKEIFKDVSSEGKPIKITP 732

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/672 (60%), Positives = 504/672 (75%), Gaps = 23/672 (3%)

Query: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS 149
           + E   G ++V+RL  LAK DWKLL +AI LL+VSC IGM +PKVIG++LD  K  L++ 
Sbjct: 84  EAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLET- 142

Query: 150 YEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209
                      NE K+    GPI+  D +PPI    SI +F+G FA  +V G  AN+GR+
Sbjct: 143 -----------NEGKD----GPISMAD-VPPIFMGYSIYEFLGGFAALMVFGIVANYGRI 186

Query: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
           VLL+I+ ER+V+RLR+ VIK+T+H D EFFDR+KVGDLISR GSDAYVVSRSMTQ VSDG
Sbjct: 187 VLLRILSERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDG 246

Query: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
           FKA+ICGGVG+GMM  IS  L+ ++LLF PP+L  A I+G+KI   S  LQ+++G LTRV
Sbjct: 247 FKALICGGVGVGMMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRV 306

Query: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIV 389
           +EEQL+G+RT++SFVAE+KEI RY+ AIR +F VGKR              LGD+SF++V
Sbjct: 307 SEEQLSGVRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVV 366

Query: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449
           L YG+ LVLQG L+IGDLTAFMLYTEYTGSSVFGL++FYSELM+G GAA+RLFEL D   
Sbjct: 367 LAYGSYLVLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVP 426

Query: 450 SVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKST 509
           S++        P +G+I F+DV+FSYPTRP N IF+ M   I  GSNVC+VGPSG+GKST
Sbjct: 427 SIKPTTGKKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKST 486

Query: 510 ITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569
           I  LLLRFY+P+ G I ID  DISK   KSLRRH+G+VQQEP LMSGT+RDNITYGL+ T
Sbjct: 487 IALLLLRFYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTET 546

Query: 570 PTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629
           P+ +EIR+V+KQCFCH FI KFP GYDTVIGP+GA LSGGQ+QRIAIARALIKKP IL+L
Sbjct: 547 PSKEEIRMVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVL 606

Query: 630 DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
           DEATSALDVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSENIIV+GNDGSVVE GK
Sbjct: 607 DEATSALDVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGK 666

Query: 690 FDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEHLVAEDVASINDK 749
           F +L+ +  SEL KLLNEK     + S + S    + P+ D+A+  +    E+    +D 
Sbjct: 667 FKELFADPSSELSKLLNEKSSRSENSSSSYSPNASEQPE-DEAN--QKNAPEEA---HDD 720

Query: 750 VVKNVLNDITHD 761
            V+ +L D+T +
Sbjct: 721 SVEEILKDVTAE 732

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/662 (58%), Positives = 502/662 (75%), Gaps = 19/662 (2%)

Query: 65  SLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVS 124
           S S TK+ N+ + +   K+  +    KE    +R+++RL  L + DWKLL  A+GLL++S
Sbjct: 85  SQSATKEKNEEDRKYSKKEKEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTIS 144

Query: 125 CTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGT 184
           C+IGM +PKVIGL+LD  KN L ++                  + G   S+D LPPIV  
Sbjct: 145 CSIGMTIPKVIGLILDQLKNALAANS-----------------VDGQPVSIDKLPPIVFG 187

Query: 185 LSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
           LS  +F+G FA AL+VG  AN+GR++LL+++ ERLV+RLR+ VIK+T+H D EFFD +KV
Sbjct: 188 LSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKV 247

Query: 245 GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
           GDLISR GSDAYVVSRSMTQ VSDGFKA+ICG VG+GMM  +S  L+ ++L+F PP+++ 
Sbjct: 248 GDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMLALSPQLSCLLLVFTPPVILS 307

Query: 305 AFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364
           A ++GK+IS  SR+LQ+++G+LT+VAEEQL+GI+T++SFVAE++EI RYN AIR +F +G
Sbjct: 308 ASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIG 367

Query: 365 KREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGL 424
           K+              +GD+SF+ VL +G+ LVLQ +L+IGDLTAFM+YTEYTG+S+FGL
Sbjct: 368 KKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGL 427

Query: 425 STFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIF 484
           STFYSE+M+GAGAASRLFEL D   S+ +       P  G+IEF++VSF+YPTRPSN IF
Sbjct: 428 STFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIF 487

Query: 485 KHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHL 544
           K+++F IE GSNVCIVGPSG+GKST+  LL ++Y P+ G ILID  +I+   +KSLRRH+
Sbjct: 488 KNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHI 547

Query: 545 GVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGA 604
           G+VQQEP LMSGTIRDNI YGL+  PT DEIR V+KQCFCH FIT+F   YDTVIGP G 
Sbjct: 548 GLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGT 607

Query: 605 SLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAH 664
            LSGGQ+QRIAIARALIKKP+ILILDEATSALDVESEGAINYT G LM+ KE+TI+SIAH
Sbjct: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667

Query: 665 RLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPP 724
           RLSTIRRSEN+IV+G+DGSVVE+GKF +L+ +  SEL +LLNEK      ++ N +  PP
Sbjct: 668 RLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTP--HQTTNITVTPP 725

Query: 725 DS 726
            +
Sbjct: 726 PT 727

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/657 (58%), Positives = 493/657 (75%), Gaps = 20/657 (3%)

Query: 99  EVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS--YEKGSQD 156
           ++ RL SLAK DWKLL +A+GLL+VSCTIGM++PKVIG+VLD  KN +  S   E GS D
Sbjct: 76  DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSAD 135

Query: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216
           L    E  E            LPPI   LS+ +F+G    AL++G  ANFGRVVLL+++ 
Sbjct: 136 LS--IESSE------------LPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLS 181

Query: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276
           ER+V+RLRSQVIK+T+H D EFFD NKVGDLISR GSDAYVVSRSMTQ VSDGFKA++CG
Sbjct: 182 ERVVARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCG 241

Query: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336
           GVG+GMM  IS  L++ +L F PP+++ +  +G+ I   SR+LQ+++G LTRV+EEQ +G
Sbjct: 242 GVGVGMMVSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSG 301

Query: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
           ++T+++FVAE++EI+RYN+ I+ ++ VGK               LGDMSF++VL YG+ L
Sbjct: 302 VKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYL 361

Query: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456
           VL G LSIGDLTA+M+YTE TGS+VFGLS+FYSE+M+G GAASRLFEL D    +     
Sbjct: 362 VLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTG 421

Query: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516
               P +G+IEF++VSF+YPTRP +QIFK ++F IEPGSNVCIVGPSG+GKSTI SLLL+
Sbjct: 422 KKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLK 481

Query: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576
           +Y P  G+I +D  DISK  +KSLRRH+G+VQQEP LMSG+IRDNITYGL+Y  T +EIR
Sbjct: 482 YYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIR 541

Query: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
            V+KQCFCH FITKFPD Y T++GP G  LSGGQ+QRIAIARAL+KKP +LILDEATSAL
Sbjct: 542 RVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSAL 601

Query: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
           DVESE AINYT G LM+ KE+TIISIAHRLSTIRRSE +IV+GNDGSVVE+GKF  L+ N
Sbjct: 602 DVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGN 661

Query: 697 EESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEHLVAEDVASINDKVVKN 753
             SEL +LLNEK         N ++ P ++P+ +      +    DV  + +++++N
Sbjct: 662 PLSELSQLLNEKS---TINERNPNEKPAETPEQESQKNAANESIVDVV-LEEEILQN 714

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/670 (57%), Positives = 495/670 (73%), Gaps = 29/670 (4%)

Query: 102 RLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVN 161
           RL  LAK DWKLL  AI LLSVSC IGM++PK+IG+VLD  K                  
Sbjct: 104 RLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQ----------------- 146

Query: 162 EDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVS 221
                +++ P  ++D +P I   L++ +F+ +   +L+VG  AN+GRV+LL+++ ER+V+
Sbjct: 147 -----IMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVA 201

Query: 222 RLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMG 281
           RLR+ VIK+TMH D EFFD NKVGDLISR  SDAYVVSRS+TQ VSDGFKA++CG VG+G
Sbjct: 202 RLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIG 261

Query: 282 MMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIK 341
           MM  IS  L++ +L   PP+++ A  +G+ I   SR LQ+++G+LT+VAEEQ +GI+T++
Sbjct: 262 MMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQ 321

Query: 342 SFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGA 401
           SFVAE+KEI+RYN AIR +F VGK+             +LGDMSF++VL YG+ LVL G+
Sbjct: 322 SFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGS 381

Query: 402 LSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTP 461
           LSIGDLTA+M+YTEYTGSS+FGLSTFYSE+M+GAGAASRLFEL D   S+   +     P
Sbjct: 382 LSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVP 441

Query: 462 TQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPN 521
            +G+IEF++VSFSYPTR SNQIFK++SF I+ GSNVCIVGPSG+GKSTI SLLLR+Y+P 
Sbjct: 442 NKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPT 501

Query: 522 YGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQ 581
            G I +D  DISK ++KSLRRH+ +VQQEP LMSGTIRDNITYGL   PT DE+R ++K+
Sbjct: 502 TGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKK 561

Query: 582 CFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 641
           CFCH FITKFP+ YDT++GP G  LSGGQ+QRIAIARALIKKP ILILDEATSALDVESE
Sbjct: 562 CFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621

Query: 642 GAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESEL 701
           GAINYT G LM+SK +TIISIAHRLSTIRRSEN+IV+GNDGSV EVGKF +LY +  SEL
Sbjct: 622 GAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSEL 681

Query: 702 FKLLNEKDHDLVSKSENTS---DIPPDSPKNDDASGLEHLVAEDVASINDKVVKNVLNDI 758
            KLL+EK      + +NT+   +I P+   N + S  E  + +++    +  +K  + D+
Sbjct: 682 SKLLHEK-ATRSERQQNTAEDQEIDPEETINIENSTPESDITQELL---ENPIKEAIMDV 737

Query: 759 THDKNSSTLR 768
             D    T R
Sbjct: 738 AADNKPITPR 747

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/676 (58%), Positives = 501/676 (74%), Gaps = 27/676 (3%)

Query: 96  GWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQ 155
           G  E+ RL  +   DWKLL +AI LL++SC+IGMA+PKVIGLVLDA KN +  S      
Sbjct: 144 GRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMTDS----PS 199

Query: 156 DLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKII 215
            LE  +                LPPI   L++  F+G FAGALV+G   N+GR +LL+++
Sbjct: 200 SLETSD----------------LPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLL 243

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
            ER+V+RLRS VIK+T+H D EFFD+NKVGDLISR GSDAYVVSRS+TQ VSDGFKAI+C
Sbjct: 244 SERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILC 303

Query: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335
           GG G+GMM  IS  L+S +++FAP +++ A I+GKKI  IS  LQ+++G LTRV+EEQLN
Sbjct: 304 GGAGIGMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLN 363

Query: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
           G++T++SFVAE+KEIRRYN+AIR ++ +GK              ++GDMSF++VL YG+ 
Sbjct: 364 GVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSY 423

Query: 396 LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455
           LVL G+L+IGDLTAFMLYT+YT +S+FGLS FYSE+M+G GAA RLF+L D   ++R  I
Sbjct: 424 LVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTI 483

Query: 456 SHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLL 515
                P  G IEFR++ F+YPTRP NQ+FK+++F IEPG++VCIVGPSG+GKSTI  LLL
Sbjct: 484 GEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLL 543

Query: 516 RFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEI 575
           R+Y+P+ G ILIDN DI K   KSLR+++G+VQQEP LMSG+IRDNITYGL    T DEI
Sbjct: 544 RYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEI 603

Query: 576 RVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSA 635
           R VSKQCFCH FITKFPD Y+T+IGP G  LSGGQ+QRIAIARALIKKPKILILDEATSA
Sbjct: 604 REVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663

Query: 636 LDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR 695
           LDVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSE IIV+GNDGSVVE GKF +LY 
Sbjct: 664 LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723

Query: 696 NEESELFKLLNEKDHDLVSKSENTSDIPP--DSPKNDDASGLEHLVAEDVASINDKVVKN 753
           +  SEL KLLNEK     +K E  + +PP  D    DD  G  +       S+++ +V +
Sbjct: 724 DPTSELSKLLNEK-QSRANKKE--APLPPQSDGENGDDFEG--NGTPASPPSLHNNLVTD 778

Query: 754 VLNDITHDKNSSTLRP 769
           VL +++ D +   + P
Sbjct: 779 VLKEVSDDSSPLKIAP 794

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/703 (57%), Positives = 520/703 (73%), Gaps = 41/703 (5%)

Query: 64  SSLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSV 123
           S++S   KDN           N     +E    + +V+RL  L K DWKLL VA+ LL++
Sbjct: 95  STVSTQSKDNKQPSL----QGNPLSTSEEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTI 150

Query: 124 SCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVG 183
           SC IGM +PKVIG++LD+ K       +  +Q     +E +E           A PPI+ 
Sbjct: 151 SCVIGMMIPKVIGIILDSLK------VQTATQ-----SEGEE-----------APPPIMM 188

Query: 184 -TLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRN 242
             L+I +F+G F+ AL+ G  ANFGR++LL+I+ ERLV+RLRS VIKRT+H D +F+D +
Sbjct: 189 FGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRSTVIKRTIHQDAQFYDIH 248

Query: 243 KVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLL 302
           K GDLISR G+DAY+VSRS+TQ +SDGFK++ICGGVG+GMM  +S  L++V+ +   P++
Sbjct: 249 KTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVV 308

Query: 303 VGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFY 362
           + A I+GK+I   SR+LQ ++G LTRV+EEQLNG++T++SFVAE++EI+R+N+AIR +F+
Sbjct: 309 ISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFH 368

Query: 363 VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVF 422
           VGKR             ++GD+SF+ VL+YG+ LVL G+L+IGDLTAFMLYTEYTG+S+F
Sbjct: 369 VGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIF 428

Query: 423 GLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQ 482
           GLSTFYSE+M+GAGAASRLFEL D+   +R  +     P +G+IEF++VSFSYPTRP NQ
Sbjct: 429 GLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQ 488

Query: 483 IFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR 542
           IFK+++F IEPGSNVCIVGPSGKGKSTI  LLL +Y+P  G ILID  DI+K  +KSLRR
Sbjct: 489 IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRR 548

Query: 543 HLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPR 602
            LG+VQQEP LMSG+IRDNITYGL+YTPT +EIR V+KQCFCH FITKFP  YDT IGP 
Sbjct: 549 KLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPS 608

Query: 603 GASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISI 662
           G  LSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAINYT G LM++K +TI+SI
Sbjct: 609 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSI 668

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDI 722
           AHRLSTIRRSEN+IV+GNDGSV+E+GKF +L+ +  SEL KLLNEK     S+ +  SD 
Sbjct: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLNEKS----SRKKTKSDP 724

Query: 723 PPDSPKND-DASGLEHLVAEDVASINDKV---VKNVLNDITHD 761
              +P+ D DA+G      E V  I+  +   + +VLND+T +
Sbjct: 725 ISSAPEVDADATG------EPVEPIDPAIEDALHSVLNDVTSE 761

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/612 (63%), Positives = 470/612 (76%), Gaps = 25/612 (4%)

Query: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156
           +++++RL  LAK DWKLL  AI LL++SC+IGM++PKVIG+VLD  K +  S +      
Sbjct: 102 YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDF------ 155

Query: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216
                              D   PI  +L + +F+  F  AL++G  ANFGR +LL+I+ 
Sbjct: 156 ------------------FDLKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILS 196

Query: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276
           ER+V+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDG KA+ICG
Sbjct: 197 ERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256

Query: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336
            VG+GMM  +S  L+ ++L F PP+L  A ++GK+I   S+ LQ+++G LTRVAEEQL+G
Sbjct: 257 VVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316

Query: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
           I+T++SFVAE  E+ RYN AIR +F VGK              +LGD+SF+ VL YG+ L
Sbjct: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYL 376

Query: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456
           VLQ  LSIGDLTAFMLYTEYTG++VFGLSTFYSE+M+GAGAASRLFEL D K S+   + 
Sbjct: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436

Query: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516
           H   P +G IEF+DVSFSYPTRPS QIFK+++F I PGS+VCIVGPSG+GKSTI  LLLR
Sbjct: 437 HKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496

Query: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576
           +Y+P  G+I IDN DISK   KSLRRH+G+VQQEP LMSGTIRDNITYGL+YTPT +EIR
Sbjct: 497 YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556

Query: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
            V+KQCFCH FITKFP+ YDTVIGP G  LSGGQ+QRIAIARALIKKP ILILDEATSAL
Sbjct: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616

Query: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +LY N
Sbjct: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676

Query: 697 EESELFKLLNEK 708
             S L +LLNEK
Sbjct: 677 PTSALSQLLNEK 688

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/692 (57%), Positives = 501/692 (72%), Gaps = 44/692 (6%)

Query: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156
           +++++RL  LAK DWKLL  AI LL++SC+IGM++PKVIG+VLD  K +  S +      
Sbjct: 99  YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDF------ 152

Query: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216
                              D   PI  +L + +F+  F  AL++G  ANFGR +LL+I+ 
Sbjct: 153 ------------------FDLKIPIF-SLPLYEFLSFFTVALLIGCVANFGRFILLRILS 193

Query: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276
           ER+V+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDG KA+ICG
Sbjct: 194 ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 253

Query: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336
            VG+GMM  +S  L+ ++L F PP+L  A ++GK+I   S+ LQ+++G LTRVAEEQL+G
Sbjct: 254 VVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 313

Query: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
           I+T++SFVAE  E+ RYN AIR +F VGK              +LGD+SF+ VL YG+ L
Sbjct: 314 IKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYL 373

Query: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456
           VLQ  LSIGDLTAFMLYTEYTG++VFGLSTFYSE+M+GAGAASRLFEL D K S+   + 
Sbjct: 374 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 433

Query: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516
           H   P +G IEF+DVSFSYPTRPS QIFK ++F I PGS+VCIVGPSG+GKSTI  LLLR
Sbjct: 434 HKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 493

Query: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576
           +Y+P  G+I+IDN DI+K   KSLRRH+G+VQQEP LMSGTIRDNITYGL+YTPT +EIR
Sbjct: 494 YYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 553

Query: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
            V+KQCFCH FITKFP+ YDTVIGP G  LSGGQ+QRIAIARALIKKP +LILDEATSAL
Sbjct: 554 SVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSAL 613

Query: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +LY N
Sbjct: 614 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSN 673

Query: 697 EESELFKLLNEKDHDLVSKSE------NTSDIP------------PDSPKNDDASGLEHL 738
             S L +LLNE+   + S+ +      N  + P             D   +D+ S  + L
Sbjct: 674 PTSALSQLLNERTAPVPSEQQQQVEKDNEKEEPNEDENHDQRNEGDDGSNHDNDSNNKPL 733

Query: 739 VAEDVASIN-DKVVKNVLNDITHDKNSSTLRP 769
            ++D  S + ++ V++VL D   + N   L P
Sbjct: 734 ESKDKKSDDIEESVEHVLKDAAKEANPIKLSP 765

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/619 (63%), Positives = 478/619 (77%), Gaps = 25/619 (4%)

Query: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS 149
           Q+  +  +++++RL  LAK DWKLL  AI LL++SC+IGM++PKVIG+VLD    TLK+S
Sbjct: 95  QRSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLD----TLKTS 150

Query: 150 YEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209
              GS   E         +  PI SL           + +F+  F  AL++G  ANFGR 
Sbjct: 151 --SGSDFFE---------LKIPIFSL----------PLYEFLSFFTVALLIGCAANFGRF 189

Query: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
           +LL+I+ ER+V+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDG
Sbjct: 190 ILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDG 249

Query: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
            KA+ICG VG+GMM  +S  L+ ++L F PP+L  A ++GK+I   S+ LQ+++G LTRV
Sbjct: 250 VKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRV 309

Query: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIV 389
           AEEQL+GI+T++SFVAE  E+ RYN AIR +F VGK              +LGD+SF+ V
Sbjct: 310 AEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTV 369

Query: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449
           L YG+ LVLQ  LSIGDLTAFMLYTEYTG++VFGLSTFYSE+M+GAGAASRLFEL D K 
Sbjct: 370 LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP 429

Query: 450 SVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKST 509
           S+     H   P +G +EF+DVSFSYPTRPS QIFK+++F I PGS+VCIVGPSG+GKST
Sbjct: 430 SISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKST 489

Query: 510 ITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569
           I  LLLR+Y+P+ G+I+ID+ DI+K   KSLRRH+G+VQQEP LMSGTIRDNITYGL+YT
Sbjct: 490 IALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549

Query: 570 PTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629
           PT +EIR V+KQCFCH FITKFP+ YDTVIG RG  LSGGQ+QRIAIARALIKKP ILIL
Sbjct: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILIL 609

Query: 630 DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
           DEATSALDVESEGAINYT G LM+SK +TIISIAHRLSTIRRSEN+IV+G+DGSVVE+GK
Sbjct: 610 DEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGK 669

Query: 690 FDKLYRNEESELFKLLNEK 708
           F KLY N  S L +LLNE+
Sbjct: 670 FKKLYANPTSALSQLLNER 688

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/612 (62%), Positives = 469/612 (76%), Gaps = 25/612 (4%)

Query: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156
           +++++RL  LAK DWKLL  AI LL++SC+IGM++PKVIG+VLD  K +  S +      
Sbjct: 102 YKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDF------ 155

Query: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216
                              D   PI  +L + +F+  F  AL++G  ANFGR +LL+I+ 
Sbjct: 156 ------------------FDLKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILS 196

Query: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276
           ER+V+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDG KA+ICG
Sbjct: 197 ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256

Query: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336
            VG+GMM  +S  L+ ++L F PP+L  A ++GK+I   S+ LQ+++G LTRVAEEQL+G
Sbjct: 257 IVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316

Query: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
           I+T++SFVAE  E+ RYN AIR +F VGK              +LGD+SF+ VL YG+ L
Sbjct: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYL 376

Query: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456
           VLQ  LSIGDLTAFMLYTEYTG++VFGLSTFYSE+M+GAGAASRLFEL D K S+   + 
Sbjct: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436

Query: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516
           H   P +G IEF+DVSFSYPTRPS QIFK ++F I PGS+VCIVGPSG+GKSTI  LLLR
Sbjct: 437 HKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496

Query: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576
           +Y+P  G+I+IDN DI+K   KSLRR +G+VQQEP LMSGTIRDNITYGL+YTPT +EIR
Sbjct: 497 YYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556

Query: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
            V+KQCFCH FITKFP+ YDTVIGP G  LSGGQ+QRIAIARALIKKP ILILDEATSAL
Sbjct: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616

Query: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +LY N
Sbjct: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676

Query: 697 EESELFKLLNEK 708
             S L +LLNE+
Sbjct: 677 STSALSQLLNER 688

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/612 (61%), Positives = 474/612 (77%), Gaps = 22/612 (3%)

Query: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156
           +++V RL  L K D+KLL V++ LL++SCTIGM +PK+IGL+LDA K             
Sbjct: 160 FKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLILDALK------------- 206

Query: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216
                    S+   P       P I+  L++ +F+G F+ AL +G  AN+GR++LL+I+ 
Sbjct: 207 ---------SVATTPDGGSSPPPTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRILS 257

Query: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276
           ERLV+RLRS V+K T+H D EFFD +KVGDLISR G+D+Y+VSRS+TQ +SDG K++ICG
Sbjct: 258 ERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICG 317

Query: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336
           GVG+GMM  +S  L+SV++ F  P+++ A I+GK+I   SR+LQ ++G LTRV+EEQLNG
Sbjct: 318 GVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNG 377

Query: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
           +RT++SFVAE++EI+R+N +IR++F VGKR             ++GD+SF+ VL+YG+ L
Sbjct: 378 VRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYL 437

Query: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456
           VL G+L+IGDLTAFMLYTEYTG+++FGLSTFYSE+M+GAGAASRLFEL D   ++R  + 
Sbjct: 438 VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLG 497

Query: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516
              TP +G+IEF++VSF+YPTRPSNQIFK ++F I+PGSNVCIVGPSGKGKSTI  LLL 
Sbjct: 498 KTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLH 557

Query: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576
           +Y+P  G ILID  DI+K  +KSLRR + VVQQEP LMSGTIRDNITYGL+  PT +EIR
Sbjct: 558 YYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR 617

Query: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
            V+KQCFCH FI KFP  YDT IGP G  LSGGQ+QRIAIARALIKKP ILILDEATSAL
Sbjct: 618 TVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 677

Query: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSENIIV+GNDGSVVE+GKF +L+ +
Sbjct: 678 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737

Query: 697 EESELFKLLNEK 708
             SEL KLLNEK
Sbjct: 738 PTSELSKLLNEK 749

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/668 (54%), Positives = 474/668 (70%), Gaps = 37/668 (5%)

Query: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156
           ++++ RL  L K DWKLL  A+ LL+VSC IGM +PKVIG VLD+ K            D
Sbjct: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLK------------D 135

Query: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216
           ++G  E  E +I                +S+  F    +G L++G  AN+ RV+LL+I+ 
Sbjct: 136 IQG-KEFSELMI--------------WDMSLKHFFYGLSGLLLLGCGANYVRVILLRILS 180

Query: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276
           E LV++LR+ VIK  +H D +FFD  KVGDLISR G+DA++VSRS+TQ +SDG KA+  G
Sbjct: 181 ENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIG 240

Query: 277 GVGMGMMFHISSTLT-SVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335
             G+GMM  IS  L+ S+++L   PLL+ A ++GK+I   S++LQ+ + NLTRV+EEQ N
Sbjct: 241 SAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFN 300

Query: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
           GI+TI+SFVAE+ E+ ++N +IR++F VGK              I+GD+SF++VL YG+ 
Sbjct: 301 GIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSW 360

Query: 396 LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455
           LV Q  LS+GDLTAFMLYTEYTG+++F LS F+SE+M+GAGAASR+FEL D K  +    
Sbjct: 361 LVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTR 420

Query: 456 SHALTPTQG-KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLL 514
                P +G +IEF++VSF+YPTRP+  IF++++F IE GSNVCIVGPSGKGKSTI  LL
Sbjct: 421 GSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLL 480

Query: 515 LRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE 574
           L +Y+P+ G ILID  DIS  +TKSLRRH+G+VQQEP LMSGTIRDNITYGL+YTPT +E
Sbjct: 481 LHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEE 540

Query: 575 IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATS 634
           IR V+KQCFCH FIT+FPD YDT IGP G  LSGGQ+QRIAIARALIKKP +LILDEATS
Sbjct: 541 IRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATS 600

Query: 635 ALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY 694
           ALDVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN+IV+GNDGSVVE GKF +L+
Sbjct: 601 ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELF 660

Query: 695 RNEESELFKLLNEKDHDLVSK--------SENTSDIPPDSPKNDDASGLEHLVAEDVASI 746
            N  SEL KLL EK     +         S+   + P  S +   AS +    AE  A  
Sbjct: 661 ANPASELSKLLREKSSGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAET 720

Query: 747 NDKVVKNV 754
            ++V+K++
Sbjct: 721 INEVLKDI 728

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/619 (57%), Positives = 458/619 (73%), Gaps = 32/619 (5%)

Query: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156
           WR++ RL  L K D KLL +AI LL++SC+IGMA+PK+IG +LD    TL+++YE    +
Sbjct: 83  WRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILD----TLRNNYE----N 134

Query: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216
           L  +++ K  ++  P+++      ++G       VGI    L+ G  ANFGRVV+L+II 
Sbjct: 135 LTSLSQIK--ILNIPLSTF-----LMG-------VGI---TLIFGCFANFGRVVILRIIS 177

Query: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276
           ERLVSRLRSQV+K  +H D+EFFD  KVGDL+SR G+DA+VVSRS+T  V+DG ++   G
Sbjct: 178 ERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIG 237

Query: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336
             G+G+M  +S  LT  +    PP++    ++GK+I   S++LQ  +G+LTRV EEQ NG
Sbjct: 238 IFGIGLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNG 297

Query: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
           IRT++ FVAE+ EI+R+N+ +R++F VGK              ++GD+ F+IVL YG+ L
Sbjct: 298 IRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYL 357

Query: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456
           V+ G++SIGDLTAFMLYTEYTG+++FGLS+FYSELM+G GAASR+FE+ D +  ++S   
Sbjct: 358 VMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTG 417

Query: 457 HA----LTPTQG-KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTIT 511
            A    L    G +IEF++VSF YPTRP+NQIFK+++F +  GSNVCIVGPSG+GKSTI 
Sbjct: 418 EAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIA 477

Query: 512 SLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPT 571
           SLLL  Y+   G ILID  DI+   TKSLRR +G+VQQEP LMSGTIRDNITYGL+  P+
Sbjct: 478 SLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPS 537

Query: 572 MDEIRVVSKQCFCHGFITKFPDGYD--TVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629
            +EIR+V+KQCFCH FITKFPD YD     G  G SLSGGQ+QRIAIARALIKKP ILIL
Sbjct: 538 KEEIRLVAKQCFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILIL 597

Query: 630 DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
           DEATSALDVESEGAINYT G +M+SK +TI+SIAHRLSTIRR E++IV+GNDGSVVE+GK
Sbjct: 598 DEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGK 657

Query: 690 FDKLYRNEESELFKLLNEK 708
           F +LY N  SEL KLLNEK
Sbjct: 658 FKELYDNPTSELSKLLNEK 676

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/646 (45%), Positives = 422/646 (65%), Gaps = 17/646 (2%)

Query: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS 149
           ++ T+ G+++V RL +LAK +   + +A+ L+ +S T+ M VP VIG +LD + NT  S+
Sbjct: 86  EESTNTGFKDVKRLFTLAKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNT--SN 143

Query: 150 YEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209
            + G    +   ++KE          D     +   + TQF        V+GA AN GR+
Sbjct: 144 DDTGDAKSKEKVDNKE----------DRDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRI 193

Query: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
           V+LK+ GE+LV+RLR++ +K  +  D  F D N+VGDLISR  SDA +V++S+T NVSDG
Sbjct: 194 VILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDG 253

Query: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
            +AI+ G VG  MM +IS  LTSVM+L  PPL + A +YGKKI  +SRQLQ + G LT+V
Sbjct: 254 TRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVYGKKIRNLSRQLQTAVGGLTKV 313

Query: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIV 389
           AEEQLN  +TI+++  EKKEIRRY   +R +F VG +E            ++G+ + + +
Sbjct: 314 AEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSL 373

Query: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449
           LL G N++  G+L++GDL++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K 
Sbjct: 374 LLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKP 433

Query: 450 SVRSNISHALTPTQGK-IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKS 508
            ++  I       +GK I F+DVSF YPTRP++++F  +SF IEPG ++C VGPSG GKS
Sbjct: 434 LIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKS 493

Query: 509 TITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGL-- 566
           T++ LLLR+YD   G+ILI   +I   + +  R+ LGVVQQEP L +GTI DNI Y +  
Sbjct: 494 TVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVPD 553

Query: 567 SYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKI 626
                 +++ +  K+  C  F+  FPDG +T++GPRG  LSGGQ+QRIAIAR+ +  P I
Sbjct: 554 EIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQLSGGQKQRIAIARSFLLDPSI 613

Query: 627 LILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVE 686
           L+LDEATSALD +SE  I  TL     ++ LT ISIAHRLSTI+ S  ++V+  +GSVVE
Sbjct: 614 LLLDEATSALDTQSEDIIAMTLKK-REAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVE 672

Query: 687 VGKFDKLYRNEESELFKLLNEKDHD-LVSKSENTSDIPPDSPKNDD 731
            GKF +L  N  SEL  LL+++  +     ++  ++ P ++P  D+
Sbjct: 673 TGKFTELIANPTSELNLLLSKEGQEPAYVAADVAAETPAEAPSTDN 718

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/649 (45%), Positives = 428/649 (65%), Gaps = 32/649 (4%)

Query: 76  NGRGLLKDDND-------TQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIG 128
           N   +LK +ND         ++   S G++++ RL SLA+ + + +A+A+  + +S ++ 
Sbjct: 66  NHNNILKPENDIVPDIKGQMLRDSKSSGFKDIQRLFSLARPELRYIALALLFILISSSVS 125

Query: 129 MAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSIT 188
           M VP +IG +LDA K        KG ++    NE+++S    P  +   L       + T
Sbjct: 126 MTVPSIIGKLLDAAK--------KGQKE----NEEEDSKTIVPDITFFGL-------TRT 166

Query: 189 QFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLI 248
           QF        +VGA AN GR+++LK+ GERLV+RLR++ +K  +  D  F D N+VGDLI
Sbjct: 167 QFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKAALDQDATFLDANRVGDLI 226

Query: 249 SRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIY 308
           SR  SDA +VS+++TQNVSDG +AII G VG GMM ++S  LT VM+L  PPL + A +Y
Sbjct: 227 SRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKLTGVMMLMVPPLGIMALVY 286

Query: 309 GKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREX 368
           G+KI  +S+QLQ+S G L++VAEEQLN  +TI+++V E+ EI RY   +R +F +G +E 
Sbjct: 287 GRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEIHRYATEVRNVFRIGLKEA 346

Query: 369 XXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFY 428
                      ++G+++ + +LL G N++  G L++G+L++FM+Y  YTGSS+FGLS+FY
Sbjct: 347 VTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSFMMYAVYTGSSLFGLSSFY 406

Query: 429 SELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGK-IEFRDVSFSYPTRPSNQIFKHM 487
           SELMKGAGAASR+FEL D K  ++S +        GK I+F +VSF+YP+RP+++IF ++
Sbjct: 407 SELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKFENVSFTYPSRPNHKIFDNL 466

Query: 488 SFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVV 547
           +  I PG +VCIVG SG GKSTI SLLLR+YD N GSI I ++DI  F+ +  RR +G V
Sbjct: 467 NLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIGTV 526

Query: 548 QQEPTLMSGTIRDNITYG----LSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
           QQEP+L +G+I DNI Y     L+     + +++  KQ  C+ F+ KFPDG  T++GPRG
Sbjct: 527 QQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCNIFLGKFPDGLQTLVGPRG 586

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIA 663
           A LSGGQ+QRIA+ARA +  P +LILDE+TSALD  SE  +  TL     ++ LT ISIA
Sbjct: 587 AQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVAKTLQA-RSARGLTTISIA 645

Query: 664 HRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDL 712
           HRLSTI+ S  +IV+G  GSVVE G FD+L  N +SEL  LL++++  +
Sbjct: 646 HRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLLSQQNEHI 694

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/651 (46%), Positives = 411/651 (63%), Gaps = 41/651 (6%)

Query: 60  KRGYSSLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIG 119
           K+G  SL+ T K       GL    +D++       GW+++ RL  LAK + + + +A+ 
Sbjct: 58  KQGKPSLTATVK-------GLRLSPHDSKAS-----GWQDIKRLFLLAKPETRSMFIALI 105

Query: 120 LLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALP 179
           L+ +S  + MAVP VIG +LD  +           ++ E    +KE++I G         
Sbjct: 106 LIILSSAVSMAVPTVIGKLLDIAR-----------EEHEQPETEKETMIFG--------- 145

Query: 180 PIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF 239
                L+ TQF     G  VVGA AN GR+V+LK+ GERLV+RLR++ +K  +  D  F 
Sbjct: 146 -----LTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAALEQDATFL 200

Query: 240 DRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAP 299
           D N+VGDLISR  SDA +VS+S+TQN+SDG +A+I G VG GMM  IS  LT VM+L AP
Sbjct: 201 DHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCVMMLLAP 260

Query: 300 PLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQ 359
           PL V A +YGK+I  +SRQLQ S G LT+V+EEQL+  +TI+++  EKKEI RY D +R+
Sbjct: 261 PLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRYADEVRK 320

Query: 360 LFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGS 419
           +F+VG +E             +G+++ + +LL G +++  G +++GDL++FM+Y  YTGS
Sbjct: 321 VFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMYAVYTGS 380

Query: 420 SVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISH-ALTPTQGKIEFRDVSFSYPTR 478
           S+FGLS+FYSELMKGAGAA+R+FEL D K  +   I    +T     I F  V FSYPTR
Sbjct: 381 SLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVKFSYPTR 440

Query: 479 PSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTK 538
           P + IF+ ++FT+ PG +VCIVGPSG GKST+ SLLLR+YD   G I + N +I  F  +
Sbjct: 441 PQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNIRDFNLR 500

Query: 539 SLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSK--QCFCHGFITKFPDGYD 596
             RR LGVVQQEP L SGTI DNITY +      DE R+     Q  C  F+  FPDG  
Sbjct: 501 KYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLANFPDGLQ 560

Query: 597 TVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKE 656
           T +GPRG  LSGGQ+QRIA+ARA +  P ILILDEATSALD +SE  +  +L     ++ 
Sbjct: 561 TTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ-RSARG 619

Query: 657 LTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            T ISIAHR+STI+ S  +IV+   G+V E G FDKL    +S L KLL++
Sbjct: 620 KTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLSK 670

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/634 (46%), Positives = 407/634 (64%), Gaps = 16/634 (2%)

Query: 91  KETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSY 150
           ++ S G+R++ RL  LA+ +   +  A+ L+ +S T+ M +P VIG +LD  K++  S  
Sbjct: 84  EKNSSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSE- 142

Query: 151 EKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVV 210
                     NE +ES              I G  +  QF  I  G  V GA AN GR++
Sbjct: 143 ----------NEKQESGDGDDKDKDKEEGTIYG-FTPKQFCVIMGGIFVAGAFANCGRII 191

Query: 211 LLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGF 270
           +LK+ GERLV+RLR++ +K  +  D  F DRN+VGDLISR  SD+ +V++S+TQNVSDG 
Sbjct: 192 ILKVTGERLVARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGT 251

Query: 271 KAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA 330
           +A+I G VG GMM +IS  LT VM L  PP+   A IYGKKI  +S+QLQ S G LT+VA
Sbjct: 252 RAVIQGFVGFGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVA 311

Query: 331 EEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVL 390
           EEQL   +TI+S+V EKKEIRRY   +RQ+F +G +E             +G++S + +L
Sbjct: 312 EEQLGATKTIQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALL 371

Query: 391 LYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS 450
           + GA+++  G +++GDL++FM+Y  YTG S+FGLS FYSELMKGAGAA+R+FEL D K +
Sbjct: 372 MSGASMIQSGLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPA 431

Query: 451 VRSNISHALTPTQG-KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKST 509
           +   +    T  +   I F+DVSF+YPTR + +IF H++ TI+PG ++CI GPSG GKST
Sbjct: 432 IAPTLGKGPTSIRNLPISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKST 491

Query: 510 ITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569
           I SLL+R+YD + G I I + D+  F  +  RR +GVV QEP L +GTI +NI Y +  +
Sbjct: 492 IASLLVRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPS 551

Query: 570 PTMDEIRVVSK--QCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKIL 627
              DE RV +   +  C  F++ FPDG +T++GPRGA LSGGQ+QR+A+ARA +  P +L
Sbjct: 552 VAQDERRVSAAIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALL 611

Query: 628 ILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEV 687
           +LDEATSALD +SE  +  TL   +R + LT ISIAHR+STI  S  ++V+G DG VVE 
Sbjct: 612 VLDEATSALDSQSEEIVARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVES 670

Query: 688 GKFDKLYRNEESELFKLLNEKDHDLVSKSENTSD 721
           G F +L     SEL  LL+ +  +     EN S+
Sbjct: 671 GPFQELIDRPNSELNYLLSLQQDEREEIKENPSE 704

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/618 (47%), Positives = 394/618 (63%), Gaps = 19/618 (3%)

Query: 96  GWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKN-TLKSSYEKGS 154
           G+++V RL  LA+ +   +++A+ L+ +S  + M VP VIG +LD  K  +      KG 
Sbjct: 96  GFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADEENGKGV 155

Query: 155 QDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKI 214
            +     ED++  I G              L+  QF         VGA AN GR+++LK+
Sbjct: 156 SEKLKEKEDEDKKIYG--------------LTALQFYTALGVVFTVGALANTGRIIILKV 201

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAII 274
            GERLV+RLR++ +K  +  +  F D NKVGDLISR  +DA +V++S+TQNVSDG +AI+
Sbjct: 202 TGERLVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAIL 261

Query: 275 CGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQL 334
            G VG GMM +IS  LTSVMLL  PPL   A IYG+KI  +SRQLQ S G LT+VAEEQL
Sbjct: 262 QGFVGFGMMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQL 321

Query: 335 NGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGA 394
           N  RTI+++  EKKEI RY   +R +F +G +E            ++G+ + + +L+ G 
Sbjct: 322 NATRTIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGT 381

Query: 395 NLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSN 454
           N++  GAL++G+L++FM+Y  YTGSS+FGLSTFYSELMKGAGAA+R+FEL D K +++  
Sbjct: 382 NMISSGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPT 441

Query: 455 ISHALTPTQGK-IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSL 513
           I        GK +EF++VSF YPTRP  QIF+  S  IEPG +VC VGPSG GKST++SL
Sbjct: 442 IGKDPITLFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSL 501

Query: 514 LLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMD 573
           LLR+YD   GSIL+   DI  F+ +  RR LGVVQQEP L +GTI +NI Y +      +
Sbjct: 502 LLRYYDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANE 561

Query: 574 EIRV--VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDE 631
             R+    +   C  F+  FPDG +T++GPRG  LSGGQ+QRIA+AR  +  P ILILDE
Sbjct: 562 PGRIERAIESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDE 621

Query: 632 ATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
           ATSALD +SE  I   L      K  T ISIAHRLSTI+ S  ++V+G +G VVE G F 
Sbjct: 622 ATSALDSQSEDIIAQNLQA-RNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQ 680

Query: 692 KLYRNEESELFKLLNEKD 709
           +L  N  S L  LL +++
Sbjct: 681 ELISNPSSGLNILLTQEE 698

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/628 (47%), Positives = 404/628 (64%), Gaps = 44/628 (7%)

Query: 96  GWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQ 155
           G++ V RL  LA+ + K LA A+ L+ +S  + M +P VIG +LD +K       E G  
Sbjct: 79  GFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEK-----EAGGD 133

Query: 156 DLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKII 215
                +E++E+ I G              L+  QF     G  V+GA AN GR+V+LK+ 
Sbjct: 134 G----DEEQETRIYG--------------LTEKQFYTALGGVFVIGACANVGRIVILKVT 175

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
           GE+LV+RLR++ +K  +  D  F D N+VGDLISR  SDA +VS+S+TQN SDG +A+I 
Sbjct: 176 GEKLVARLRTKTMKAALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQ 235

Query: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335
           G VG GMM +IS+ LT VMLL APPL++ A +YG++I  ++R+LQ   G LT+VAEEQLN
Sbjct: 236 GMVGFGMMGYISAQLTGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLN 295

Query: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
             RTI+S+  E+KEIRRY + +R +F VG RE            ++G+M+ + +LL G +
Sbjct: 296 ATRTIQSYCGERKEIRRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTS 355

Query: 396 LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455
           ++  GA+++G+L++FM+Y  YTGSS+FGLS+FYSELMKGAGAASR+FEL D     R  +
Sbjct: 356 MIRSGAITVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELND-----RVPL 410

Query: 456 SHALTPTQGK---------IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKG 506
            H   PT+GK         IEF++V FSYP+R ++ +F  ++  I PG +VC+VGPSG G
Sbjct: 411 IH---PTKGKDPISLAAKEIEFKNVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGG 467

Query: 507 KSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGL 566
           KSTI+SLLLRFYD + G I I   +I  F  +  RR LG+VQQEP L +G+I+DNI Y L
Sbjct: 468 KSTISSLLLRFYDVDSGVITIGGQNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYAL 527

Query: 567 SYTPTMDEIRV--VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624
                 D+ RV    +   C  FI+ FPDG DT++GPRG  LSGGQ+QRIAIARA I  P
Sbjct: 528 PPHIISDKHRVNRALEAANCTRFISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDP 587

Query: 625 KILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSV 684
            ILILDEATSALD +SE  I   L     S ++T ISIAHR+STI  S  +IV+  +G V
Sbjct: 588 SILILDEATSALDSQSEDIIAQALRARSESGKIT-ISIAHRISTIEHSNRVIVLSRNGGV 646

Query: 685 VEVGKFDKLYRNEESELFKLLNEKDHDL 712
            E G F  L     S L KLL+ K+H+L
Sbjct: 647 SETGAFCDLINQPNSNLNKLLS-KEHEL 673

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/619 (46%), Positives = 402/619 (64%), Gaps = 26/619 (4%)

Query: 96  GWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQ 155
           G++++ RL  LAK +   +A+A+ L+ +S  + M +P ++G +LD  K+  +   +  ++
Sbjct: 89  GFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKD--RKDADDTTE 146

Query: 156 DLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKII 215
           D EG                   P I G ++  QF        +VGA AN GR+V+LKI 
Sbjct: 147 DDEG-------------------PKIFG-MTTKQFCTALLAVFLVGAAANAGRIVILKIT 186

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
           GERLV+RLR++ +K  +  D  F D N+VGDLIS   SDA +V++S+TQNVSDG +A+I 
Sbjct: 187 GERLVARLRTRTMKAALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQ 246

Query: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335
           G VG GMM +IS  LTSVM+L  PPL + A +YG+KI  +SRQLQ S G LT+V+EEQL 
Sbjct: 247 GFVGFGMMGYISWQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLG 306

Query: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
            ++TI+S+V EKKEI RY   +R +F +G +E            ++G++S + +L+ G N
Sbjct: 307 AVKTIQSYVGEKKEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTN 366

Query: 396 LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455
           ++  G +++GDL++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K  +   I
Sbjct: 367 MIQNGLITVGDLSSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTI 426

Query: 456 SH-ALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLL 514
               +T     I F +VSF+YPTR + +IF  +  T+EPG +VCIVGPSG GKST+ SLL
Sbjct: 427 GQDPVTLANKTIRFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLL 486

Query: 515 LRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGL--SYTPTM 572
           LR+YD N G I+I +H+I+ F  +  RR LG+VQQEP L +GTI DNI Y +        
Sbjct: 487 LRYYDTNEGRIMIGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADND 546

Query: 573 DEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEA 632
           D I     Q  C  F+  FPDG  T++GPRGA LSGGQ+QRIA+ARA +  P +LILDEA
Sbjct: 547 DLISTAIGQANCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEA 606

Query: 633 TSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDK 692
           TSALD +SE  +  TL   ++ + LT ISIAHRLSTI+    ++V+G  G VVE G F++
Sbjct: 607 TSALDSQSEEIVAQTLRVRVQ-RGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEE 665

Query: 693 LYRNEESELFKLLNEKDHD 711
           L RN  SEL  LL+++  +
Sbjct: 666 LLRNPLSELSILLSQQQDE 684

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/624 (47%), Positives = 401/624 (64%), Gaps = 24/624 (3%)

Query: 96  GWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNT----LKSSYE 151
           G++++ RL  LAK +   + +A+  + +S  + M +P VIG +LDA K      + +S E
Sbjct: 101 GFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASGE 160

Query: 152 K-GSQDLEGVNEDK-ESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209
             GS D     ED  + LI G              L+  QF        VVGA AN GR+
Sbjct: 161 GVGSSDSSDNQEDSSDRLIYG--------------LTFPQFYTALGTIFVVGAFANMGRI 206

Query: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
           VLLK+ GE+LV+RLR++ +K  +  D  F D N+VGDLISR  SDA +VS+S+TQN+SDG
Sbjct: 207 VLLKVTGEKLVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDG 266

Query: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
            +A+I G VG GMM  IS  LT VM L APPL V A +YGKKI  +SRQLQ S G LT+V
Sbjct: 267 ARAVIQGAVGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKV 326

Query: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIV 389
           AEEQL+  RT++++  EK+EIRRY   +R +F +G +E             +G+++ + +
Sbjct: 327 AEEQLSAARTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLAL 386

Query: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449
           LL G +++  GA+++GDL++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K 
Sbjct: 387 LLTGTSMIRSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKP 446

Query: 450 SVRSNISHALTPTQGK-IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKS 508
            +           QGK IEFR+V+F+YPTR  N+IF  +S  I+PG +VCIVGPSG GKS
Sbjct: 447 LIHPTKGVDPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKS 506

Query: 509 TITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSY 568
           TI SLLLR+YD + G I I   DI +F  +  RR LGVVQQEP L +GTI DNITY +  
Sbjct: 507 TIASLLLRYYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPG 566

Query: 569 TPTMDEIRVVSK--QCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKI 626
               D+ RV     Q  C  F+  FPDG +T++GPRGA +SGGQ+QRIA+ARA +  P +
Sbjct: 567 ELAGDDSRVSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAV 626

Query: 627 LILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVE 686
           LILDEATSALD +SE  +  +L +  R  + T +SIAHRLSTI+ S  +IV+   G V E
Sbjct: 627 LILDEATSALDSQSEEVVAQSLRSRSRRGK-TTVSIAHRLSTIQHSSRVIVLDRHGGVGE 685

Query: 687 VGKFDKLYRNEESELFKLLNEKDH 710
            G F +L  + +S L +LL +++ 
Sbjct: 686 TGSFRELISDPDSHLTQLLLKEEE 709

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  535 bits (1379), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 298/650 (45%), Positives = 421/650 (64%), Gaps = 21/650 (3%)

Query: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS 149
           +++ S  W+++ RL  LA+ + K +  A+ L+ +S ++ M VP VIG ++D  K    SS
Sbjct: 77  EEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDVAKEDGTSS 136

Query: 150 YEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209
            E   +  +  ++   S      A  D+   I+G L++ QF G      VVGA AN GR+
Sbjct: 137 SEADGKRGDATDKTDGS----TAADTDSEKLILG-LTLPQFYGGLFSLFVVGAAANMGRI 191

Query: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
           V+LK+ GE+LV+RLR++ +K  +  D  F D NKVGDLISR  SDA +VS+S+TQN+SDG
Sbjct: 192 VILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDG 251

Query: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
            +++I G VG GMM +IS  LT VM+L APPL V A +YG+KI  +SR LQ S G LT+ 
Sbjct: 252 TRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKA 311

Query: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIV 389
           AEEQL+  RTI+++  EK+ IR Y   +RQ++ VG +E            ++G+ + + +
Sbjct: 312 AEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLAL 371

Query: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449
           LL G +++  GA+++GDL++FM+Y  YTGSS+FG+S+FYSELMKGAGAA+R+FEL D K 
Sbjct: 372 LLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKP 431

Query: 450 SV-----RSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSG 504
           ++     R  +S A  P    +EF+ V F+YPTR  + IF+ +S  I+PG +VCIVGPSG
Sbjct: 432 AIHPTKGRDPVSLARKP----VEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSG 487

Query: 505 KGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITY 564
            GKST+ SLLLRFYD + G+ILI   +I+ F  +  RR +G+VQQEP L +GTI +NI Y
Sbjct: 488 GGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILY 547

Query: 565 GLSYTPTMDEIRVVSK---QCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALI 621
            +      +E   V++   Q  C  F++ FPDG  T++GPRG  LSGGQ+QRIA+ARA +
Sbjct: 548 TVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFL 607

Query: 622 KKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGND 681
             P +LILDEATSALD  SE  I  TL +   ++  T ISIAHR+STI+ S  +IV+G +
Sbjct: 608 LDPDLLILDEATSALDSRSEEVIARTLHS-RTTRGKTTISIAHRVSTIQHSTRVIVLGRN 666

Query: 682 GSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDD 731
           G VVE G FD+L  N +S+L KLL  K+ + V   E T+   P  P+  D
Sbjct: 667 GGVVETGTFDELASNTDSQLNKLL-RKEEEPVQPGEITN--APHRPEGSD 713

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  534 bits (1376), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 287/620 (46%), Positives = 399/620 (64%), Gaps = 26/620 (4%)

Query: 94  SVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKG 153
           S G +++ RL  LAK + K + +A+  + +S ++ M +P +IG +LD  K          
Sbjct: 90  SNGMKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGD- 148

Query: 154 SQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLK 213
                  N  KE L+            I G L+  QF     G  + GA AN  R+V+LK
Sbjct: 149 ------NNAKKEKLM------------IFG-LTKPQFYTALGGLFLAGAIANASRIVILK 189

Query: 214 IIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAI 273
           + GERLV+RLR++ +K  ++ D  F D N+VGDLISR  SDA +V++++TQNVSDG +A+
Sbjct: 190 VTGERLVARLRTRTMKAALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAV 249

Query: 274 ICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQ 333
           I G VG GMM  IS  LT VM++  PPL V A +YG+KI  +SRQLQ S G LT+VAEEQ
Sbjct: 250 IQGFVGFGMMSFISWKLTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQ 309

Query: 334 LNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYG 393
           LN  RTI+++  E  EI RY   +R++F VG +E            ++G+++ + +LL G
Sbjct: 310 LNATRTIQAYGGEALEIHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVG 369

Query: 394 ANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRS 453
            +++  G L++GDL++FM+Y  YTGSS+FGLS FYSELMKGAGAA+R+FEL D K  ++ 
Sbjct: 370 TSMIQYGTLTVGDLSSFMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKP 429

Query: 454 NISHALTPTQGK-IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITS 512
            I +      GK IEF++VSF+YPTRP++ I  ++S +I+PG +VCIVGPSG GKST++S
Sbjct: 430 TIGYDPKSLLGKSIEFQNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSS 489

Query: 513 LLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGL----SY 568
           LLLR+YD + GSI ID  +I +F  +  RR LGVVQQEP L +GTI DNI Y +    + 
Sbjct: 490 LLLRYYDVSTGSIKIDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETL 549

Query: 569 TPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI 628
           T    +++   +Q  C  F+  FP+G +T++GPRG  LSGGQ+QRIA+ARA +  P +LI
Sbjct: 550 TANSPDVKRALEQANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLI 609

Query: 629 LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           LDEATSALD +SE  +   L   +    LT ISIAHRLSTI+ S  +IV+   GSVVE G
Sbjct: 610 LDEATSALDSQSEEIVAKNLSERVELG-LTTISIAHRLSTIKHSTRVIVLDKSGSVVETG 668

Query: 689 KFDKLYRNEESELFKLLNEK 708
            F++L     SEL  LL+++
Sbjct: 669 PFEELVDYSRSELNMLLSQQ 688

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  530 bits (1365), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 309/696 (44%), Positives = 429/696 (61%), Gaps = 40/696 (5%)

Query: 30  PAAVSIQAPRRYNVSLLAVIERREVVIYRPKRGYSSLSKTKKDNDGNGRGLLKDDNDTQV 89
           P+  +I  P+   V L ++I  ++ ++ +  R  SS+++ K       +  L D N    
Sbjct: 30  PSFKTIVCPK---VRLNSIISHKKALLSQSIRLQSSIAEGKASTKPTLK--LSDANSK-- 82

Query: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS 149
               S G++++ RL  L++ + K + +A+ L+ +S ++ MAVP VIG +LD    +    
Sbjct: 83  ----SSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDDEE 138

Query: 150 YEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209
            E+ ++D         S + G              L+  QF        V+GA AN  R+
Sbjct: 139 DEEKARD---------SKLYG--------------LTKKQFFTALGLVFVIGAVANASRI 175

Query: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
           ++LKI GERLV+RLR++ +K  +  D  F D N+VGDLISR  SDA +V++S+TQNVSDG
Sbjct: 176 IILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDG 235

Query: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
            +AII G VG GMM  +S  LT VM+L APPL   A +YGKKI  +SRQLQ S G LT+V
Sbjct: 236 TRAIIQGFVGFGMMSFLSWKLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKV 295

Query: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIV 389
           AEEQLN  RTI+++  EK E+ RY   +R +F++G +E            ++G+ + + +
Sbjct: 296 AEEQLNATRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSL 355

Query: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449
           LL G N++  G ++IG+L++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K 
Sbjct: 356 LLVGTNMIQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKP 415

Query: 450 SVRSNISH-ALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKS 508
            +   I    ++     + F++VSF+YPTRP +QIFK ++ TI+PG +VC VGPSG GKS
Sbjct: 416 LIHPTIGKDPISLAHKPVVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKS 475

Query: 509 TITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSY 568
           TI SLLLR+YD N GSI  D+ D+  F  +  RR +G VQQEP L +GTI DNI Y +  
Sbjct: 476 TIASLLLRYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPS 535

Query: 569 TPTMDEIRVVS--KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKI 626
                E RV    +Q  C  F+  FPDG  T++G RGA LSGGQ+QRIA+ARA +  P +
Sbjct: 536 EIAEREDRVARAIEQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAL 595

Query: 627 LILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVE 686
           LILDEATSALD +SE  +   L   +  + LT ISIAHRLSTI+ S  IIV+G  GSVVE
Sbjct: 596 LILDEATSALDSQSEEIVAKNLQKRVE-RGLTTISIAHRLSTIKHSTRIIVLGKHGSVVE 654

Query: 687 VGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDI 722
            G F  L    +SEL  LL E+ HD   K E T+++
Sbjct: 655 TGSFRDLIAIPDSELNALLAEQ-HDEEGK-EKTANL 688

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  530 bits (1364), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 306/700 (43%), Positives = 422/700 (60%), Gaps = 42/700 (6%)

Query: 21  PRRLNSYLAPAAV-----SIQAPRRYN-VSLLAVIERREVVIYRPKRGYSSLSKTKKDND 74
           P+ L S  A A+      S+  P  Y    +  +I  R+  + R  R  S +++ KK   
Sbjct: 12  PKLLRSQFASASALYSTKSLFKPPMYQKAEINLIIPHRKHFLLRSIRLQSDIAQGKKST- 70

Query: 75  GNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKV 134
              +  LK  N        S G++++ RL  L+K + K + +A+ L+ +S ++ MAVP V
Sbjct: 71  ---KPTLKLSN----ANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSV 123

Query: 135 IGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIF 194
           IG +LD          E   +D EG   +K                 +   +  QF    
Sbjct: 124 IGKLLDLAS-------ESDGEDEEGSKSNK-----------------LYGFTKKQFFTAL 159

Query: 195 AGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSD 254
               ++GA AN  R+++LK+ GERLV+RLR++ +K  +  D  F D N+VGDLISR  SD
Sbjct: 160 GAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSD 219

Query: 255 AYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISA 314
           A +V++S+TQNVSDG +AII G VG GMM  +S  LT VM++ APPL   A IYG+KI  
Sbjct: 220 ASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRN 279

Query: 315 ISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXX 374
           +SRQLQ S G LT+VAEEQLN  RTI+++  EK E+RRY   +R +F++G +E       
Sbjct: 280 LSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLF 339

Query: 375 XXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKG 434
                ++G+ + + +LL G +++  G++++G+L++FM+Y  YTGSS+FGLS+FYSELMKG
Sbjct: 340 FGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKG 399

Query: 435 AGAASRLFELMDHKNSVRSNISH-ALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEP 493
           AGAA+R+FEL D K  +R  I    ++  Q  I F++VSF+YPTRP +QIFK ++ TI+P
Sbjct: 400 AGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKP 459

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
           G +VC VGPSG GKSTI SLLLR+YD N GSI   + DI  F  +  RR +G VQQEP L
Sbjct: 460 GEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLL 519

Query: 554 MSGTIRDNITYGL--SYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQR 611
            +GTI DNI Y +        D IR    +  C  F+  FPDG  T++G RGA LSGGQ+
Sbjct: 520 FNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQK 579

Query: 612 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRR 671
           QRIA+ARA +  P +LILDEATSALD +SE  +   L   +  +  T ISIAHRLSTI+ 
Sbjct: 580 QRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVE-RGFTTISIAHRLSTIKH 638

Query: 672 SENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHD 711
           S  +IV+G  GSVVE G F  L     SEL  LL E+  +
Sbjct: 639 STRVIVLGKHGSVVETGSFRDLIAIPNSELNALLAEQQDE 678

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  526 bits (1354), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 305/674 (45%), Positives = 413/674 (61%), Gaps = 42/674 (6%)

Query: 56  IYRPKRGYSSLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLA 115
           +++  R  SS+   KK    +   L   D D++     S G++++ RL  L++ +   + 
Sbjct: 49  MFQTIRFQSSIIDGKKTASPDSPTLKLSDADSK-----SSGFKDIKRLFVLSRPESGYIG 103

Query: 116 VAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD--LEGVNEDKESLIAGPIA 173
           +A+ L+ +S ++ MAVP VIG +LD   +       K ++D  L G              
Sbjct: 104 LALLLILISSSVSMAVPSVIGKLLDLASDDDDEEDAKETKDNKLYG-------------- 149

Query: 174 SLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMH 233
                      LS  QF        ++GA AN  R+++LK+ GERLV+RLR++ +K  + 
Sbjct: 150 -----------LSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMKAALD 198

Query: 234 HDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSV 293
            D  F D N+VGDLISR  SDA +V++S+TQNVSDG +AII G VG GMM  +S  LT V
Sbjct: 199 QDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCV 258

Query: 294 MLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRY 353
           M++ APPL   A IYG+KI  +SRQLQ S G LT+VAEEQLN  RTI+++  EK E+RRY
Sbjct: 259 MMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRY 318

Query: 354 NDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLY 413
              +R +F+VG +E            ++G+ + + +LL G N++  GA+++G+LT+FM+Y
Sbjct: 319 AKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTSFMMY 378

Query: 414 TEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISH-ALTPTQGKIEFRDVS 472
             YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K  +R  I    ++     I F+DVS
Sbjct: 379 AVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKPIVFKDVS 438

Query: 473 FSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDI 532
           F+YPTRP +QIFK ++ TI+PG +VC VGPSG GKSTI SLLLR+YD + GSI   + DI
Sbjct: 439 FTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDFGDEDI 498

Query: 533 SKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSK--QCFCHGFITK 590
             F  +  RR +G VQQEP L +GTI DNI Y +       E RV     Q  C  F+  
Sbjct: 499 KNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRVARAIGQANCTKFLAN 558

Query: 591 FPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGT 650
           FPDG  T++G RGA LSGGQ+QRIA+ARA +  P +LILDEATSALD +SE  +   L  
Sbjct: 559 FPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAKNLQR 618

Query: 651 LMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE--- 707
            ++ + LT ISIAHRLSTI+ S  +IV+G  GSVVE G F  L     SEL  LL E   
Sbjct: 619 RVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNALLAEQQD 677

Query: 708 ---KDHDLVSKSEN 718
              KD  + SK+ N
Sbjct: 678 DEGKDETVTSKNNN 691

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  522 bits (1345), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 303/693 (43%), Positives = 419/693 (60%), Gaps = 41/693 (5%)

Query: 35  IQAPRRYNVSLLAVIERREVVIYRPKRGYSSLSKTKKDNDGNGRGLLKDDNDTQVQKETS 94
            + P   N+ L  +I  R+  + +  R  SS+S+ K       +  L D N        S
Sbjct: 32  FKPPTYQNMGLTLIIPYRKQFLSQSIRLQSSVSEGKTFTKPTLK--LSDANSK------S 83

Query: 95  VGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLD--ATKNTLKSSYEK 152
            G++++ RL  L+K + K + +A+ L+ +S ++ MAVP VIG +LD  +     +   + 
Sbjct: 84  SGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASETEDEEKEEKA 143

Query: 153 GSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLL 212
            S  L G                         L+  QF        ++GA AN  R+++L
Sbjct: 144 KSNKLYG-------------------------LTKRQFFTALGLVFIIGAVANASRIIIL 178

Query: 213 KIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKA 272
           K+ GERLV+RLR++ +K  +  D  F D N+VGDLISR  SDA +V++S+TQNVSDG +A
Sbjct: 179 KVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRA 238

Query: 273 IICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEE 332
           II G VG GMM  +S  LT VM++ APPL   A IYG+KI  +SRQLQ S G LT+VAEE
Sbjct: 239 IIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEE 298

Query: 333 QLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLY 392
           QLN  RTI+++  EK E+RRY   +R +F++G +E            ++G+ + + +LL 
Sbjct: 299 QLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLV 358

Query: 393 GANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVR 452
           G +++  G++++G+L++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K  +R
Sbjct: 359 GTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIR 418

Query: 453 SNISH-ALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTIT 511
             I    ++  Q  I F++VSF+YPTRP +QIFK ++ TI PG +VC VGPSG GKSTI 
Sbjct: 419 PTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIA 478

Query: 512 SLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPT 571
           SLLLR+YD N GSI   + DI  F  +  RR +G VQQEP L +GTI DNI Y +     
Sbjct: 479 SLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIA 538

Query: 572 MDEIRV--VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629
             E R+     Q  C  F+  FPDG  T +G RGA LSGGQ+QRIA+ARA +  P +LIL
Sbjct: 539 EQEDRIGRAIGQANCTKFLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLIL 598

Query: 630 DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
           DEATSALD +SE  +   L   +  + LT ISIAHRLSTI+ S  ++V+G  GSVVE G 
Sbjct: 599 DEATSALDSQSEEIVAKNLQRRVE-RGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGS 657

Query: 690 FDKLYRNEESELFKLLNEKDHDLVSKSENTSDI 722
           F  L     SEL  LL E+  +   + E T+D+
Sbjct: 658 FQDLIAIPNSELNALLAEQQDE--EQKEGTADL 688

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  523 bits (1346), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 287/645 (44%), Positives = 413/645 (64%), Gaps = 19/645 (2%)

Query: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS 149
           ++  S  W+++ RL  LA+ + + +  A+ L+ +S ++ M VP VIG ++DA K+     
Sbjct: 77  EEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDD---- 132

Query: 150 YEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209
            ++ S+ +E  ++       G          I G L++ QF G+     VVGA AN GR+
Sbjct: 133 -QQASKLVENDSDAAAPDADGR--------QIFG-LTMPQFYGVLFSVFVVGAAANMGRI 182

Query: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
           V+LK+ GE+LV+RLR++ +K ++  D  F D NKVGDLISR  SDA +VS+S+TQN+SDG
Sbjct: 183 VILKVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDG 242

Query: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
            +++I G VG GMM +IS  LT VM+L APPL   A IYGK+I  +SR LQ S G LT+ 
Sbjct: 243 TRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKA 302

Query: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIV 389
           AEEQL+  RTI+++  EK  I +Y   +RQ++ VG +E            ++G+++ + +
Sbjct: 303 AEEQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLAL 362

Query: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449
           LL G +++  GA+++GDL++FM+Y  YTGSS+FG+S+FYSELMKGAGAA+R+FEL D + 
Sbjct: 363 LLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRP 422

Query: 450 SVRSNISHALTPTQGK-IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKS 508
           ++            GK +EF++V F+YPTR  + IF++++F I  G +VCIVGPSG GKS
Sbjct: 423 AIHPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKS 482

Query: 509 TITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSY 568
           T+ SLLLRFYD + G+I I    I+ F  +  RR LGVVQQEP L +GTI DNI Y +  
Sbjct: 483 TVASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQ 542

Query: 569 TPTMDEIRVVSK--QCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKI 626
           +   DE RV     Q  C  F++ FPDG  T++GPRG  LSGGQ+QRIA+ARA +  P +
Sbjct: 543 SLLNDENRVARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDL 602

Query: 627 LILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVE 686
           LILDEATSALD  SE  +   L +   ++  T ISIAHR+STI+ S  +IV+G  G VVE
Sbjct: 603 LILDEATSALDSRSEEVVARALYS-RSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVE 661

Query: 687 VGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDD 731
            G FD+L  + +S+L  LL  K+ +  S+    S +P ++ +   
Sbjct: 662 TGTFDELISDPDSQL-NLLLRKEEEPSSEETTDSHVPENTSQGQQ 705

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  514 bits (1324), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 285/619 (46%), Positives = 386/619 (62%), Gaps = 31/619 (5%)

Query: 96  GWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQ 155
           G ++V RL  LA+ + K L  A+ L+ +S  + M +P VIG +LD  +           +
Sbjct: 81  GAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAR-----------E 129

Query: 156 DLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKII 215
           D+E  + D+E       A L  LP         QF    +G   VGA AN GR+V+LK  
Sbjct: 130 DVEQESGDEEE------AVLYGLPE-------KQFYLALSGIFAVGALANMGRIVVLKTT 176

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
           GERLV+RLR++ +K  +  +  F D N+VGDLISR  SDA +VS+S+TQN SDG +A+I 
Sbjct: 177 GERLVARLRTRTMKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQ 236

Query: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335
           G VG GMM +IS  LT+VM L APPL++ A  YG+++  +SR+LQ   G LT+VAEEQLN
Sbjct: 237 GAVGFGMMSYISWQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLN 296

Query: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
             RT++++  E++EIRRY   +R +F VG +E             +G+ + + +LL G +
Sbjct: 297 ATRTVQAYCGERREIRRYATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTS 356

Query: 396 LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455
           ++  G +S+G+L++FM+Y  YTGSS+F LS+FYSELMKGAGAA R+FEL D K  +   I
Sbjct: 357 MIKGGGISVGELSSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTI 416

Query: 456 SHALTPTQGK-IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLL 514
                   GK I F  V+F+YPTRP +Q+F  M  +I PG +VCIVGPSG GKST+ SLL
Sbjct: 417 GKDPVSLTGKTIAFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLL 476

Query: 515 LRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE 574
           LRFYDP  GSI I   DI  F     RR +G+VQQEP L + +I +NITY L    T D 
Sbjct: 477 LRFYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDP 536

Query: 575 IRV--VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEA 632
            R+    +   C  F+  FP+G  T +GPRG  LSGGQ+QR+A+ARA ++ P ILILDEA
Sbjct: 537 ARIDRALRLSNCSAFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEA 596

Query: 633 TSALDVESEGAINYTLGTLMRSKELTI-ISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
           TSALD +SE  +  TL  L R +E  I ISIAHR STI+ S  +IV+   G V+E G + 
Sbjct: 597 TSALDSKSEDIVASTL--LQRCQEAKITISIAHRKSTIQHSTRVIVLDKLGHVLETGTYQ 654

Query: 692 KLYRNEESELFKLLNEKDH 710
           +L  +  S L  LL+ K+H
Sbjct: 655 QLIGDPGSSLSGLLS-KEH 672

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  501 bits (1289), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 282/642 (43%), Positives = 398/642 (61%), Gaps = 63/642 (9%)

Query: 78  RGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGL 137
           R ++  ++ T+   + +  W +V +L  LAK + K +A A+GL++VS  + M++P VIG 
Sbjct: 12  RPVIHRNSSTKTDLKKTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGT 71

Query: 138 VLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGA 197
           ++D                                ++ DA  PI G L+  QF+      
Sbjct: 72  LIDHA------------------------------STPDA--PIYG-LTRNQFLLALGSV 98

Query: 198 LVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYV 257
            VVGA AN GR+++LKI GE+LV+RLR++ +K  +  D  F D+++VGDLISR  SDA +
Sbjct: 99  FVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLSQDATFLDKHRVGDLISRLSSDASI 158

Query: 258 VSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISR 317
           VS+S+T N+SDG +A + G VG+GMM +IS  LT+VM +  PPL + A +YG KI  ISR
Sbjct: 159 VSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTMMVPPLGILAMLYGGKIKKISR 218

Query: 318 QLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXX 377
           QLQ   G L++ +EEQLN ++T++++  E+KE++RY++ +R +F +G +E          
Sbjct: 219 QLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNEVRSVFNIGVKEAVASALFFGS 278

Query: 378 XXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGA 437
             ++G+++ + +LL G       ++++G+L++FM+Y  YTGSSVFGL+ FYSELMKG GA
Sbjct: 279 TGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVYTGSSVFGLTGFYSELMKGCGA 335

Query: 438 ASRLFELMDHKNSVRSNISHALTPTQG----------KIEFRDVSFSYPTRPSNQIFKHM 487
           A R+ EL + K  +        +PT+G           I F +VSF+Y    S  +   M
Sbjct: 336 AERVLELQNMKTKI--------SPTKGISPPKTLKGLPITFNNVSFAYSNGKS--VLSEM 385

Query: 488 SFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVV 547
           +F I PG +VC VG SG GKSTI+SLLLR+Y    G+I I N+DIS F  +  RR LGVV
Sbjct: 386 NFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLRKYRRMLGVV 445

Query: 548 QQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLS 607
           QQEP L +GTI DNITYGL +  ++ ++ +  K   C  FI +   G DT++GPRGA LS
Sbjct: 446 QQEPLLFNGTILDNITYGL-HDKSLTDLNMALKAANCDQFIKESHMGLDTLVGPRGAQLS 504

Query: 608 GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKE--LTIISIAHR 665
           GGQRQRIA+AR  ++ P ILILDEATSALD +SE  IN     L R +E  +T ISIAHR
Sbjct: 505 GGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINK---ELQRRQEAGMTTISIAHR 561

Query: 666 LSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
           LSTIR S  +IV+  DG VVE G FD+L    +SEL KLL E
Sbjct: 562 LSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLKE 602

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  481 bits (1239), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/627 (43%), Positives = 397/627 (63%), Gaps = 19/627 (3%)

Query: 85  NDTQVQKETSVGWREVLRLCSLAKHD-WKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATK 143
           N T  + +T     ++  L  LAK + W ++A ++GL+ ++  + M VP VIG +LD   
Sbjct: 87  NSTNTKGKTR---EDIYNLFKLAKPEKWYIIA-SMGLIFITSAVSMLVPSVIGKLLD--- 139

Query: 144 NTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGAT 203
             + +  E  S   E     KE        + +    I G   +  F G+     VVGA 
Sbjct: 140 --ISTGIEFASNKDENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGV-IFVVGAI 196

Query: 204 ANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMT 263
           AN GR+++LK+ GER+V+RLR++ +K  +  D +F D NKVGDLISR  SD+ +VS ++T
Sbjct: 197 ANTGRIIILKLTGERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVT 256

Query: 264 QNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSS 323
           +NVSDG +A+I G VG+GMM  IS  L+ VML   PP+ V A IYG+KI  IS++LQ+S 
Sbjct: 257 RNVSDGARAVIQGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESV 316

Query: 324 GNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGD 383
           G+LT+++EEQLNG RTI+S+V EK EI +Y   +R++++VG  E            ++G+
Sbjct: 317 GSLTKISEEQLNGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGN 376

Query: 384 MSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFE 443
            + + +L  G N++  G LSIG L++FM+Y  YTGSS+FGLS+FYSE+MKG+GAASR+FE
Sbjct: 377 GAMLSLLYVGCNMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFE 436

Query: 444 LMDHKNSVRSNISHALTPT--QGK-IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIV 500
           +  +   +  N +  + P   Q K IEF  + F+YPTR  + IF+ ++  I PG +VCI+
Sbjct: 437 INKYVPDI--NATKGIDPISFQDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCII 494

Query: 501 GPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRD 560
           GPSG GKSTI+SLLLR+YDP  G+I I   DI +++ +  R+ +GVV QEP L +GTI +
Sbjct: 495 GPSGSGKSTISSLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILE 554

Query: 561 NITYGLSYTPTMDEIRVVS--KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIAR 618
           NI Y +      D+ R+ +  +   C+ F+   P G +T +GPRG  LSGGQ+QR+A+AR
Sbjct: 555 NILYNVPEEIANDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALAR 614

Query: 619 ALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVV 678
           A + +P +L+LDEATSALD  SE  +  TL     +K  T ISIAHR+STI+ S  ++V+
Sbjct: 615 AFLLEPTLLVLDEATSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVL 673

Query: 679 GNDGSVVEVGKFDKLYRNEESELFKLL 705
              G VVE G +++L   ++S L KLL
Sbjct: 674 DKVGHVVETGPYEELLGIKDSALNKLL 700

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  211 bits (538), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 151/530 (28%), Positives = 260/530 (49%), Gaps = 22/530 (4%)

Query: 193  IFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISR 250
            I  G  +  A  NF +  L     E  + +LR+QV++R    ++++F  +R+K  ++ + 
Sbjct: 738  IVIGVAIADAILNFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSAL 797

Query: 251  FGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGK 310
              +D   +    +  +       +   VG+     I   L+ V +   P +++ + +YG 
Sbjct: 798  LLNDLRDLRALASDFLIAVSSFAVVSSVGIIWALIIGWKLSLVCISMFPLIVIFSAVYGM 857

Query: 311  KISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXX 370
             +     Q + +  +L  +  E   GI+TI+    E   +R+Y      +  +  R    
Sbjct: 858  ALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRAIT 917

Query: 371  XXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSE 430
                      L      I+  Y   LV+ G  +   +   +    +T  +   L +   +
Sbjct: 918  TGLGVAVIEALAMSIQAILFYYALKLVIDGQYTTKKMFETLTLLLFTIMTCNILISQVPD 977

Query: 431  LMKGAGAASRLFELMDHK-------NSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQI 483
            + +G  AA+R+ +++D K          +   S +++ +   I  ++V+F+YP+ PS  I
Sbjct: 978  ISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQNVTFAYPSAPSIHI 1037

Query: 484  FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
            F  +   +  G    +VG SG GKST+ +LL + Y P  G++L++N D++++  + LRR 
Sbjct: 1038 FDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDVNEWNIRDLRRQ 1097

Query: 544  LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
            + VV+Q PT+ SGT+R+N+ YGL + P   E+  V +    H FI+K P G DT I    
Sbjct: 1098 MSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLPLGLDTTIDID- 1156

Query: 604  ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMR---SKELTII 660
              LSGGQ QR+ IARA++K+PKILILDE TSALD  S   IN     ++R      LT I
Sbjct: 1157 -LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVIN----NIVRRGCPAPLT-I 1210

Query: 661  SIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDH 710
            SI H +  ++  + II + N G V   G FD L +++++  F+ L   +H
Sbjct: 1211 SITHNVDMMKACDEIIFLKN-GRVAGTGSFDALLQSDKT--FRALIADEH 1257

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 132/527 (25%), Positives = 254/527 (48%), Gaps = 17/527 (3%)

Query: 214 IIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSR---SMTQNVSDGF 270
           ++GER    +R +++ + + +  E++D+ +  D+   F      V     S  +  +   
Sbjct: 84  LLGERCGFGIRRRLLYKYLENPFEWYDKTE--DICGNFTQQNRCVEEARASCAEASAVIT 141

Query: 271 KAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA 330
           ++++     +G  F+ S +LT V L  AP +++  + + +K+   +    + +   +++ 
Sbjct: 142 RSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLL 201

Query: 331 EEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVL 390
           +  +   + I+    E +EI+ + + ++       +              L    FV   
Sbjct: 202 DWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLSLAMFVQAF 261

Query: 391 LYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS 450
            +G+ ++ +G ++IGD+          GS++ G       + KG+ A + + + +    +
Sbjct: 262 WFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKFLADDKT 321

Query: 451 VRSNISHA----LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKG 506
             ++I           +G I F++V FSYP+RP + + + +S     G    ++G SG G
Sbjct: 322 ATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLLGKSGSG 381

Query: 507 KSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGL 566
           KS++++LLL+FY+   G I +D  +I       L +++ VV+Q   + +GT+++NI  G+
Sbjct: 382 KSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKENIIIGI 441

Query: 567 ---SYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
                   + ++++V +      FI    DG +T+IG  G SLSGGQ+Q++AIARAL+K 
Sbjct: 442 DGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVAIARALMKD 501

Query: 624 PKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGS 683
           P+ILILDE+ SALDV   G I   + T    KE T I + H L+ I  S +   +   G 
Sbjct: 502 PQILILDESLSALDVLQRGLILRAIRT--HRKEKTTIILTHELNQI-GSNDFCYLIESGQ 558

Query: 684 VVEVGKFDKLYRNEESEL--FKLLNEKDHDLVSKSENTSDIPPDSPK 728
            +E G  + L  +  +    +K L++        S+ T    P +PK
Sbjct: 559 CIEHGLEETLVNDPSTRFHSWKHLHDTYDHYDCFSQYTYVETPTTPK 605

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  204 bits (520), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 156/548 (28%), Positives = 261/548 (47%), Gaps = 28/548 (5%)

Query: 180 PIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF 239
           PI  TL++  +     GA++ G   N     +   + +  + ++  Q  +  M  D+ + 
Sbjct: 158 PIAITLTVLSYGAARFGAVLFGEIRN----AVFASVAQNAIRKVSLQTFQHLMRLDLGWH 213

Query: 240 DRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISSTLTSVM 294
              + G L           +YV+S  +   +   F+ +++CG +        ++   + M
Sbjct: 214 LSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPIAFEISVVCGILTYQFGTSFAAVTFATM 273

Query: 295 LLFAPPLLVGAFIYGKKISAISRQLQQSSG----NLTRVAEEQLNGIRTIKSFVAEKKEI 350
           LL++        I+  K +A   + ++S+         VA + L     +K F  E+   
Sbjct: 274 LLYS--------IFTFKTTAWRTEFRRSANRADNKAASVALDSLINFEAVKYFNNERYLA 325

Query: 351 RRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAF 410
            +Y++++        +             ++   +   ++  G   V+ G LS+GDL   
Sbjct: 326 DKYHNSLTNYTNSQIKVAQSLAFLNSGQNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLI 385

Query: 411 MLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQG--KIEF 468
                     +  L + Y EL +       LF+L  +K +++++ +  + P     +I+F
Sbjct: 386 NQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKF 445

Query: 469 RDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILID 528
            +V+F Y   P  +I ++ +FT+  G    IVGPSG GKSTI  L+ RFYDP  G ILID
Sbjct: 446 ENVTFGY--HPDRKILENANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILID 503

Query: 529 NHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFI 588
             DI +   KSLRR +GVV Q+  L + TI +N+ +G   T T D+IR    +      I
Sbjct: 504 GKDIRELDLKSLRRAIGVVPQDTPLFNDTIWENVKFG-KITATDDDIRKAIDKAQLAPLI 562

Query: 589 TKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 648
              P G +T++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  T+
Sbjct: 563 HSLPQGSETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTI 622

Query: 649 GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN-E 707
                    T I IAHRL TI  ++ I+V+ N G V E GK  +L     S   +L N +
Sbjct: 623 KENFAGNSRTSIYIAHRLRTIADADKIVVLEN-GRVKEEGKHAELLSKPTSLYSELWNIQ 681

Query: 708 KDHDLVSK 715
           ++ DL+ +
Sbjct: 682 ENLDLLEE 689

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  198 bits (503), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 157/544 (28%), Positives = 256/544 (47%), Gaps = 28/544 (5%)

Query: 178 LPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIE 237
           LP  +G++ ++     F G+++ G   N     +   +G+  ++R+  Q  +  M  D+ 
Sbjct: 177 LPIAIGSMILSYGAARF-GSVLFGELRN----AIFASVGQSAITRVSLQTFQHLMKLDLG 231

Query: 238 FFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISSTLTS 292
           +    + G L           +YV+S  +   +    +   +CG +        ++   S
Sbjct: 232 WHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPITVEIGAVCGILTYQFGGSFAAMTFS 291

Query: 293 VMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL----TRVAEEQLNGIRTIKSFVAEKK 348
            MLL++        I+  K +A   + ++S+         VA + L     +K F  E+ 
Sbjct: 292 TMLLYS--------IFTFKTTAWRTEFRKSANKADNKAASVAVDSLINFEAVKYFNNEQY 343

Query: 349 EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLT 408
              +Y+ ++ Q      +             ++   +   ++  G   V+ G LS+GDL 
Sbjct: 344 LANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSALTAMMYMGCTGVMSGELSVGDLV 403

Query: 409 AFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQ--GKI 466
                       +  L + Y EL +       LF+L  +K S++++    + P     +I
Sbjct: 404 LINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVSIQNSKKPLMLPPNVPSEI 463

Query: 467 EFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSIL 526
            F++VSF Y   P   I K+ SFTI  GS   IVGPSG GKSTI  L+ RFYDP  G IL
Sbjct: 464 VFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVGPSGSGKSTILKLVFRFYDPIEGRIL 521

Query: 527 IDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHG 586
           +D  D+ +   +SLRR +GVV Q+  L + +I DN+ +G     T  EI     +     
Sbjct: 522 LDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKFG-RIDATDQEIERAIDRAQLRA 580

Query: 587 FITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINY 646
            I + P G DT++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  
Sbjct: 581 LIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLR 640

Query: 647 TLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
           T+     +   T + IAHRL TI  ++ IIV+   G V E GK  +L    +S   +L N
Sbjct: 641 TIKENFTTGSKTSVYIAHRLRTIADADKIIVL-EHGRVKEEGKHAELLATPKSLYAELWN 699

Query: 707 EKDH 710
            +++
Sbjct: 700 VQEN 703

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  197 bits (501), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 152/542 (28%), Positives = 256/542 (47%), Gaps = 27/542 (4%)

Query: 180 PIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF 239
           P+  T++I  +     GA++ G   N     +   + +  + ++  Q  +  M  D+ + 
Sbjct: 171 PVAITMTILSYGAARFGAVMFGELRN----AVFAKVAQNAIRKVSLQTFQHLMKLDLGWH 226

Query: 240 DRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISSTLTSVM 294
              + G L           +YV+S  +   +   F+ +++CG     + +   S+  +  
Sbjct: 227 LSRQTGGLTRAMDRGTKGISYVLSAMVFHMIPITFEISVVCGI----LTYQFGSSFAA-- 280

Query: 295 LLFAPPLLVGAFIYGKKISAISRQLQQSSG----NLTRVAEEQLNGIRTIKSFVAEKKEI 350
           + F   LL   F +  K +A   + ++S+         VA + L     +K F  E+   
Sbjct: 281 MTFVTMLLYSFFTF--KTTAWRTEFRRSANRADNKAASVALDSLINFEAVKYFNNEEYLA 338

Query: 351 RRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAF 410
            +Y+ ++ +      +              +   +   ++  GA+ V++GAL++GDL   
Sbjct: 339 NKYHQSLSKYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYMGASGVMEGALTVGDLVLI 398

Query: 411 MLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQ--GKIEF 468
                     +  L + Y EL +       LF+L  +   +++     + P     +I+F
Sbjct: 399 NQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNPILIKNTERPLMLPEHLPCEIKF 458

Query: 469 RDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILID 528
            +V+F Y  +P   I K+ +FTI PG    IVGPSG GKSTI  L+ RFYDP  G IL+D
Sbjct: 459 ENVTFGY--QPDRNILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLD 516

Query: 529 NHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFI 588
             DI +     LRR +GVV Q+  L + TI +N+ +G     T +EI    ++      I
Sbjct: 517 GKDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKFG-RINATDNEIVTAIEKAQLSDLI 575

Query: 589 TKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 648
            K P G +T++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +E ++  T+
Sbjct: 576 HKLPKGTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTI 635

Query: 649 GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEK 708
                    T + IAHRL TI  ++ IIV+ N G+V E G  + L  N  S   +L N +
Sbjct: 636 KENFSDVAKTSVYIAHRLRTIADADKIIVLEN-GAVREEGTHNALLANPNSLYSELWNIQ 694

Query: 709 DH 710
           ++
Sbjct: 695 EN 696

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  196 bits (498), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 155/553 (28%), Positives = 256/553 (46%), Gaps = 31/553 (5%)

Query: 169 AGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVI 228
           A P A L    PI  T  I  +     G+++ G   N     +   + +  ++R+  Q  
Sbjct: 143 ADPTAVL----PIAVTAMILSYGAARFGSVLFGELRN----AIFASVAQSAITRVSLQTF 194

Query: 229 KRTMHHDIEFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMM 283
           +  M  D+ +    + G L           +YV+S  +   +    +   +CG +     
Sbjct: 195 QHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPITVEIGAVCGILTYQFG 254

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL----TRVAEEQLNGIRT 339
              ++   + MLL++        I+  K +A   + ++S+         VA + L     
Sbjct: 255 ASFAAMTFTTMLLYS--------IFTFKTTAWRTEFRKSANKADNKAATVAVDSLINFEA 306

Query: 340 IKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQ 399
           +K F  E+    +Y++++ Q      +              +   +   ++  G   V+ 
Sbjct: 307 VKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYMGCTGVIS 366

Query: 400 GALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL 459
           G LS+GDL             +  L + Y EL +       LF+L  +K  +++     +
Sbjct: 367 GTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVKIQNKEKPLM 426

Query: 460 TPTQ--GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRF 517
             +Q   KI F +VSF Y   P   I K+ SFT+  G    IVGPSG GKSTI  L+ RF
Sbjct: 427 LSSQRPSKIVFENVSFGY--DPDRMILKNSSFTMPAGWKTAIVGPSGSGKSTILKLVFRF 484

Query: 518 YDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV 577
           YDP  G IL+D  D+ +   +SLRR +GVV Q+  L + +I +N+ +G   + + +EIR+
Sbjct: 485 YDPQEGRILVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIWENVRFG-KISASDEEIRL 543

Query: 578 VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALD 637
             ++      + + P G DT++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD
Sbjct: 544 AVEKAQLESLVDQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALD 603

Query: 638 VESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNE 697
             +E A+  T+     +   T + IAHRL TI  ++ IIV+   G V E GK  +L    
Sbjct: 604 THTEQALLRTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI-QQGQVKEEGKHAELLAKP 662

Query: 698 ESELFKLLNEKDH 710
            S   +L N +++
Sbjct: 663 GSLYAELWNVQEN 675

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  198 bits (504), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 143/520 (27%), Positives = 248/520 (47%), Gaps = 25/520 (4%)

Query: 202  ATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDR--NKVGDLISRFGSDAYVVS 259
            A +NF +  +L    E  +  LR++ ++      +E+F R  NK  ++ +   +D   + 
Sbjct: 762  AVSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLR 821

Query: 260  RSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQL 319
              ++Q +S     +    VG+         L+ V +   P +++ + IYG  +       
Sbjct: 822  SLVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTY 881

Query: 320  QQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXX 379
            +    NL  +  E + G++TIK    +    + Y+    ++  + ++             
Sbjct: 882  KTKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITT 941

Query: 380  ILGDMSFVIVLLYGANLVLQGALSIGDLT---AFMLYTEYTGSSVFGLSTFYSELMKGAG 436
             +      I+  YG  LV+ G  S   +      +L+T  T +S   L +   ++ +G  
Sbjct: 942  AIATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQR 998

Query: 437  AASRLFELMDHKNSVRS-----------NISHALTPTQGKIEFRDVSFSYPTRPSNQIFK 485
            AAS ++ +++     +            +    +  TQ  +   ++ F+YPT     I+ 
Sbjct: 999  AASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYD 1058

Query: 486  HMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLG 545
            ++S  +  G  V IVG SG GKST+  LL + Y      I ID  D++++  ++LRR + 
Sbjct: 1059 NLSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQIS 1118

Query: 546  VVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGAS 605
            VV+Q+P L  GT+R+N+ YGL ++P   +I  + K    + FI   P+G +T +    + 
Sbjct: 1119 VVEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SL 1176

Query: 606  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHR 665
            +SGGQ QR+ IARAL++KPKILILDE TSALD  S   IN  +        L  ISI H 
Sbjct: 1177 ISGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHN 1234

Query: 666  LSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLL 705
               + RS N + V  DG + E G F+KL++   +EL+K++
Sbjct: 1235 -EQMMRSCNTVAVLKDGKICETGPFNKLFK-PGNELYKVV 1272

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 176/694 (25%), Positives = 309/694 (44%), Gaps = 61/694 (8%)

Query: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVI-GLVLDATKNTLKS 148
           +K+ SV W+E + +    K DW L+A  + L +++  +  AV  ++ G V D  K+    
Sbjct: 3   KKKVSV-WKENIYMYVQFKRDWLLIATMV-LTTIANGLVPAVTSILTGKVFDLLKDFADP 60

Query: 149 SYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGR 208
           +  K       +     SL+A    +     P++ T SI+ ++             +FG 
Sbjct: 61  NIPKDHNLYHQLVLRSMSLMALAACAF----PLIWT-SISTWM-------------SFGE 102

Query: 209 VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDR--NKVGDL------ISRFGSDAYVVSR 260
                  G+    R R  ++   +   +E++D+  N  GD       +    + +   S 
Sbjct: 103 -------GQGFTVRYR--MLNSYLDKSMEWYDKKENLSGDFTQLNRCVEELRASSAEASA 153

Query: 261 SMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQ 320
              QN+S     I       G+ F+ S +LT ++L   P L++ AFI+ + I   +    
Sbjct: 154 ITLQNISSMLSLI-------GVSFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALEN 206

Query: 321 QSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXI 380
             SG    +    +N  + IK    + KEI  + +   +      +              
Sbjct: 207 TESGLAADLLAWSMNSAQMIKLSCTQLKEIESFEELTLKCNDYFIKLSLYVAANISTLRF 266

Query: 381 LGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASR 440
           L    FV    +G   + +G L+I D+          GS++     +   L KG  A  +
Sbjct: 267 LSLAMFVQGFWFGNTEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRK 326

Query: 441 LFELM-DHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCI 499
           +   + D+K  +  +    +  ++  I FR VSFSYP+RP++ +   +S     G    I
Sbjct: 327 IQSFLNDNKVEIDESALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFI 386

Query: 500 VGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIR 559
           VG SG GKST+++LLL+ YD   G I I +  I +   + L +++ VV+Q  TL + T+ 
Sbjct: 387 VGRSGSGKSTLSNLLLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLV 446

Query: 560 DNITYG-----LSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRI 614
           +NI  G      S      +++   K       I    +G DT++G  G SLSGGQ+QR+
Sbjct: 447 NNILLGSQDEDKSSPVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRV 506

Query: 615 AIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSEN 674
           A+ARA ++  ++LILDEA SALD+     +   + T  R    TII + H LS I   + 
Sbjct: 507 ALARAYMRDTEVLILDEAVSALDIVHREQLMSNI-TKWRQGRTTII-LTHELSQISIQDY 564

Query: 675 IIVVGNDGSVVEVGKFDKLYRNEESELFKL-LNEKDHDLVSKSENTSDIPPDSPKNDDAS 733
           + VV  +G ++E G   +L  + +S   ++ + +  HD   K EN       + +++  S
Sbjct: 565 LYVV-EEGRIIESGFQGQLMYDPDSAFCRMNILQNVHD---KYENNDRFSSVTLEDEMHS 620

Query: 734 GLEHLVAEDVASI---NDKVVKNVLNDITHDKNS 764
            L+ +  +D+ +     ++++KN+   I  D  S
Sbjct: 621 ALDWVYKDDLITPITGENQILKNIDKYIIKDNFS 654

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  198 bits (503), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 156/535 (29%), Positives = 255/535 (47%), Gaps = 35/535 (6%)

Query: 198  LVVGATA-----NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISR 250
            +V+G  A     NF +  LL    E  +  LR++++ +    +I +F  + NK  ++ + 
Sbjct: 766  IVLGVAAADGFFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITAL 825

Query: 251  FGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGK 310
              +D   +   +++ +S     +    +G+         L+ V +   P +++ + IYG 
Sbjct: 826  VLNDLRDLRSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGG 885

Query: 311  KISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXX 370
             +       + S   L     + +  I+TIK   AE      Y+D  +++  +  +    
Sbjct: 886  ILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIA 945

Query: 371  XXXXXXXXXILGDMSFVIVLLYGANLVLQGALS---IGDLTAFMLYTEYTGSSVFGLSTF 427
                     ++      I+  YG  LVL    +   + +    +L+T  + +S+ G    
Sbjct: 946  TGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ--- 1002

Query: 428  YSELMKGAGAASRLFELMDHKN---SVRSNISHALTPTQGK---------IEFRDVSFSY 475
              ++ +G  AAS ++ ++D +     + +N + AL  +  +         I  R++SF+Y
Sbjct: 1003 IPDISRGQRAASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIPIISIRNLSFAY 1062

Query: 476  PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKF 535
            P+ P+  IFKHM   +     + IVG SG GKST+  LL R Y+    SI+ID  D++ +
Sbjct: 1063 PSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDW 1122

Query: 536  TTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGY 595
               SLR+ + VV+Q+P+   G+IRDN+TYG        EI  V K    + F+   P G 
Sbjct: 1123 NLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGL 1182

Query: 596  DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK 655
            DT +      LSGGQ QR+ IARAL++K KILILDE TSALD  S   IN     ++R  
Sbjct: 1183 DTRVDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVRKG 1236

Query: 656  E--LTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEK 708
               L  + I H    + R  N I V   G VVE G FD LY N+E ELF+++  K
Sbjct: 1237 PPGLLTLVITHS-EQMMRCCNSIAVLKHGKVVEEGNFDNLY-NKEGELFRIVCNK 1289

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 138/497 (27%), Positives = 236/497 (47%), Gaps = 33/497 (6%)

Query: 215 IGERLVSRLRSQVIKRTMHHD-IEFFDRNK--VGDL------ISRFGSDAYVVSRSMTQN 265
           IGER   R+R+Q+++  +    + ++D N+  +GD       +    S +   S    QN
Sbjct: 100 IGERQGFRVRAQLLEAYLETKPMGWYDANETLLGDFTQVNRCVEELRSSSAEASAITFQN 159

Query: 266 VSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGN 325
           +       IC  +G    F+ S +LT ++L  +P + + A I+ + I   +++    + N
Sbjct: 160 L-----VAICALIGTS--FYYSWSLTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSN 212

Query: 326 LTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMS 385
             ++    +N  + ++ +  +  E +++ + I        +              L    
Sbjct: 213 AAQLFTWSMNAAQLVRLYCTQPLERQKFQEIILSCNTFFIKSCLYVAANAGILRFLTLTM 272

Query: 386 FVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM 445
           FV    +G+ ++ +G L+I D+          GS++         L KG  A  ++  L+
Sbjct: 273 FVQGFWFGSTMIRKGKLNINDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALL 332

Query: 446 D-----HKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIV 500
           +     + ++ R ++   L      + F +VSF+YP+RPS  + ++++     G    IV
Sbjct: 333 ESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIV 392

Query: 501 GPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRD 560
           G SG GKSTI++LLL FYD   GSILI+  +      K L  ++ VV+Q  TL + T++ 
Sbjct: 393 GKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKK 452

Query: 561 NI------TYGLSYTPTMDEIRVVSKQC---FCHGFITKFPDGYDTVIGPRGASLSGGQR 611
           NI      + G + T T+    ++   C        I   PDG +T+IG  G SLSGGQ+
Sbjct: 453 NILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQ 512

Query: 612 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRR 671
           QR+AIARA I+   IL LDEA SALD+     +   +    + K  T I + H LS I  
Sbjct: 513 QRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQIES 570

Query: 672 SENIIVVGNDGSVVEVG 688
            +++ V+  +G VVE G
Sbjct: 571 DDHLYVM-QEGRVVESG 586

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  197 bits (502), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 153/531 (28%), Positives = 258/531 (48%), Gaps = 21/531 (3%)

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFDRNK--VGDLISRFGSDAYVVSRSMTQNVSDGFKA 272
           +GER    +R +++   +   +E++D +   +GD  ++       +  S  +  +  F+ 
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCHDKLLGDF-TQVNRCVEELRSSSAEASAITFQN 158

Query: 273 IICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEE 332
            +     +G  F+ S +LT ++L  AP +++ A ++   I   +      +G   ++   
Sbjct: 159 FVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNW 218

Query: 333 QLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLY 392
            +N  + +K +  +  EI  + + + Q   +  +              L    FV    +
Sbjct: 219 SMNSAQLVKLYCTQAYEIHSFKELVGQCNDLFIKSCFYVSANTSILRFLSLSMFVQGFWF 278

Query: 393 GANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN--- 449
           GA +V +G LSI D+          GS++         L KG  A  ++ + +       
Sbjct: 279 GAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISFSQRSP 338

Query: 450 SVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKST 509
           S+      ++  + G+I F+++SF+YPTRP   + K +S T +PG +  I+G SG GKST
Sbjct: 339 SLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSGSGKST 398

Query: 510 ITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569
           + +LLL+FY+   GSI I N ++ K     L  ++ VV+Q  TL + T+R+N+  G+S +
Sbjct: 399 LANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLLLGISNS 458

Query: 570 PT---MDEIRVVSK---QC---FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARAL 620
                 D+I +  +    C        I + PDG DT+IG  G SLSGGQ+QR+AIARA 
Sbjct: 459 NQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRVAIARAY 518

Query: 621 IKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGN 680
           IK   +LILDEA SALD+     I   +    RS + TII + H LS +   ++ + V  
Sbjct: 519 IKDSSVLILDEAVSALDIIHRELIMKAIKN-WRSGKTTII-LTHDLSQLDY-DDFLYVFE 575

Query: 681 DGSVVEVGKFDKLYRNEESELFKL--LNEKDHDLVSKSENT-SDIPPDSPK 728
           DG V E G    L ++E++   KL  +  + H   S SE+T  + P D  K
Sbjct: 576 DGEVKESGYQQALLQDEKTIFSKLYDIQMRKHMSYSPSESTIVETPGDEKK 626

 Score =  181 bits (460), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 164/572 (28%), Positives = 266/572 (46%), Gaps = 35/572 (6%)

Query: 166  SLIAG---PIAS------LDALPPIVG-----TLSITQFVGIFAGALVVGATANFGRVVL 211
            SLIAG   PI S      L+ + P+        L + ++  I  G     A +NF +  +
Sbjct: 729  SLIAGATNPIFSYCFSYLLNGIVPMTNGQYRSQLYLLKWSFIVLGISAADAISNFLKSYI 788

Query: 212  LKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
            L    E  +  LR++ +   M+  +++F  + NK  +L +   +D   +   +++ +S  
Sbjct: 789  LGYCSELWIMDLRNEAMAAIMNKRLDWFSKEENKSSELSALLLNDLRDLRSLVSEFLSAM 848

Query: 270  FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
               I+   VG+         L+ V +   P +++ + IYG  +       + +   L   
Sbjct: 849  TTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYKTAVAELENH 908

Query: 330  AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIV 389
              E +  I+TI+   A K  I+ Y      L  +  +              +      I+
Sbjct: 909  EYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNTIAVCIQSIL 968

Query: 390  LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMD--- 446
              YG  LV +G  S   +        +T  S   L +   ++ +G  AAS L+ ++D   
Sbjct: 969  YYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASWLYRILDESD 1028

Query: 447  -HKNSVRSNISHALTPTQGK------IEFRDVSFSYPTRPSNQIFKHMSFTIEPGS-NVC 498
             +K SV S    A     G       I  +++ FSYP+  + +I+K+++  +      + 
Sbjct: 1029 DNKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLHVTSSQKTIG 1088

Query: 499  IVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTI 558
            IVG SG GKST+  LL + Y     SI ID  D++++ T  LR+ + VV+Q PTL  GT+
Sbjct: 1089 IVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNPTLFEGTV 1148

Query: 559  RDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIAR 618
            RDN+ YG     +  EI  V K    + FI   P G D+ I  +   +SGGQ QR+ IAR
Sbjct: 1149 RDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSGGQAQRLCIAR 1206

Query: 619  ALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLS-TIRRSENIIV 677
            AL++KP ILILDE TSALD  S   IN     L+++   T+++I    S  +  + N + 
Sbjct: 1207 ALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSKQMMEACNSLA 1262

Query: 678  VGNDGSVVEVGKFDKLYRNEESELFKLLNEKD 709
            V  DG + E G F +L +N  SEL +++NE D
Sbjct: 1263 VIKDGRLAEQGNFAELMKN-NSELRRIINELD 1293

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  193 bits (490), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 159/550 (28%), Positives = 254/550 (46%), Gaps = 35/550 (6%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATAN--FGRVVLLKIIGERLVSRLRSQVIKRTMHH 234
           ALP  +G   +   V  F G+++ G   N  F RV       +  +  +  Q  +  M  
Sbjct: 149 ALPAAIGLTILCYGVARF-GSVLFGELRNAVFARV------AQNAIRTVSLQTFQHLMKL 201

Query: 235 DIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSD----GFK-AIICGGVGMGMMFHISST 289
           D+ +    + G L          +S+ +T  V       F+ +++CG +        ++ 
Sbjct: 202 DLGWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAI 261

Query: 290 LTSVMLLFAPPLLVGAFIYGKKISA----ISRQLQQSSGNLTRVAEEQLNGIRTIKSFVA 345
             S MLL++        ++  K +A      R   ++      VA + L     +K F  
Sbjct: 262 TFSTMLLYS--------MFTIKTTAWRTKFRRDANKADNKAASVALDSLINFEAVKYFNN 313

Query: 346 EKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIG 405
           EK    +YN ++        +             ++   +   ++  G   V+ G L++G
Sbjct: 314 EKYLSDKYNSSLISYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVG 373

Query: 406 DLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQ-- 463
           DL             +  L + Y +L +       LF+L  ++  +++     + P    
Sbjct: 374 DLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVP 433

Query: 464 GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYG 523
             I F +V+F Y   P  +I K+ SFTI  G    IVG SG GKSTI  L+ RFYDP  G
Sbjct: 434 YDITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESG 491

Query: 524 SILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCF 583
            ILI+  DI ++   +LR+ +GVV Q+  L + TI +N+ +G     T +E+  V ++  
Sbjct: 492 RILINGRDIREYDINALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQ 550

Query: 584 CHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 643
               I K P G+DT++G RG  +SGG++QR+AIAR L+K  KI+  DEATSALD  +E A
Sbjct: 551 LAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQA 610

Query: 644 INYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEES---E 700
           +  T+ +   S   T + IAHRL TI  ++ IIV+ N G V E GK  +L     S   E
Sbjct: 611 LLRTIRSNFTSGSRTSVYIAHRLRTIADADKIIVLDN-GRVREEGKHLELLATPNSLYRE 669

Query: 701 LFKLLNEKDH 710
           L+ +  + DH
Sbjct: 670 LWTIQEDLDH 679

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  193 bits (490), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 156/548 (28%), Positives = 255/548 (46%), Gaps = 31/548 (5%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDI 236
           ALP  +G   I+  V  F G+++ G   N     +   + +  +  +  Q  +  M  D+
Sbjct: 150 ALPAAIGLTIISYGVARF-GSVLFGELRN----AVFAKVAQNAIRTVSLQTFQHLMKLDL 204

Query: 237 EFFDRNKVGDLISRFGSDAYVVSRSMTQNVSD----GFK-AIICGGVGMGMMFHISSTLT 291
            +    + G L          +S+ +T  V       F+ +++CG +        ++   
Sbjct: 205 GWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITF 264

Query: 292 SVMLLFAPPLLVGAFIYGKKISA----ISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEK 347
           S MLL++        I+  K +A      R   ++      VA + L     +K F  EK
Sbjct: 265 STMLLYS--------IFTIKTTAWRTHFRRDANRADNKAASVALDSLINFEAVKYFNNEK 316

Query: 348 KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDL 407
               +YN ++        +             ++   +   ++  G   V+ G L++GDL
Sbjct: 317 YLSSKYNSSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGDLTVGDL 376

Query: 408 TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQ--GK 465
                        +  L + Y +L +       LF+L  ++  ++S     + P     +
Sbjct: 377 VLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIKSVERPLMLPEHVPYE 436

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           I F +V+F Y   P  +I K+ SFTI  G    IVG SG GKSTI  L+ RFYDP  G I
Sbjct: 437 ITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRI 494

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCH 585
           LI+  DI ++   +LRR +GVV Q+  L + TI +N+ +G     T +E++   ++    
Sbjct: 495 LINGRDIKEYDIDALRRVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVKTAVQKAQLA 553

Query: 586 GFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAIN 645
             I K P G++T++G RG  +SGG++QR+AIAR L+K  +I+  DEATSALD  +E A+ 
Sbjct: 554 PLIKKLPQGFETIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALL 613

Query: 646 YTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEES---ELF 702
            T+ +   S   T + IAHRL TI  ++ IIV+ N G+V E GK  +L     S   EL+
Sbjct: 614 RTIRSNFPSGSRTSVYIAHRLRTIADADKIIVLDN-GTVKEDGKHIELLATPGSLYRELW 672

Query: 703 KLLNEKDH 710
            +  +  H
Sbjct: 673 TIQEDLSH 680

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  196 bits (498), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 155/530 (29%), Positives = 255/530 (48%), Gaps = 25/530 (4%)

Query: 198  LVVGATA-----NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISR 250
            LV+G  A     NF +  LL    E  V  LR++V+++    ++++F  + NK  ++ + 
Sbjct: 765  LVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISAL 824

Query: 251  FGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGK 310
              +D   +   +++ +S     +    +G+         L+ V +   P +++ + IYG 
Sbjct: 825  VLNDLRDLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGG 884

Query: 311  KISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXX 370
             +       + S   L     + +  I+TIK   AE      Y+D   ++  +  +    
Sbjct: 885  ILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIA 944

Query: 371  XXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSE 430
                     ++      I+  YG  LV+    +  ++        +T  S   L +   +
Sbjct: 945  TGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPD 1004

Query: 431  LMKGAGAASRLFELMDHK-NSVRSNISHALT------PTQGK-----IEFRDVSFSYPTR 478
            + +G  AAS ++ ++D K N++    ++A T         GK     +  ++++F+YP+ 
Sbjct: 1005 ISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSA 1064

Query: 479  PSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTK 538
            P+  ++K+M+F +  G  + I+G SG GKST+  LL + Y+   G I ID  D++ +   
Sbjct: 1065 PTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLT 1124

Query: 539  SLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTV 598
            SLR+ + VV+Q+P L +GTIRDN+TYGL       E+    K    H F+   P G DT 
Sbjct: 1125 SLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTR 1184

Query: 599  IGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELT 658
            I      LSGGQ QR+ IARAL++K KILILDE TSALD  S   IN  +        L 
Sbjct: 1185 IDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKK--GPPALL 1240

Query: 659  IISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEK 708
             + I H    + RS N I V  DG VVE G FD LY N   ELF++++ +
Sbjct: 1241 TMVITHS-EQMMRSCNSIAVLKDGKVVERGNFDTLY-NNRGELFQIVSNQ 1288

 Score =  191 bits (486), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 141/496 (28%), Positives = 236/496 (47%), Gaps = 21/496 (4%)

Query: 215 IGERLVSRLRSQVIKRTMHHD-IEFFDRNK--VGDLISRFGSDAYVVSRSMTQNVSDGFK 271
           IGER   R+RSQ+++  +    +E++D N+  +GD  ++       +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 272 AIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAE 331
            ++     +G  F+ S +LT ++L  +P +   A ++ + I   S +    +    ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 332 EQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLL 391
             +N  + ++ +  ++ E +++ + I        +              L    FV    
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLTMFVQGFW 277

Query: 392 YGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM---DHK 448
           +G+ ++ +G L+I D+          GS++         L KG  A  ++  L+     +
Sbjct: 278 FGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKR 337

Query: 449 NSVRSNISHA--LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKG 506
           N +   ++H   L      + F +VSFSYP+RPS  + K++S     G    IVG SG G
Sbjct: 338 NPLNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSG 397

Query: 507 KSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYG- 565
           KST+++LLLRFYD   GSI I+ H+I     K L  ++ VV+Q  TL + T+R NI  G 
Sbjct: 398 KSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGS 457

Query: 566 --------LSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIA 617
                    S       I+   +      FI   PDG +T+IG  G +LSGGQ+QR+AIA
Sbjct: 458 TDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIA 517

Query: 618 RALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIV 677
           RA I+   IL LDEA SALD+     +   +    + K  T I + H LS I  S++ + 
Sbjct: 518 RAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQI-ESDDYLY 574

Query: 678 VGNDGSVVEVGKFDKL 693
           +  +G VVE G   +L
Sbjct: 575 LMKEGEVVESGTQSEL 590

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  194 bits (493), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 149/563 (26%), Positives = 271/563 (48%), Gaps = 35/563 (6%)

Query: 169  AGPIAS------LDALPPIVGTLS----ITQFVGIFAGALVVGATANFGRVVLLKIIGER 218
            A P+ S      L+ + P+ GT+     + ++  I     ++ A   F +  ++    E 
Sbjct: 721  ANPVFSYSFSYLLNGIIPVHGTVGSSFYLLKWSLIVLSVAIIDAFCTFSKTFIMGYCSEY 780

Query: 219  LVSRLRSQVIKRTMHHDIEFFD--RNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276
             +  LR +V++   ++  E+F    NK  ++ +   +D   +   +T+ ++     ++  
Sbjct: 781  WIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTLVTEFLATASTFLVVS 840

Query: 277  GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336
              G+         L+ V +   P ++V + +YG  +       + +   L     E +  
Sbjct: 841  TCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYKSAVAQLENCLYEVVVS 900

Query: 337  IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
            ++TI+    +     RY+   +++  +G+R              L      I+  YG  L
Sbjct: 901  MKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTLCIQAILYYYGIKL 960

Query: 397  VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRS--- 453
            V+ G  +   +        +T  +   L     E+ +G  AA+ ++ ++    + R    
Sbjct: 961  VIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATYIYRILKEAAATREHQD 1020

Query: 454  --NISHALTPTQGK---IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKS 508
              N +  ++ T  K   +  +D++F+YP  PS  +++H++  ++  ++V +VG SG GKS
Sbjct: 1021 MHNRTLPISNTSEKDTMVLVKDLTFAYPATPSKHVYEHLNLNLKSDTSVALVGESGSGKS 1080

Query: 509  TITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSY 568
            TI SLL + YD     I +D  D+S++ T SLR  + VV+Q   L++GTIR+N+TYGL  
Sbjct: 1081 TIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSANLLNGTIRENLTYGL-- 1138

Query: 569  TPTMDEIRV----VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624
             P  D   V    + K    + F+++ P+G DT++      LSGGQ QR+ IARAL+K  
Sbjct: 1139 -PEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQAQRLCIARALVKPH 1195

Query: 625  KILILDEATSALDVESEGAINYTLGTLMRSKELT-IISIAHRLSTIRRSENIIVVGNDGS 683
            +ILILDE TSALD  S    N  +  + +    T II+I H    +R  E+++++ N G+
Sbjct: 1196 RILILDECTSALDALST---NIIIDIVRKGIPNTLIIAITHDEHMMRSCESVLLLKN-GA 1251

Query: 684  VVEVGKFDKLYRNEESELFKLLN 706
            +VE G F +L + ++SE  K LN
Sbjct: 1252 IVEQGSFVELMQ-QDSEFKKCLN 1273

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 131/439 (29%), Positives = 214/439 (48%), Gaps = 29/439 (6%)

Query: 280 MGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN-GIR 338
           +G  F+ S +LT +++L + P++    IY  K++     L+      T  A E L   +R
Sbjct: 155 IGTSFYYSWSLT-LIILCSTPIITAIAIYFAKLTNKYTDLENKE---TSYAAELLTWSMR 210

Query: 339 ---TIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
               +K + A+ +EI +++ ++ +   +  +              L    FV    +GA 
Sbjct: 211 FNDMVKFYTAQNEEISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGAT 270

Query: 396 LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRL--FELMDHKNSVRS 453
           ++ +  L I D+          G++V    +  + + KG  A  +L  F  ++ K  +++
Sbjct: 271 MIRRNKLDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQA 330

Query: 454 NISHALTPTQGK---IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTI 510
            +     P +G    I F ++SF YP R SN   +++S  +E G    I+G SG GKST+
Sbjct: 331 ALK---CPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTL 387

Query: 511 TSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYG---LS 567
             LLLRFY+   GSI +DN  I     + L  ++ VV+Q  TL + T+R+NI  G    S
Sbjct: 388 AKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQS 447

Query: 568 YTPTMDEI----RVVSKQC---FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARAL 620
               M+ I    R + K C     +  +    DG DTVIG  G  LSGGQRQR+A+ARA 
Sbjct: 448 EPARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAF 507

Query: 621 IKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGN 680
           ++   I+I DE+ SALDV     +   + +  + K  T I + H LS I  ++ I ++ +
Sbjct: 508 LRNTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH 565

Query: 681 DGSVVEVGKFDKLYRNEES 699
            G V E G  + L ++E S
Sbjct: 566 -GRVCEYGYQEDLLKSETS 583

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  193 bits (491), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 153/533 (28%), Positives = 252/533 (47%), Gaps = 26/533 (4%)

Query: 187  ITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKV 244
            + ++ GI     V+ +T  F +   L    E  +  LR   I++    D+ +F  D NK 
Sbjct: 789  LIKWSGIVLFIAVLDSTFTFLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKS 848

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
             ++ +   +D   +   +++ +S     II   VG+   F     L+ V +   P  ++ 
Sbjct: 849  SEISALVLNDLRDLRSLVSEFLSSISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFILF 908

Query: 305  AFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364
            +  YG  +       +     L     E   GI TI+    E + + +Y +  +++    
Sbjct: 909  SCFYGGLLQRYETDYKTKVAELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRAS 968

Query: 365  KREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALS---IGDLTAFMLYTEYTGSSV 421
            K+              L      I+  YG  LV  G+ S   + +    +L+T  T  S+
Sbjct: 969  KKRAITIGFGVAASNTLTLAVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSL 1028

Query: 422  FGLSTFYSELMKGAGAASRLFELMDHKNSV----RSNISHALTPTQGKIEFRDVSFSYPT 477
             G      ++ +G  AA+ +F ++D+++      +  I+         I  +++SFSYP+
Sbjct: 1029 IGQ---IPDISRGQRAATYIFRIIDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPS 1085

Query: 478  RPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTT 537
             PS  I+K +   +  G  + +VG SG GKST+T L+   Y+   GSI ID  DI+++ T
Sbjct: 1086 APSTAIYKGLKLDVFSGETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDT 1145

Query: 538  KSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFC--HGFITKFPDGY 595
              LR  + VV+Q+P    GT+ +N+ YG+S   T  +I+V    C      F+   P+G 
Sbjct: 1146 NKLRTIISVVEQKPQFFDGTVGENLLYGISGRVT--QIQVKEALCLAGVQDFVFSLPEGL 1203

Query: 596  DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK 655
            DT I    + +SGGQ QR++IARA+++KPKIL LDE TSALD  +  AI      L++  
Sbjct: 1204 DTRIDT--SLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKH 1257

Query: 656  --ELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
               +T I I H    +R  E I V+ N G V E G FD LY  +  E F+++N
Sbjct: 1258 FCGITTIVITHNEQMMRACERIAVLQN-GKVAEDGSFDDLYA-QRGEFFRIMN 1308

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 147/580 (25%), Positives = 256/580 (44%), Gaps = 36/580 (6%)

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFDRN--------KVGDLISRFGSDAYVVSRSMTQNV 266
           +GE+   R+R +++   +   + ++D++        ++   +    S     S    QNV
Sbjct: 104 LGEKQGLRVRRKLLNTYLDKPLTWYDKSEQASGEFTQLNRCVEELRSSCAESSAITFQNV 163

Query: 267 SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL 326
              F   I         F+ S +LT V++   P ++V + I  K I   +R     S   
Sbjct: 164 VTVFALTITS-------FYYSWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRA 216

Query: 327 TRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSF 386
            ++     +    I+ F  ++ EI ++  ++++      R                   F
Sbjct: 217 AQMVSWSFDAAEMIRLFCTQQFEIEKFELSVKKCTKYFIRISLFSSASYAMLRFFTLCMF 276

Query: 387 VIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLF---- 442
           +    +G  ++ QG L+ GD+          G+++         + KG  A  ++     
Sbjct: 277 IQGFWFGNKMIRQGVLTTGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTS 336

Query: 443 ---ELMDHKNSVRSN------ISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEP 493
              +  DH+N + S+      I+       G+I F++VSFSYPTRP+  + K++S     
Sbjct: 337 EENDFPDHRNEIISDAFILNHINANKFRCGGEISFKNVSFSYPTRPNYHVLKNVSLNFPK 396

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
                IVG SG GKSTI  LLL+ Y    G+I +D  DI    T  L  ++ +V+Q  TL
Sbjct: 397 NKTTFIVGKSGSGKSTIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTL 456

Query: 554 MSGTIRDNITYGLSYTPTMDE-IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQ 612
            + TI++NI  G       D  +R   +       I   P+G DTV+G  G SLSGGQ+Q
Sbjct: 457 FNDTIKNNILLGCKGKAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQ 516

Query: 613 RIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRS 672
           R+A+ARA ++   ILILDEA S +D+     +   +      K +T + + H L+ I   
Sbjct: 517 RVALARARVRDSPILILDEAISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQI-SD 573

Query: 673 ENIIVVGNDGSVVEVGKFDKLYRNEESELFKL--LNEKDHDLVSKSENTSDIP--PDSPK 728
           E+ +    +G + E G    L +NE S   +L  L +       +S +TS++   P++ +
Sbjct: 574 EDYLYFMEEGQIRESGFKCNLEKNENSHFNRLWRLQKAKTGFSRRSVSTSNLEKFPENAE 633

Query: 729 NDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNSSTLR 768
             + + L+    +   SI +K +  +   I     SS++R
Sbjct: 634 VVNETKLDPCTHQGRISIIEKHMSLLTPGINFFPTSSSIR 673

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 152/526 (28%), Positives = 247/526 (46%), Gaps = 32/526 (6%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATAN--FGRVVLLKIIGERLVSRLRSQVIKRTMHH 234
           ALP  +G L+I  +     G+++ G   N  F RV       +  +  +  Q  +  M  
Sbjct: 152 ALPAAIG-LTILCYGTARFGSVLFGELRNAVFARV------AQNAIRTVSLQTFRHLMKL 204

Query: 235 DIEFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISST 289
           D+ +    + G L           +YV++  +   +   F+ +++CG +        ++ 
Sbjct: 205 DLGWHLSRQTGGLTRAMDRGTKGISYVLTAMVFHIIPISFEISVVCGILTYQFGASFAAI 264

Query: 290 LTSVMLLFAPPLLVGAFIYGKKISA----ISRQLQQSSGNLTRVAEEQLNGIRTIKSFVA 345
             S MLL++        ++  K +A      R   ++      VA + L     +K F  
Sbjct: 265 TFSTMLLYS--------MFTIKTTAWRTNFRRDANRADNKAASVALDSLINFEAVKYFNN 316

Query: 346 EKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIG 405
           EK    +YN ++        +             ++   +   ++  G   V+ G L++G
Sbjct: 317 EKYLADKYNGSLINYRDSQIKVSQSLAFLNSGQNLIFTSALTAMMYMGCTGVIGGDLTVG 376

Query: 406 DLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQ-- 463
           DL             +  L + Y EL +       LF+L  ++  +++     + P    
Sbjct: 377 DLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFKLRKNEIKIKNAERPLMLPEHVP 436

Query: 464 GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYG 523
             I F++V+F Y   P  +I K+ SFTI  GS   IVG SG GKSTI  L+ RFYDP  G
Sbjct: 437 YDITFQNVTFGY--HPDRKILKNASFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESG 494

Query: 524 SILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCF 583
            ILI+  DI ++   +LR+ +GVV Q+  L + TI +N+ +G     T +E+  V ++  
Sbjct: 495 RILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVNTVVEKAQ 553

Query: 584 CHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 643
               I K P G++T++G RG  +SGG++QR+AIAR L+K  +I+  DEATSALD  +E A
Sbjct: 554 LAPLIKKLPQGFNTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQA 613

Query: 644 INYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
           +  T+ +   S   T + IAHRL TI  ++ IIV  N G V E GK
Sbjct: 614 LLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVFDN-GKVREEGK 658

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  189 bits (481), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 156/548 (28%), Positives = 252/548 (45%), Gaps = 31/548 (5%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDI 236
           ALP  +G   +   V  F G+++ G   N     +   + +  +  +  Q  +  M  D+
Sbjct: 149 ALPAAIGLTILCYGVARF-GSVLFGELRN----AVFAKVAQNAIRTVSLQTFQHLMKLDL 203

Query: 237 EFFDRNKVGDLISRFGSDAYVVSRSMTQNVSD----GFK-AIICGGVGMGMMFHISSTLT 291
            +    + G L          +S+ +T  V       F+ +++CG +        ++   
Sbjct: 204 GWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITF 263

Query: 292 SVMLLFAPPLLVGAFIYGKKISA----ISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEK 347
           S MLL++        I+  K +A      R   ++      VA + L     +K F  EK
Sbjct: 264 STMLLYS--------IFTIKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEK 315

Query: 348 KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDL 407
               +YN ++        +             ++   +   ++  G   V+ G L++GDL
Sbjct: 316 YLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDL 375

Query: 408 TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQ--GK 465
                        +  L + Y +L +       LF+L  ++  +++     + P      
Sbjct: 376 VLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYD 435

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           I F +V+F Y   P  +I K+ SFTI  G    IVG SG GKSTI  L+ RFYDP  G I
Sbjct: 436 ITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRI 493

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCH 585
           LI+  DI ++   +LR+ +GVV Q+  L + TI +N+ +G     T +E+  V ++    
Sbjct: 494 LINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVITVVEKAQLA 552

Query: 586 GFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAIN 645
             I K P G+DT++G RG  +SGG++QR+AIAR L+K  +I+  DEATSALD  +E A+ 
Sbjct: 553 PLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALL 612

Query: 646 YTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEES---ELF 702
            T+     S   T + IAHRL TI  ++ IIV+ N G V E GK  +L     S   EL+
Sbjct: 613 RTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDN-GRVREEGKHLELLAMPGSLYRELW 671

Query: 703 KLLNEKDH 710
            +  + DH
Sbjct: 672 TIQEDLDH 679

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON}
           Anc_1.527 YKL209C
          Length = 1296

 Score =  191 bits (484), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 151/550 (27%), Positives = 264/550 (48%), Gaps = 34/550 (6%)

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFDRNKV--GDLISRFGSDAYVVSRSMTQNVSDGFKA 272
           IGER   ++R++++   +   + ++D N+   GD  ++       +  S  +  +  F+ 
Sbjct: 106 IGERQGIKVRTKILNNYLTQSMTWYDLNEQLQGDF-TQLHRCVEELRSSSAEASAVTFQN 164

Query: 273 IICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEE 332
            I     +   F+ S +LT ++L   P + + +  +   I   +      +    ++  E
Sbjct: 165 CIAIIALIATSFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSAQIFTE 224

Query: 333 QLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLY 392
            +  I+ IK    + K++ ++  +I +      +              L  + FV    +
Sbjct: 225 TIQNIQLIKLNNLQLKKLMKFQTSISKCNKFFIQMCLYVSLNTSILRTLTLLMFVQGFWF 284

Query: 393 GANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVR 452
           G+ ++ +G L I ++          GS +         L KG  A  ++ + +D  +   
Sbjct: 285 GSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVDFLDEADDPL 344

Query: 453 SNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITS 512
              S  +T     I F+++SF+YP+RP+  I   ++   +  +   IVG SG GKST+++
Sbjct: 345 EINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSN 404

Query: 513 LLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLS-YT-- 569
           LLL+FY+   G ILIDN +I     K+L  ++ +V+Q+ TL + TIR+NI +G+S +T  
Sbjct: 405 LLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQ 464

Query: 570 -----PTMDE-IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
                P ++E ++          F+   P+G DTVIG  G +LSGGQ+QR+A+ARA ++ 
Sbjct: 465 YASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRD 524

Query: 624 PKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGS 683
           P ILILDEA SALDV     +   +  L RS + TII + H L+ I   + + V+ + G 
Sbjct: 525 PPILILDEAVSALDVNIRELLMKAIK-LWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GR 581

Query: 684 VVEVGKFDKLYRNEESELFKL--------LNEKDHDLVSKSENTS----------DIPPD 725
           ++E GK  +L  +  +E  KL        LNE D DL + + N S          D   D
Sbjct: 582 IIEHGKRKELITDPNTEFHKLVAIQNNNNLNE-DFDLETDTFNGSPRDEKNYIEVDYEAD 640

Query: 726 SPKNDDASGL 735
           +PK +  S +
Sbjct: 641 TPKAEKYSSI 650

 Score =  188 bits (478), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 149/534 (27%), Positives = 255/534 (47%), Gaps = 22/534 (4%)

Query: 187  ITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKV 244
            + ++  I  G  ++   +NF +  LL I  E  +  LR + +K  +   I++F  ++ + 
Sbjct: 768  LIKWSCIVIGITIIDGISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQT 827

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
             ++ +   +D   +   +++ +S     I+    G+         L  V +   P +++ 
Sbjct: 828  AEMSALILNDLRDLRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIF 887

Query: 305  AFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364
            + IYG  +       + S  NL  +  + ++ I+TIKS   E      Y  A  +L  V 
Sbjct: 888  SAIYGAVLQKSETDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVA 947

Query: 365  KREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGL 424
             +              +      I+  YG  L++ G  ++  +        +T  +   L
Sbjct: 948  TKRSIYTGLGISITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSL 1007

Query: 425  STFYSELMKGAGAASRLFELMDHKNSVRS-NISHALTPTQGKI-------EFRDVSFSYP 476
                 ++ +G  AAS ++ ++   +  +  N  +++      I       + ++++F+Y 
Sbjct: 1008 VNQIPDMSRGQRAASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYE 1067

Query: 477  TRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFT 536
            + PS ++   ++  + PG  + I G SG GK+T+ SLL++FYD +   I  +  DI  + 
Sbjct: 1068 STPSIKVLDGLTLKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYE 1127

Query: 537  TKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYD 596
             +SLR  + +V+Q+P+++SG+IRDN+        +  E+  V K      FI   P G D
Sbjct: 1128 FESLRDAIVIVEQKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGID 1187

Query: 597  TVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKE 656
            T+I      LSGGQ QRI IARAL++KPKILILDE TSALD  S   IN      + SKE
Sbjct: 1188 TIIDT--TLLSGGQAQRICIARALLRKPKILILDECTSALDAMSADIINN-----LVSKE 1240

Query: 657  L---TIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            L   TIISI H  S +   +N+ V+ N G +VEVG +D L     S L KLL++
Sbjct: 1241 LNGVTIISITHSESMMTSCQNVAVLKN-GKIVEVGTYDSL-ATSSSHLGKLLSK 1292

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  186 bits (472), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 155/550 (28%), Positives = 256/550 (46%), Gaps = 34/550 (6%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDI 236
           ALP  +    ++  V  F GA++ G   N     +   + +  +  +  +  K  M  D+
Sbjct: 139 ALPAAIAMTVLSYGVARF-GAVLFGELRN----AVFAKVAQNAIRTVSLETFKHLMKLDL 193

Query: 237 EFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGV--GMGMMFHISST 289
            +    + G +           +YV+S  +   +   F+ +++CG +    G  F   + 
Sbjct: 194 GWHLTRQTGGMTRAMDRGTKGISYVLSAMVFHIIPISFEISVVCGILTHQFGAQFAGITF 253

Query: 290 LTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL----TRVAEEQLNGIRTIKSFVA 345
           LT  M+L++        I+  + +A   + ++S+         +A + L     +K F  
Sbjct: 254 LT--MMLYS--------IFTIRTTAWRTEFRRSANRADNKGASIALDSLINFEAVKYFNN 303

Query: 346 EKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIG 405
           E     +YN+A+        +             ++   +   ++  G   +L G L++G
Sbjct: 304 ESYLASKYNNALMTYRDAQIKVSQSLAFLNSGQNLIFTSALTAMMYMGCTGILGGNLTVG 363

Query: 406 DLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGK 465
           DL             +  L + Y EL +       LF+L  ++  +++     + P  GK
Sbjct: 364 DLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRRNEVVIKNVEQPKMLPADGK 423

Query: 466 ---IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNY 522
              I F +V+F Y   P   I K+ SF I  G  + IVGPSG GKSTI  L+ RFYDP  
Sbjct: 424 PFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIVGPSGSGKSTILKLVFRFYDPQE 481

Query: 523 GSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQC 582
           G ILI+  D+ +    SLR+ +GVV Q+  L + TI +N+ +G     T +E+    ++ 
Sbjct: 482 GRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWENVRFG-RIDATDEEVWAAVEKA 540

Query: 583 FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 642
                I+K   G DT++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +E 
Sbjct: 541 HLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVLLKNADIMFFDEATSALDTHTEQ 600

Query: 643 AINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELF 702
            +  T+    ++   T I IAHRL TI  ++ IIV+  DGSV E G   +L   + S L+
Sbjct: 601 NLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-EDGSVKEEGTHTELLARDHS-LY 658

Query: 703 KLLNEKDHDL 712
           K L +   +L
Sbjct: 659 KDLWDIQENL 668

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  186 bits (473), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 157/562 (27%), Positives = 260/562 (46%), Gaps = 38/562 (6%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDI 236
           ALP  +G L+I  +     GA++ G   N     +   + +  +  +  Q  +  M  D+
Sbjct: 148 ALPAAIG-LTILCYGFARFGAVLFGEVRN----AVFAKVAQNAIRTVSLQTFQHLMKLDL 202

Query: 237 EFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISSTLT 291
            +    + G L           +YV+S  +   +   F+ +++CG +        ++   
Sbjct: 203 GWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHILPITFEISVVCGILTYQFGASFAAITF 262

Query: 292 SVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL----TRVAEEQLNGIRTIKSFVAEK 347
           + M+L++        I+  + +A   Q ++ +         VA + L     +K F  EK
Sbjct: 263 TTMILYS--------IFTIRTTAWRTQFRRDANKADNKGASVALDSLINFEAVKYFNNEK 314

Query: 348 KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDL 407
               +Y+ ++ +      +             ++   +   ++  G   V+ G L++GDL
Sbjct: 315 YLADKYHTSLIKYRDSQIKVSQSLAYLNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDL 374

Query: 408 TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGK-- 465
                        +  L + Y EL +       LF+L   KN ++  I +   P   K  
Sbjct: 375 VLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQL--RKNEIK--IENGTNPIVLKAS 430

Query: 466 -----IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDP 520
                I F +V+F Y ++   +I  + SFTI  G    +VGPSG GKSTI  L+ RFYDP
Sbjct: 431 DGPFEITFENVTFGYDSK--RKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDP 488

Query: 521 NYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSK 580
             G ILI+  D+ ++   SLRR +GVV Q+  L + TI +N+ +G     T +E+  V +
Sbjct: 489 EQGRILINGVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFG-RIDATDEEVHTVIE 547

Query: 581 QCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           +      I K P GY+T++G RG  +SGG++QR+AIAR L+K  KI+  DEATSALD  +
Sbjct: 548 KAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHT 607

Query: 641 EGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESE 700
           E A+  T+     S   T + IAHRL TI  ++ IIV+  DG+V E G    L     S 
Sbjct: 608 EQALLTTIRANFESGSRTSVYIAHRLRTIADADKIIVL-EDGAVKEEGTHSGLLATPGSL 666

Query: 701 LFKLLN-EKDHDLVSKSENTSD 721
              L N +++ D++     T +
Sbjct: 667 YANLWNIQENLDVIEDELKTQE 688

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  189 bits (480), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 152/524 (29%), Positives = 252/524 (48%), Gaps = 24/524 (4%)

Query: 198  LVVGATANFGRVVLLK--IIG---ERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISR 250
            +V+G  A    + LLK  I+G   E  +  LR   +++  ++ IE+   D NK  +L + 
Sbjct: 753  IVMGIAAADSGLTLLKEFILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSAL 812

Query: 251  FGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGK 310
              +D   +  S +  +S     +I   VG+         L+ V +   P L++ + IYG 
Sbjct: 813  LMNDLRDLRTSTSNFISFVSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGI 872

Query: 311  KISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXX 370
             +     + + +   L  V  E + G++TI+    E     ++N   +    +G+R    
Sbjct: 873  LLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIV 932

Query: 371  XXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSE 430
                      L      I+  Y   LV+ G  +   +        +T  +   L     +
Sbjct: 933  TGFGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCNNLVNQIPD 992

Query: 431  LMKGAGAASRLFELMD--HKNSVRSNISHALTP-----TQGKIEFRDVSFSYPTRPSNQI 483
            + +G  AAS+++ +++   ++       H + P     T   I F D+SF+YPT P+ +I
Sbjct: 993  IRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKI 1052

Query: 484  FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
             KH+S  I  G  + IVG SG GKST+ +++ R Y+    S+ +DN D++ +    LR  
Sbjct: 1053 LKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQ 1112

Query: 544  LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
            + VV+Q+PTL  GTIR+N+ YG        ++  + K    + F    P+G +T I    
Sbjct: 1113 IAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLETKID--S 1170

Query: 604  ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTI--IS 661
              LSGGQ QR+ IARAL+++PKILILDE TSALD  S   IN     ++R    T+  IS
Sbjct: 1171 GLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIIN----EIIREGPPTMLTIS 1226

Query: 662  IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLL 705
            I H    +R   N + V + G +VE+G  + L R ++ +L+KL+
Sbjct: 1227 ITHDEQMVRAC-NKVAVLDQGHIVEMGNREDLLR-QKGQLWKLV 1268

 Score =  180 bits (457), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 139/506 (27%), Positives = 247/506 (48%), Gaps = 20/506 (3%)

Query: 214 IIGERLVSRLRSQVIKRTMHHDIEFFDRNKV--GDLISRFGSDAYVVSRSMTQNVSDGFK 271
           ++GER   R+R+Q+I   +   ++++D N    GDL ++       +  S  +  +  +K
Sbjct: 88  LLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDL-TQTNRCVEELRSSSAEASALTWK 146

Query: 272 AIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAE 331
            ++         F+ S +LT V +  AP +++ A  + + I   S +    +   +++  
Sbjct: 147 NLVTILALTVTSFYYSWSLTLVTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLS 206

Query: 332 EQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLL 391
             +   + ++    +  E++ +  A+++      +              L    FV    
Sbjct: 207 WSMEAAQLVRLSCMQLVEVQNFQLAVKKCSKNFMKMCLYASANTAILKFLTLTIFVQAFW 266

Query: 392 YGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM------ 445
           +G+ ++ +  L I D+          G+++ G       L KG      + E +      
Sbjct: 267 FGSTMIRKHKLRIEDVITCFQSCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYL 326

Query: 446 --DHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPS 503
             D KN+ R  +   ++    KIE R+V F+YP+RP+    K++S T+  G    +VG S
Sbjct: 327 KEDFKNNRRFYLDGGISE---KIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKS 383

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKS++ +LLL+ YD   GSI ID  DI     KS+ +++ +V+Q  TL + T+R+NI 
Sbjct: 384 GSGKSSLGNLLLKLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNIL 443

Query: 564 YGLSYTPTM---DEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARAL 620
           +G   T  +   + ++   +      FI   P+G DT+IG  G + SGGQ+QRIAIARA 
Sbjct: 444 FGSKETDELVRDESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAY 503

Query: 621 IKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGN 680
           ++   IL+LDEA SALD+   G +   +    RS++ TII + H LS I   +++I +  
Sbjct: 504 MRDTPILVLDEAVSALDIIHRGLLMNAIRN-WRSEKTTII-LTHDLSEI-GPDDMIYLLE 560

Query: 681 DGSVVEVGKFDKLYRNEESELFKLLN 706
           DG VVE G+   L  N++   F +++
Sbjct: 561 DGEVVEQGQQRNLLLNQQGRFFNMVS 586

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  185 bits (470), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 150/561 (26%), Positives = 262/561 (46%), Gaps = 29/561 (5%)

Query: 174 SLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKI-------IGERLVSRLRSQ 226
           ++D++    G ++ +  + I    L  GA A FG V+ +++       + +  ++++  Q
Sbjct: 143 TVDSMNIEWGDVTTSLPIAITLTVLSYGA-ARFGSVLFVELRNAIFSNVAQNAITKVSLQ 201

Query: 227 VIKRTMHHDIEFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFKAIICGGVGMGM 282
             +  M  D+ +  R + G L           +YV+S  +   +   F+     G+   +
Sbjct: 202 TFQHLMKLDLGWHLRRQTGGLTRAMDRGCKGISYVLSAMVFHIIPITFEITFVCGI---L 258

Query: 283 MFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL----TRVAEEQLNGIR 338
            +   S+  +V   FA  LL    I+  + +A   Q ++ + +       VA + L    
Sbjct: 259 TYQFGSSFAAVT--FATMLLYS--IFTIRTTAWRTQFRRDANSADNKAASVALDSLINFE 314

Query: 339 TIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVL 398
            +K F  E+    +Y+ ++        +             ++   +   V+    + V+
Sbjct: 315 AVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFLNSGQNLIFTSALTAVMYMACSGVM 374

Query: 399 QGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHA 458
           +G+L++GDL             +  L + Y EL +       LF L  +K ++++ ++  
Sbjct: 375 EGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELKQSLIDMESLFRLQKNKITIKNVLNPQ 434

Query: 459 LTPTQ--GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516
           + P +    I F +V+F Y   P  +I K+ +FTI  G    IVGPSG GKSTI  L+ R
Sbjct: 435 MLPEKLPSDIRFENVTFGYD--PERKILKNATFTIPAGKKTAIVGPSGSGKSTILRLVFR 492

Query: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576
           FY+P  G ILID  DI +    SLR+ +GVV Q+  L + TI +N+ +G       D   
Sbjct: 493 FYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFNDTIWENVKFGRIDASDKDITN 552

Query: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
            + +       I   P G +T++G RG  +SGG++QR+AI+R L+K   ++  DEATSAL
Sbjct: 553 AIERAQLTK-LIQNLPKGINTIVGERGLMISGGEKQRLAISRVLLKDCPLMFFDEATSAL 611

Query: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
           D  +E ++  T+      +  T + IAHRL TI  ++ IIV+ N+  V E G    L + 
Sbjct: 612 DTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKIIVL-NNSRVHEEGDHKTLLKT 670

Query: 697 EESELFKLLNEKDHDLVSKSE 717
             S   +L N ++   V KS+
Sbjct: 671 PGSLYSELWNIQESMTVDKSK 691

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  185 bits (470), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 147/551 (26%), Positives = 253/551 (45%), Gaps = 26/551 (4%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDI 236
           ALP  +  L+I  +     GA++ G   N     +   + +  +  +  Q     M  D+
Sbjct: 166 ALPAAIA-LTIISYGAARFGAVLFGELRN----AIFAKVAQNTIKTISLQTFDHLMKLDL 220

Query: 237 EFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISSTLT 291
            +    + G L           +YV++  +   +   F+ +++CG     + +   ++  
Sbjct: 221 GWHLSRQTGGLTRAMDRGTKGISYVLTAMIFHIIPITFEISVVCGI----LTYQFGASFA 276

Query: 292 SVMLLFAPPLLVGAFIYGKKI--SAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKE 349
            +   F   LL G F        +   RQ  ++      +A + L     +K F  E+  
Sbjct: 277 GIT--FTTMLLYGIFTLRTTAWRTKFRRQANKADNKGASIALDSLINFEAVKYFNNEQYL 334

Query: 350 IRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTA 409
             +YN +++       +             ++   +   ++  G   +L G LS+GDL  
Sbjct: 335 ASKYNTSLKSYTEAQVKVAQSLAFLNSGQNLIFTSALTAMMYMGCTGILGGNLSVGDLVL 394

Query: 410 FMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQG---KI 466
                      +  L + Y +L +       LF+L  ++  + +N + A+   +     I
Sbjct: 395 INQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLRKNEVKILNNKNPAILSLKDGPFNI 454

Query: 467 EFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSIL 526
           EF++V+F Y   P+ +I ++ SF I  G    +VGPSG GKSTI  L+ RFYDP  G +L
Sbjct: 455 EFKNVTFGYD--PNRKILRNASFIIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVL 512

Query: 527 IDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHG 586
           ++  D+  +   SLRR +GVV Q+  L + TI +N+ +G   T T ++I    ++     
Sbjct: 513 VNGIDVRDYDLDSLRRAIGVVPQDTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGT 571

Query: 587 FITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINY 646
            I K P  Y+T++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +E  +  
Sbjct: 572 LIEKLPKKYETIVGERGLMISGGEKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLK 631

Query: 647 TLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
           T+         T + IAHRL T+  S+ IIV+  +GS+ E G    L     S    L N
Sbjct: 632 TIKNNFDKGSRTSVYIAHRLRTVADSDKIIVL-KEGSIFEEGTHLGLLSKPNSLYKDLWN 690

Query: 707 -EKDHDLVSKS 716
            +++ D+++ S
Sbjct: 691 IQENLDMINDS 701

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  184 bits (468), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 145/526 (27%), Positives = 246/526 (46%), Gaps = 22/526 (4%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDI 236
           ALP  +G L+I  +     GA++ G   N     +   + +  + ++  Q  +  M  D+
Sbjct: 169 ALPAAIG-LTIICYGLTRFGAVLFGEVRN----AVFAKVAQNAIQKISLQTFQHLMKLDL 223

Query: 237 EFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISSTLT 291
            +    + G L           +YV++  +   V   F+ +++CG +        ++   
Sbjct: 224 GWHLSRQTGGLTRAMDRGTKGISYVLNAMVFHIVPITFEISVVCGILTYQFGASFAAITF 283

Query: 292 SVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIR 351
           + MLL++    +  F      +   RQ  ++      +A + L     +K F  E+   +
Sbjct: 284 TTMLLYS----IFTFKTTAWRTKFRRQANKADNKGASIALDSLINFEAVKYFNNEEYLAQ 339

Query: 352 RYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFM 411
           +Y+  + Q      +             ++   +  +++  G   ++ G L++GDL    
Sbjct: 340 KYHKTLSQYRDSQIKVAQSLAFLNSGQNLIFTSALTVMMYMGCTGIIGGNLTVGDLVLIN 399

Query: 412 LYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGK----IE 467
                    +  L + Y EL +       LF+L  +   +++     +   +G     I 
Sbjct: 400 QLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQLKKNPIIIKNVEKPLMLAEKGHMPMTIR 459

Query: 468 FRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI 527
           F +V+F Y  +   +I K+ SF IE G    IVGPSG GKSTI  LL RFYDP  G IL+
Sbjct: 460 FENVTFGYDKQ--RKILKNASFQIESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRILV 517

Query: 528 DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGF 587
           +  D  ++   SLR+ +GVV Q+  L + TI +N+ +G     + DEI  V  +      
Sbjct: 518 NGVDAREYDIDSLRKVIGVVPQDTPLFNDTIWENVRFG-RIGASDDEITQVINKAQLGPL 576

Query: 588 ITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYT 647
           + K P G +T++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  T
Sbjct: 577 LVKLPQGRETIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQALLKT 636

Query: 648 LGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKL 693
           +    +    T + IAHRL TI  ++ IIV+  +G+V E GK  +L
Sbjct: 637 INENFKKGSRTSVYIAHRLRTIADADKIIVL-QEGTVREEGKHSEL 681

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  186 bits (473), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 146/517 (28%), Positives = 238/517 (46%), Gaps = 22/517 (4%)

Query: 205  NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISRFGSDAYVVSRSM 262
            NF +  LL    E  +  LR++++++    +I +F  + NK  ++ +   +D   +   +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDLRDLRSLV 837

Query: 263  TQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQS 322
            ++ +S     I    +G+         L+ V +   P +++ + IYG  +       + S
Sbjct: 838  SEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETDYKSS 897

Query: 323  SGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILG 382
               L     + +  I+TIK   AE      Y+D   ++  +  +             ++ 
Sbjct: 898  VAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMTNMIA 957

Query: 383  DMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLF 442
                 I+  YG  LV+    +   + A      +T  S   L     ++ +G  AAS ++
Sbjct: 958  MCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQIPDISRGQRAASWIY 1017

Query: 443  ELMDHKNS---VRSNISHALTPTQGK---------IEFRDVSFSYPTRPSNQIFKHMSFT 490
             ++D       +  N    L  + G          +  ++++F+YP+ P+  I+K M   
Sbjct: 1018 RILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIYKRMDLN 1077

Query: 491  IEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQE 550
            +  G  V IVG SG GKST+  LL   Y    G I ID  D++ +   SLRR + VV+Q+
Sbjct: 1078 MFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREISVVEQK 1137

Query: 551  PTLMSGTIRDNITYG-LSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGG 609
            P+L  G+IRDN+TYG L   P   E+    K    + F+   P   DT I      LSGG
Sbjct: 1138 PSLFDGSIRDNLTYGCLGQMPDF-ELYDALKYVGIYDFVASLPQSLDTRIDTN--LLSGG 1194

Query: 610  QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTI 669
            Q QR+ IARAL++K KILILDE TSALD  S   IN  +        L  + I H    +
Sbjct: 1195 QAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVKK--GPPALLTMVITHNEEMM 1252

Query: 670  RRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
            R   +++V   DG +VE G FD LY N+  ELF++++
Sbjct: 1253 RCCSSVVVF-KDGKIVEEGSFDTLY-NDHKELFRIIS 1287

 Score =  177 bits (448), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 135/493 (27%), Positives = 239/493 (48%), Gaps = 25/493 (5%)

Query: 215 IGERLVSRLRSQVIKRTMHHD-IEFFDRNK--VGDLISRFGSDAYVVSRSMTQNVSDGFK 271
           IGER   R+RS +++  +    IE++D N+  +GD  ++       +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 272 AIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAE 331
            ++     +G  F  S +LT ++L  +P + + A  + + I   +++    +G   ++  
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLT 218

Query: 332 EQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLL 391
             +N  + ++ +  +  E +++ + +        +              L    FV    
Sbjct: 219 WSMNAAQLVRLYCTQPLERKKFEEIVSNCNTFFIKSCFYLAANAGVLRFLTLTMFVQGFW 278

Query: 392 YGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSV 451
           +G+ ++ +G L+I D+          G+++         L KG  A  ++  L++  N  
Sbjct: 279 FGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLE--NGP 336

Query: 452 RSNISHALTPTQ-------GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSG 504
           + N S+ +   Q       G + F +VSF+YP+RP+  I ++       G    IVG SG
Sbjct: 337 KRNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIVGKSG 396

Query: 505 KGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITY 564
            GKSTI++LLL+FYD   GSI I+  +I     KSL  ++ VV+Q  TL + T+++NI  
Sbjct: 397 SGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKNNILL 456

Query: 565 GLS------YTPTMDEIRVVSKQC---FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
           G +       + T+D   ++ + C        I   PDG +T+IG  G +LSGGQ+QR+A
Sbjct: 457 GSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQQRVA 516

Query: 616 IARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENI 675
           IARA I+   IL LDEA SALD+     +   +    + K  T I + H+LS I  +++ 
Sbjct: 517 IARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGK--TTIILTHQLSQI-EADDY 573

Query: 676 IVVGNDGSVVEVG 688
           + +  DG V+E G
Sbjct: 574 LYLMQDGKVIESG 586

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  186 bits (472), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 159/557 (28%), Positives = 270/557 (48%), Gaps = 43/557 (7%)

Query: 168  IAGPIAS------LDALPPIVGTLSITQFVGIFAGALVVGA----TANFGRVVLLKIIGE 217
            IA P+ S      LD + P V  +  + ++  ++  ++  A     + F +   L  + E
Sbjct: 715  IANPVFSFTFSYLLDGIVPKVDGVGSSHYLLKWSVIVLCVAFTDGISTFLKSFSLGFVSE 774

Query: 218  RLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
              +  LR++ ++   + ++E+F  D NK  +L +   +D   +   +++ +S     I+ 
Sbjct: 775  NWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAMSTFIVV 834

Query: 276  GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335
               G+         L+ V +   P +++ + IYG  +       + +  +L     E + 
Sbjct: 835  SLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENCVYEIML 894

Query: 336  GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
            GI+TI+    E+  I+RY+    ++ ++G++              L      I+  YG  
Sbjct: 895  GIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAILFYYGLK 954

Query: 396  LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYS------ELMKGAGAASRLFELMDHKN 449
            LV      IG+ T   ++  +T   +F + T  S      ++ +G  AASR+F ++D  +
Sbjct: 955  LVF-----IGEYTTMKMFKTFT-LLLFTIMTCTSLINQIPDVTRGQRAASRIFRILDESD 1008

Query: 450  S-VRSNISHALT---PTQGKIE----FRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVG 501
              +  +  H  T   P    I+      ++ F YP+  S+ +F  ++  I     V +V 
Sbjct: 1009 RFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVAVVA 1068

Query: 502  PSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN 561
             SG GKST+  LL R Y  ++ SI ID  DI+++   SLR  + +V+Q+PTL  G+IR N
Sbjct: 1069 ESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSIRKN 1128

Query: 562  ITYGLSYTPTMD-EIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARAL 620
            + YG +    MD +I  V KQ     F+T  P+G DT +    + LSGGQ QRI IARAL
Sbjct: 1129 LIYG-NKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRICIARAL 1185

Query: 621  IKKPKILILDEATSALDVESEGAINYTLGTLMRS--KELTIISIAHRLSTIRRSENIIVV 678
            ++K KILILDE TSALD ES     + +  L++S    +  I+I H    +R   N+IV+
Sbjct: 1186 LRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVIVL 1241

Query: 679  GNDGSVVEVGKFDKLYR 695
              DG   + G FD+LY+
Sbjct: 1242 -QDGETAQQGTFDELYK 1257

 Score =  150 bits (380), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 137/527 (25%), Positives = 249/527 (47%), Gaps = 44/527 (8%)

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFDRNK--VGDLIS--RFGSDAYVVSRSMTQNVSDGF 270
           IGE    R+R  ++   +   +E+FD N   +GD +   R   +    S   +      F
Sbjct: 96  IGETQSFRIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAEASAITFQNF 155

Query: 271 KAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA 330
            AII     +   F+ S +LT ++L  +P L+V A  + + I   ++     +G   +  
Sbjct: 156 VAII---ALVCTSFYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSL 212

Query: 331 EEQLNGIRTIKSFVAEKKEIRRYNDA--------IRQLFYVGKREXXXXXXXXXXXXILG 382
              +N  + +K +  +  EI+++ +         I   FYV                 L 
Sbjct: 213 TWSMNAAQLVKLYCTQDFEIKKFKEIVIRCNDYFINAWFYVSAN--------TSILRFLS 264

Query: 383 DMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFG--LSTFYSE---LMKGAGA 437
              FV    +G+ ++ +  +S+  +      T ++   + G  L+T   +   L K    
Sbjct: 265 LAMFVQGFWFGSTMIKKNKMSVDQVI-----TCFSSCLMLGSILNTTLPQIVLLQKAHVG 319

Query: 438 ASRLFELMDHKNSVRSN----ISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEP 493
            +R+ + ++ K+ + ++     S  L      I F  +SF YP+RP + + K++S   +P
Sbjct: 320 LNRVQDFLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNFDP 379

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
                IVG SG GKST+++LLL+FY+   G I ++  ++       + +++ +V+Q+ TL
Sbjct: 380 NKTTFIVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTL 439

Query: 554 MSGTIRDNITYGLSYTPTMDEI----RVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGG 609
            + T+R+N+  GLS+    +++    +   +       I K P G DT +G  G SLSGG
Sbjct: 440 FNDTLRNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGG 499

Query: 610 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTI 669
           Q+QR+A+ARA ++   ++ILDEA SALD  +   +   +    RSK  T I + H L+ I
Sbjct: 500 QQQRVALARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSK--TAIILTHELNQI 557

Query: 670 RRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKS 716
             S+ + ++ N G + E G  ++L  N ES   K  + ++ +  S+S
Sbjct: 558 LPSDFLYLMEN-GQIKEEGYQNELIENVESTFCKFFHLQNSNRESES 603

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  182 bits (462), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 143/534 (26%), Positives = 247/534 (46%), Gaps = 33/534 (6%)

Query: 180 PIVGTLSITQFVGIFAGALVVGATANFGRVVLLKI-------IGERLVSRLRSQVIKRTM 232
           PI  TL++  +             A FG V+ +++       + +  ++++  Q  +  M
Sbjct: 150 PIAVTLTVLSY-----------GAARFGAVLFVELRNAVFSNVAQSAITKVSLQTFQHLM 198

Query: 233 HHDIEFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHIS 287
             D+ +    + G L           +YV+S  +   +   F+ +++CG +        +
Sbjct: 199 KLDLGWHLSRQTGGLTRAMDRGCKGISYVLSAMVFHIIPITFEISMVCGILTYQFGASFA 258

Query: 288 STLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEK 347
           +   S MLL++    +  F      +   R   ++      VA + L     +K F  EK
Sbjct: 259 AITFSTMLLYS----IFTFRTTAWRTRFRRDANKADNKAASVALDSLINFEAVKYFNNEK 314

Query: 348 KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDL 407
               +Y+ ++ +      +             ++   +   ++    N V+QG+L++GDL
Sbjct: 315 YLADKYHTSLMKYRDSQIKVSQSLAFLNTGQNLIFTTALTAMMYMACNGVMQGSLTVGDL 374

Query: 408 TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGK-- 465
                        +  L + Y +L +       LF+L  ++ +++++ +    P      
Sbjct: 375 VLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLD 434

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           I F +V+F Y   P  +I  ++SFTI  G    IVGPSG GKSTI  L+ RFY+P  G I
Sbjct: 435 IRFENVTFGYD--PERRILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRI 492

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCH 585
           L+   DI      SLR+ +GVV Q+  L + TI +N+ +G + + + DEI    ++    
Sbjct: 493 LVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFG-NISSSDDEILRAIEKAQLT 551

Query: 586 GFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAIN 645
             +   P G  TV+G RG  +SGG++QR+AIAR L+K   ++  DEATSALD  +E A+ 
Sbjct: 552 KLLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALL 611

Query: 646 YTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEES 699
           +T+     S   T + +AHRL TI  ++ IIV+   GSV E G    L  ++ S
Sbjct: 612 HTIQQNFSSNSKTSVYVAHRLRTIADADKIIVL-EQGSVREEGTHSSLLASQGS 664

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  182 bits (462), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 140/469 (29%), Positives = 226/469 (48%), Gaps = 27/469 (5%)

Query: 255 AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKIS 313
           +YV+S  +   +  GF+ +++CG +        +    + MLL++        I+  + +
Sbjct: 257 SYVLSAMLFHIIPIGFEISVVCGILTYQFGASFAGITFTTMLLYS--------IFTIRTT 308

Query: 314 AISRQLQQSSGNL----TRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXX 369
           A   Q ++ +         VA + L     +K F  E     +Y+D++ Q      +   
Sbjct: 309 AWRTQFRRDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQ 368

Query: 370 XXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYS 429
                     ++   +  +++  G   V++G L++GDL             +  L + Y 
Sbjct: 369 SLAFLNSGQNLIFTSALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNFLGSVYR 428

Query: 430 ELMKGAGAASRLFELMDHKNSVR-SNISHALTPTQGK-------IEFRDVSFSYPTRPSN 481
           EL +       LF+L   KN ++  N      P   K       I+F +V+F Y T  + 
Sbjct: 429 ELKQSLIDMESLFQL--RKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFGYDT--NR 484

Query: 482 QIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLR 541
           +I K+ SF I  G    +VGPSG GKSTI  L+ RFYDP  G +LI+  ++ ++   SLR
Sbjct: 485 KILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLR 544

Query: 542 RHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGP 601
           R +GVV Q+  L + TI +N+ +G       +EI+ V ++      I K P    T++G 
Sbjct: 545 RVMGVVPQDTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKTIVGE 603

Query: 602 RGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIIS 661
           RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  T+     S   T I 
Sbjct: 604 RGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIY 663

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDH 710
           IAHRL TI  ++ IIV+  DG V E G  ++L   + S    L N +++
Sbjct: 664 IAHRLRTIADADKIIVL-EDGKVKEEGSHNELLATKGSLYSNLWNIQEN 711

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  185 bits (469), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 145/502 (28%), Positives = 235/502 (46%), Gaps = 14/502 (2%)

Query: 202  ATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRS 261
            A  NF ++ LL  + E+ V +LR  +++  +  D+ +  +NK  ++ +   +D   +   
Sbjct: 775  AVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNV 834

Query: 262  MTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF-IYGKKISAISRQLQ 320
             +  +S      +   VG+     I   LT V L   P L +G   +YG  +     Q +
Sbjct: 835  TSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLP-LFIGVITLYGMFVQKSEVQYK 893

Query: 321  QSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXI 380
             +   L  +  E + G++TIK    E     RY    + L    +R              
Sbjct: 894  TAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSC 953

Query: 381  LGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASR 440
            L  +   I+  YG  LV+ G      L        +T  S  GL +      +G  A + 
Sbjct: 954  LVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTF 1013

Query: 441  LFELMDHKNSVRSNISHAL--TPT-----QGKIEFRDVSFSYPTRPSNQIFKHMSFTIEP 493
            +F +++       N S  L   PT     +  +  R ++F+YP     QI+K+ +  I  
Sbjct: 1014 VFGMLEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRINQ 1073

Query: 494  GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
            G+ V IVG SG GKST+  L+   Y     S+ ID  DI  +   +LR+ + VV+Q+P  
Sbjct: 1074 GTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRF 1133

Query: 554  MSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQR 613
             +GTIR+N+ YGL  T T +EI  V  +     F+   P+G +T +      +SGGQ QR
Sbjct: 1134 FNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQR 1191

Query: 614  IAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSE 673
            ++I RAL+++P +LILDE TSALD  +  AI   +   +   ++T+I I H    ++  +
Sbjct: 1192 LSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSLH--DITVIVITHSKQMMKMCD 1249

Query: 674  NIIVVGNDGSVVEVGKFDKLYR 695
             I+V+ N G+V E G FD L+R
Sbjct: 1250 RIVVLKN-GAVAEDGSFDDLFR 1270

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 136/511 (26%), Positives = 239/511 (46%), Gaps = 29/511 (5%)

Query: 214 IIGERLVSRLRSQVIKRTMHHDIEFFDR----NKVGDLISRFGSDAYVVSRSMTQNVSDG 269
           ++GER   R+R ++++  +   ++++D+    N +  + +R   +A     S  +     
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYDKIDDINGMYTITNRCVEEA---RASCAEASGVL 153

Query: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
           F++ +   +     F  S+ LT V L  AP L +   ++ K +   +    + + + +  
Sbjct: 154 FQSAVTALILAVTAFKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASST 213

Query: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIR--QLFYVGKREXXXXXXXXXXXXILGDMSFV 387
               LN    +K F  +  E+R++N A+   + ++V  R              L  M FV
Sbjct: 214 LSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFV--RTLICSSINQAAMRFLSLMMFV 271

Query: 388 IVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDH 447
               YG+ L+ +  +    +      +    SS+  + +    L KG  A  ++ E ++ 
Sbjct: 272 QAFWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVNV 331

Query: 448 KNSVRSN-------ISH--ALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVC 498
           +   R N       + H  AL     +I F  VSF+YP RP  +    +S T  P     
Sbjct: 332 EPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRPNQITF 391

Query: 499 IVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTI 558
           IVG SG GKST+ +LLL+FY    G I +++ ++       L +++ +V+Q  TL +GT+
Sbjct: 392 IVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTL 451

Query: 559 RDNITYGLSYTPTMDEIRVVSKQC---FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
            +NIT  LS  P       V + C        +   P+G  T +G  G S+SGGQ+QR+A
Sbjct: 452 FENIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQRVA 509

Query: 616 IARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENI 675
           +ARA+++   +LILDEA SALD+     +   + +  R+ + TII + H LS +   ++ 
Sbjct: 510 LARAILRDAPVLILDEAISALDIIHRDLLMEVIRS-WRADKTTII-LTHELSHV-LDDDY 566

Query: 676 IVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
           + +   G V+E G   +L  N  S  F+ LN
Sbjct: 567 LYMMEHGQVIEQGYKSELLSNPNSR-FRALN 596

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  181 bits (459), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 154/550 (28%), Positives = 251/550 (45%), Gaps = 37/550 (6%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDI 236
           ALP  +G   IT  V  F GA++ G   N     +   + +  +  +  Q  K  M  D+
Sbjct: 162 ALPAAIGLTIITYGVSRF-GAVLFGELRN----AVFAKVAQSAIMNISLQTFKHLMKLDL 216

Query: 237 EFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISSTLT 291
            +    + G L           +YV+   +   +   F+ +++CG +        +    
Sbjct: 217 GWHLSRQTGGLTRAMDRGTKGISYVLGAMIFHIIPITFEISMVCGILTYQFGASFAGITF 276

Query: 292 SVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL----TRVAEEQLNGIRTIKSFVAEK 347
           + MLL+A        I+  + +A   + ++++         +A + L     +K F  E+
Sbjct: 277 TTMLLYA--------IFTIRTTAWRTEFRRAANRADNKGASIALDSLINFEAVKYFNNEQ 328

Query: 348 KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDL 407
               +Y  ++        +             ++   +   ++  G   V+ G L++GDL
Sbjct: 329 YLANKYYSSLVDYRNSQVKVAQSLAFLNSGQNLIFTSALTAIMYLGCTGVIGGNLTVGDL 388

Query: 408 TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISH-------ALT 460
                        +  L + Y EL +       LF+L   KN ++    H        LT
Sbjct: 389 VLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKL--RKNEIKIQNVHRPLMLPNELT 446

Query: 461 PTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDP 520
           P +  I+F +V+F Y      +I K+ SFTI  G    +VGPSG GKSTI  L+ RFYDP
Sbjct: 447 PFE--IKFENVTFGYD--KERKILKNASFTIPAGWKTAVVGPSGSGKSTILKLVFRFYDP 502

Query: 521 NYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSK 580
             G IL++  DI +    SLR+ +GVV Q+  L + TI +N+ +G     T +EI    +
Sbjct: 503 EEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWENVKFG-RIEATDNEILQAIE 561

Query: 581 QCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           +      I K P G +T++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +
Sbjct: 562 KAQLAPLIKKLPKGRETIVGERGLMISGGEKQRLAIARVLLKNSGIMFFDEATSALDTHT 621

Query: 641 EGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESE 700
           E ++  T+         T + IAHRL TI  ++ IIV+  DG V E G   +L   +ES 
Sbjct: 622 EQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL-KDGQVEEEGTHRQLIAKKESL 680

Query: 701 LFKLLNEKDH 710
             +L N +++
Sbjct: 681 YSELWNIQEN 690

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  179 bits (454), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/338 (35%), Positives = 183/338 (54%), Gaps = 16/338 (4%)

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           ++  G   V+ G L++GDL             +  L + Y EL +       LF+L   K
Sbjct: 385 MMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKL--RK 442

Query: 449 NSVR-SNISH--ALTPTQG--KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPS 503
           N V+  N S   +++ + G  +I+F +V+F Y  +   +I K+ SFTI  G    I GPS
Sbjct: 443 NQVKIQNCSQPKSISKSDGPFEIKFENVTFGYDGQ--RKILKNASFTIPAGMKTAIAGPS 500

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKST+  L+ RFYDP  G +L++  D+ ++    LR+ +GVV Q+  L + TI +N+ 
Sbjct: 501 GSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPLFNDTIWENVK 560

Query: 564 YGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
           +G       +  RV+ K       I K P G  T++G RG  +SGG++QR+AIAR L+K 
Sbjct: 561 FGRIEASDEEITRVIDKAQLSD-LIAKLPQGSSTIVGERGLMISGGEKQRLAIARVLLKD 619

Query: 624 PKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGS 683
             I+  DEATSALD  +E ++  T+     S E T + IAHRL TI  ++ IIV+  +G+
Sbjct: 620 ADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADADKIIVL-EEGT 678

Query: 684 VVEVGKFDKLYRNEES---ELFKLLNEKDHDLVSKSEN 718
           V E G   +L   E S   EL+++  ++D DL+    N
Sbjct: 679 VREEGTHQELLARENSLYKELWRI--QEDLDLLEDEIN 714

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  178 bits (452), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 122/334 (36%), Positives = 180/334 (53%), Gaps = 14/334 (4%)

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           ++  G   V+ G L++GDL             +  L + Y EL +       LF+L   K
Sbjct: 374 MMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKL--RK 431

Query: 449 NSVR-SNISHA--LTPTQGKIE--FRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPS 503
           N V+  NI +   +    G  E  F +V+F Y      +I K+ SFTI  G    IVGPS
Sbjct: 432 NEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNASFTIPAGWKTAIVGPS 489

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKSTI  L+ RFYDP  G ILI+  D+ +    SLR+ +GVV Q+  L + +I +N+ 
Sbjct: 490 GSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQDTPLFNDSIWENVK 549

Query: 564 YGLSYTPTMD-EIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIK 622
           +G      +D EI  V ++      I K P  Y+T++G RG  +SGG++QR+AIAR L+K
Sbjct: 550 FG--RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGGEKQRLAIARVLLK 607

Query: 623 KPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDG 682
              ++  DEATSALD  +E A+  T+    ++   T I IAHRL TI  ++ IIV+  DG
Sbjct: 608 DASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTIADADKIIVL-EDG 666

Query: 683 SVVEVGKFDKLYRNEESELFKLLN-EKDHDLVSK 715
           +V E G  ++L     S   +L N +++ DL+ +
Sbjct: 667 TVREEGTHNELLAKSTSLYKELWNVQENLDLIER 700

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  178 bits (451), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 144/544 (26%), Positives = 247/544 (45%), Gaps = 25/544 (4%)

Query: 177 ALPPIVGTLSITQFVGIFAGALVVGATAN--FGRVVLLKIIGERLVSRLRSQVIKRTMHH 234
           ALP  +  L++  +     GA++ G   N  F RV      G+  +  +  +  +  M  
Sbjct: 144 ALPGAI-MLTVVCYGAARFGAVLFGELRNAVFARV------GQNAIRNVSMETFRHLMKL 196

Query: 235 DIEFFDRNKVGDLISRFGSD----AYVVSRSMTQNVSDGFK-AIICGGVGMGMMFHISST 289
           D+ +    + G L           +YV+S  +   +   F+ +++CG +        +  
Sbjct: 197 DLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGI 256

Query: 290 LTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKE 349
             + MLL++    +  F      +   R+  ++      VA + L     +K+F  EK  
Sbjct: 257 TFTTMLLYS----IFTFRTTAWRTKFRREANKADNKAASVALDSLINFEAVKNFNNEKYL 312

Query: 350 IRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTA 409
             +Y  ++ +      R             ++   +   ++  G   ++ G+L++GDL  
Sbjct: 313 AEKYETSLLKYRDSQVRVAQSLAFLNSGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVL 372

Query: 410 FMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQG---KI 466
                      +  L + Y EL +       LF L ++   + +     + P       I
Sbjct: 373 INQLVFQLSVPLNFLGSVYRELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDI 432

Query: 467 EFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSIL 526
            F +V+F Y   P  +I ++ SF I  G    +VGPSG GKST+  L+ RFYDP  G IL
Sbjct: 433 VFENVTFGYD--PRRKILQNASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRIL 490

Query: 527 IDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHG 586
           ++  DI ++   SLRR +GVV Q+  L + TI +N+ +G       +  R + K      
Sbjct: 491 VNGIDIREYDLDSLRRAIGVVPQDTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP- 549

Query: 587 FITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINY 646
            + + P G +T++G RG  +SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  
Sbjct: 550 LVYRLPGGLNTIVGERGLMISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLR 609

Query: 647 TLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
           T+         T + IAHRL TI  ++ IIV+  +G   E G   +L + E+S   +L N
Sbjct: 610 TIRANFDRGSKTSVYIAHRLRTIADADKIIVL-EEGRPREEGTHHELLQKEDSLYRELWN 668

Query: 707 EKDH 710
            +++
Sbjct: 669 IQEN 672

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  177 bits (449), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 113/327 (34%), Positives = 174/327 (53%), Gaps = 8/327 (2%)

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           ++  G   V+ G L++GDL             +  L + Y EL +       LF L ++K
Sbjct: 353 MMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFNLRNNK 412

Query: 449 NSVRSNISHALTPTQG---KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGK 505
             + +N    + P      +I+F +V+F Y TR   +I ++ SFTI  G    IVGPSG 
Sbjct: 413 IKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--RKILRNASFTIPAGVKTAIVGPSGS 470

Query: 506 GKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYG 565
           GKSTI  L+ RFYDP  G +L++  D+ ++   S R+ +GVV Q+  L + TI +N+ +G
Sbjct: 471 GKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVPQDTPLFNDTIWENVKFG 530

Query: 566 LSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPK 625
                T DE+    ++      I K P G  T++G RG  +SGG++QR+AIAR L+K  +
Sbjct: 531 -RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISGGEKQRLAIARVLLKNSQ 589

Query: 626 ILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVV 685
           I+  DEATSALD  +E ++  T+         T + +AHRL TI  ++ I+V+  +G V 
Sbjct: 590 IMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRTIADADKILVL-EEGCVR 648

Query: 686 EVGKFDKLYRNEESELFKLLNEKDHDL 712
           E G   +L     S L+K L +   +L
Sbjct: 649 EEGSHTELLSRPNS-LYKQLWDIQENL 674

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  177 bits (448), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 146/533 (27%), Positives = 259/533 (48%), Gaps = 15/533 (2%)

Query: 183  GTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDR- 241
            G+  + +F  I +   +    + F ++  L   GE  +  LR +   + + + I +F + 
Sbjct: 700  GSEYLLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISWFSKS 759

Query: 242  -NKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPP 300
             NK   L +   +D   +   +T+ +S     I+   +G+     I   L+ V +   P 
Sbjct: 760  NNKAPILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIAIIPL 819

Query: 301  LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQL 360
            ++V   +YG  +     + + S  NL  +  E + G++TI+S   ++   +++N  I+ L
Sbjct: 820  VVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLL 879

Query: 361  FYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSS 420
               G               +L  +   I+  YG  LVL G  +   L   +    +T  +
Sbjct: 880  EKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVT 939

Query: 421  VFGLSTFYSELMKGAGAASRLFELM--DHKNSVR--SNISHA---LTPTQGKIEFRDVSF 473
            V  L T   ++ +G  + S + +++  D++ ++   SN+S       P Q  IE  ++SF
Sbjct: 940  VASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVIEVSNLSF 999

Query: 474  SYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
            +Y    + +   +++  +       IVG SG GKST+ +L+   Y  + GSI I + DI+
Sbjct: 1000 TYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDIN 1059

Query: 534  KFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPD 593
            K++TK L + + ++QQ P L   TIR+N+ YGL+ T   + +  V +      FI    +
Sbjct: 1060 KWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNN 1119

Query: 594  GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMR 653
            G D+ +    + LSGGQ QR+ +AR +++ PK+LILDE TSALDV S   IN  +G+  R
Sbjct: 1120 GLDSKLD--DSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS--R 1175

Query: 654  SKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
            S     I ++H+  TI+  + I  +  DG+V  +G +++L  N   E  KLLN
Sbjct: 1176 SLAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMENNW-EFRKLLN 1226

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 133/485 (27%), Positives = 222/485 (45%), Gaps = 32/485 (6%)

Query: 212 LKIIGERLVSRLRSQVIKRTMHHD-----IEFFDRNKVGDLISRFGSDAYVVS--RSMTQ 264
           L I G  ++   +S +I++ + H+       +FD+ +  D++  F      +   RS + 
Sbjct: 90  LAIYGWMMLGERQSYIIRKKLFHEYFNLPCSWFDKYR-SDIMGEFTQLHRCIEEVRSSSA 148

Query: 265 NVSDGFKAIICGGVGM-GMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSS 323
             S      +   + + G  F+ S +LT ++    P +++ A I+ K I   + +    S
Sbjct: 149 EASAIMSQSLVAVIALIGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTES 208

Query: 324 GNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGD 383
                     L  I  ++    +  EI  Y   I Q      +             +L  
Sbjct: 209 ECAAERLAWMLKNIEFVRLHNGDDFEISMYTHYIAQANEYYIKASLFISANISILRLLSL 268

Query: 384 MSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGS---SVFGLSTFYSELMKGAGAASR 440
           + FV    +G++++ QG L+I  +          GS   S  G +     L KG  A  R
Sbjct: 269 LMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVV---LQKGDVAMKR 325

Query: 441 LFELMDHKNSVRSNISHA-------LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEP 493
           L +++D   + R +++         L P    I F +VSF YP R ++++F  M+F I+P
Sbjct: 326 LLKMIDR--TPRESLAFIDAISGIDLLP----IVFNNVSFCYPERKTDKVFDKMNFIIKP 379

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
                ++GPSG GKST+  L+L  YD  +GSI++ + DI       +  ++ +V Q PTL
Sbjct: 380 NKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTL 439

Query: 554 MSGTIRDNITYGLSYT--PTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQR 611
            + TIR+NI    ++T  P+  E+  + K       I + PDG DT IG  G  LSGGQ 
Sbjct: 440 FNDTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQA 499

Query: 612 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRR 671
           Q++A+ARA  +   IL+LDE  SA+D+     +   +      K  T + I H L  IR 
Sbjct: 500 QKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK--TTVIITHDLEFIRN 557

Query: 672 SENII 676
           ++NI+
Sbjct: 558 TDNIL 562

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  176 bits (447), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 138/519 (26%), Positives = 243/519 (46%), Gaps = 22/519 (4%)

Query: 193  IFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDR--NKVGDLISR 250
            + A AL  G T NF ++ +L    E  +  LR+++++       E++ R  NK  ++ + 
Sbjct: 728  VLAIALADG-TFNFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISAL 786

Query: 251  FGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGK 310
              +D   +   +T+ +S     +    +G+         L+ V +   P +++ + IYG 
Sbjct: 787  ALNDLRDLRTLVTEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGT 846

Query: 311  KISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXX 370
             +       + +  +L  +  E +  I+TIK        +  Y++  +++  + K+    
Sbjct: 847  VLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIV 906

Query: 371  XXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSE 430
                      +      I+  YG  LVL G  +   +        +T ++   L +   +
Sbjct: 907  TGLGLSMLTTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQIPD 966

Query: 431  LMKGAGAASRLFELMDHKNSVRS---------NISHALTPTQGKIEFRDVSFSYPTRPSN 481
            + +G  AAS +  ++D     +           I H    +   IE  +++F YP  P  
Sbjct: 967  VSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHE-NDSDPLIEIENLNFHYPNTPGV 1025

Query: 482  QIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLR 541
             +++ ++  I  G  + +VG SG GKST+  LL + YD     ILI+  DI+ ++   LR
Sbjct: 1026 NVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILR 1085

Query: 542  RHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV--VSKQCFCHGFITKFPDGYDTVI 599
              + VV+Q+P L  GTIR+NITYG+S    + E  V  + +    H F+   P   DTV+
Sbjct: 1086 AEICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVV 1145

Query: 600  GPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG---AINYTLGTLMRSKE 656
                  LSGGQ QR+ I R L++KPK+LILDE TS+LD ++     A+   L T +    
Sbjct: 1146 DI--GLLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDI 1203

Query: 657  LTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR 695
            LTI+ I H    ++    ++V+ + G VVE G+FD L++
Sbjct: 1204 LTIV-ITHNRQMMQCCSRLVVL-DVGRVVEDGQFDDLHQ 1240

 Score =  173 bits (438), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 136/503 (27%), Positives = 246/503 (48%), Gaps = 28/503 (5%)

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFD--RNKVGDL------ISRFGSDAYVVSRSMTQNV 266
           +GER   R+RS++++  +   +E++D   N  GD       +    S +   S    QN 
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYDLKENLAGDFTQLNRCMEELRSGSAEASAVTYQNC 152

Query: 267 SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL 326
                A+IC      + F+ S  LT ++L  +P ++V A  + + I   +    + +   
Sbjct: 153 V-AIIALIC------VSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAA 205

Query: 327 TRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSF 386
             +    ++  +T+K    + KEI+++   + +      R              L    F
Sbjct: 206 ADLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYFIRTSLFTAANIGILRFLTLSMF 265

Query: 387 VIVLLYGANLVLQGALSIGD-LTAFMLYTEYTGSSVFGLSTFYSELM-KGAGAASRLFEL 444
           V    +G+ ++ +G L+I D +T F  Y+     S+   +  +   + KG  A +++ + 
Sbjct: 266 VQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQKGQVALAKIQKF 323

Query: 445 MDHKNSVRSNI--SHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGP 502
           ++    + S    S  L  +   I   +++F+YP+RP+  + K++S  I+      IVG 
Sbjct: 324 INESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTTFIVGK 383

Query: 503 SGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI 562
           SG GKSTIT+L+++FY+   G+I++ + DI       L +++ +V+Q  TL + T+++NI
Sbjct: 384 SGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDTLKNNI 443

Query: 563 TYGLSYTPTMDEIRVVSKQC---FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARA 619
             G  YT       ++S  C        I+  PDG +T +G  G +LSGGQ+QR+A+ARA
Sbjct: 444 LLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRVALARA 503

Query: 620 LIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVG 679
            ++   ILILDEA SALD+     +   +  + ++K  T I + H L+ I  ++ I +  
Sbjct: 504 FLRDTDILILDEAVSALDIMQREILMRNISKVRQNK--TTIILTHDLNQINDNDYIYLFE 561

Query: 680 NDGSVVEVGKFDKLYRNEESELF 702
           N+  + E G F K   N+E+ LF
Sbjct: 562 NN-EIKENG-FKKTLMNDENTLF 582

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  176 bits (446), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 148/558 (26%), Positives = 263/558 (47%), Gaps = 36/558 (6%)

Query: 167  LIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQ 226
            L++G IAS +A P   G  S T++  I     ++ +T  F +   L   GE  +  LR +
Sbjct: 755  LLSG-IASSNAYPA-TGRRS-TKWSLIVLSVALLDSTFTFLKCFTLSKCGENWIRALRLR 811

Query: 227  VIKRTMHHDIEFFDRNK-----VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMG 281
              K   + ++ +F+  +     V  L+     D   ++      V+       CG     
Sbjct: 812  AFKNISNRELAWFNSEQNSTSNVSSLVINDLRDLRALASEFLAAVTTLVVVSFCG----- 866

Query: 282  MMFHISS----TLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGI 337
            +++ ++S    +L  + L+ A  L  GA  YG  +       + +  ++       +  I
Sbjct: 867  LIWALASGWKLSLVCISLIPAFILFTGA--YGGLLQKCEANYKSAVASMEDQLYSAVRRI 924

Query: 338  RTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLV 397
            +TI+    E++ I+ Y     +    G++              L  ++  I+L YG  LV
Sbjct: 925  KTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKLV 984

Query: 398  LQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSV------ 451
            + G  S   +   +    +T  +   L     E+ +G  AA+ LF ++D +         
Sbjct: 985  ITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANLE 1044

Query: 452  -RSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTI 510
              S ++      +  I  +D+ FSY    +  +++ ++ +++ G  V +VG SG GKST+
Sbjct: 1045 GESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTL 1104

Query: 511  TSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTP 570
              L+ R Y    GSI  D  D++++   +LR+ + VV+Q P+L  G+I DN+TYGLS + 
Sbjct: 1105 WHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSV 1164

Query: 571  TMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILD 630
               EIR + +      F+   P G  + I      LSGGQ QR+AI RAL++KP++L+LD
Sbjct: 1165 DEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVLD 1222

Query: 631  EATSALDVESEGAINYTLGTLMR--SKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
            E TSALD +      + +   +R  S+  T + + H    +R    I+   N G+++E G
Sbjct: 1223 ECTSALDAQH----GFIMSEFVRQGSQSTTTLVLTHSEQMMRACNRILTFAN-GNIIEDG 1277

Query: 689  KFDKLYRNEESELFKLLN 706
             F++LY +++ ELFK+L+
Sbjct: 1278 SFERLY-SQKGELFKILS 1294

 Score =  154 bits (390), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 135/532 (25%), Positives = 245/532 (46%), Gaps = 36/532 (6%)

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFDRNK--VGDLISRFGSDAYVVSRSMTQNVSDGFKA 272
           +GER   RLR ++++  +   + ++D N+   GD  ++       +  S  ++ +  F+ 
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDF-TQLNRCVEELRSSSAESSAIVFQN 157

Query: 273 IICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEE 332
           ++     +G   + S +LT +++  +P ++  A  + +K+   +++    + +       
Sbjct: 158 VVTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAW 217

Query: 333 QLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLY 392
            L+  + ++    + +E+ R+   +++      +              L    FV    Y
Sbjct: 218 SLDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWY 277

Query: 393 GANLVLQGALSIGDL-TAFMLYTEYTGSSVFGLSTFYSEL------MKGAGAASRLFELM 445
           G + +  G L  GD+ T F        S V   ST  S L       KGA    ++   +
Sbjct: 278 GNSRINIGKLKPGDVVTCF-------SSCVLLASTLNSTLHQIIILQKGAVGLQKIMAFV 330

Query: 446 DHKNSVRSN-----ISHALTP---TQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNV 497
           + +++  S      IS    P    +  I F++V F+YPTRP + + K +S     G   
Sbjct: 331 NSRDASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETT 390

Query: 498 CIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGT 557
            ++G SG GKSTI +LLL FY    G+I ++  D+ +     L R++ +V+Q  +L + T
Sbjct: 391 FVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTET 450

Query: 558 IRDNITYGLSYTPTMDEIRV--VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
           + +N+T G +     DEIR+    +       I     G +T IG  G  LSGG++QR+A
Sbjct: 451 LANNVTIGEAGVDD-DEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVA 509

Query: 616 IARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENI 675
           +ARA  +   ILILDEA SA D   +  +   +    R+ + TII + H LS I  ++ +
Sbjct: 510 LARAYFRNAPILILDEALSAQDRIHKSLLMEAIRK-WRADKTTII-LTHELSDILDTDYV 567

Query: 676 IVVGNDGSVVEVGKFDKLYRNEESEL-----FKLLNEKDHDLVSKSENTSDI 722
            V+ +DG + E G    L  N +SE      F+  ++   D+ +  + TS I
Sbjct: 568 YVM-SDGQIREHGYKSGLLSNPKSEFSNLHRFQACDDDFGDVATLGDGTSQI 618

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 148/546 (27%), Positives = 260/546 (47%), Gaps = 61/546 (11%)

Query: 207  GRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNV 266
             + VL  ++G R   ++   ++ RT+H  + FFD   +G +++RF  D   V + +T  +
Sbjct: 1125 SKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYL 1184

Query: 267  SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIY--GKKISAISRQLQQ--- 321
               F  ++     M ++  I+    SV       +LVG   Y  G    A SR+L++   
Sbjct: 1185 EAAFFCLVQCIATMALITFITPQFLSV------AILVGCLYYLVGYFYMAASRELKRFES 1238

Query: 322  -SSGNLTRVAEEQLNGIRTIKSFVAEKK----EIRRYNDAIRQLFY--VGKREXXXXXXX 374
             S   + +   E L G+ TI+++  E +     + + ++  +  FY  V  R        
Sbjct: 1239 ISKSPIYQHFSETLVGVATIRAYGDESRFMLENLHKIDENNKPFFYLWVFNRWLSFRIDM 1298

Query: 375  XXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKG 434
                 I G   F++  +   +  + G      LT  + +TE        L  FY+++   
Sbjct: 1299 IGAFVIFGAGVFILTNIKNIDSGMAGI----SLTYAISFTE----GALWLVRFYADVEMN 1350

Query: 435  AGAASRLFELMDHK----NSVRSNISHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSF 489
              +  RL E M+ +    +  +  + H   P+ GKIE +D+S  Y P  P  ++ K++SF
Sbjct: 1351 MNSVERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYAPNLP--KVIKNVSF 1408

Query: 490  TIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQ 549
             +EP + + IVG +G GKSTI + + RF +P  G I ID+ +I+      LRR + ++ Q
Sbjct: 1409 VVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQ 1468

Query: 550  EPTLMSGTIRDNITYGLSYTP-------------TMDEIRVVSKQCFCHGFITKFPDGYD 596
            +PTL +GTI+ N+     +T              T +E++    Q        KF +  +
Sbjct: 1469 DPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLN-LE 1527

Query: 597  TVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKE 656
              I   G++LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+       +
Sbjct: 1528 NEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRK--EFSQ 1585

Query: 657  LTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKS 716
             TI++IAHRL ++   + IIV+       EV ++D  Y         LL +K+ +  S  
Sbjct: 1586 STILTIAHRLRSVIDYDKIIVMDAG----EVKEYDHPY--------SLLLDKNSNFYSMC 1633

Query: 717  ENTSDI 722
            E + ++
Sbjct: 1634 EQSGEL 1639

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 107/451 (23%), Positives = 196/451 (43%), Gaps = 48/451 (10%)

Query: 268 DGFK-AIICGG----VGMGMMFHISSTLTSVMLLFAP----PLLVGAFIYGKKISAISRQ 318
           D FK + ICG     V   +M  ++ TL   +L +A      L++       K++    +
Sbjct: 502 DAFKVSEICGYLHFFVEAVIMVFVAITLLYKLLGYAAFVGAALIIACLPLNLKLATFLGK 561

Query: 319 LQQSSGNLT--RVAE--EQLNGIRTIKSFVAEK------KEIRRYNDAIRQLFYVGKREX 368
           LQ+ S   T  R+ +  E L  IR IK F  E       KE+R      ++L  + KR  
Sbjct: 562 LQKESLGFTDKRIQKLNETLQAIRIIKFFSWEDNFSRDIKEVRE-----KELHLLLKRSL 616

Query: 369 XXXXXXXXXX---XILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLS 425
                         I+   SF   + Y    VL   ++   L+ F L      + +  LS
Sbjct: 617 IWAFSSFVWFVTPSIVTSASFAFYI-YVQGEVLTTPVAFTALSLFTL----LKTPLDQLS 671

Query: 426 TFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFK 485
              S +++   +  R+ + +  +++ + N    +     +I F++V+ ++     +   +
Sbjct: 672 NMISFVIQSKVSLDRIQDFLGEQDTDKYN-QLTIDKLGNRIAFKNVTVTWDNGEEDFKLR 730

Query: 486 HMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD------ISKFTTKS 539
            ++   +PG+   ++GP+G GK+++   LL       G I++   +      I KF    
Sbjct: 731 DLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEIIVPALNPRQDLVIDKF---G 787

Query: 540 LRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVI 599
           L   +    Q   L++ T+R+NI +   Y    +    V   C     +        T I
Sbjct: 788 LTNSIAYCSQAAWLLNETVRNNILFNSPYNE--ERYNAVIDACGLRRDLKILKASDMTEI 845

Query: 600 GPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKEL 657
           G +G +LSGGQ+QR+++ARAL    K ++LD+  SA+D  +   I  N   G LM  +  
Sbjct: 846 GEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTALWIYDNCITGPLMSGR-- 903

Query: 658 TIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           T I ++H ++   ++  ++V+  +G V + G
Sbjct: 904 TCILVSHNIALTLKNAELVVILENGRVKDQG 934

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  174 bits (442), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 154/547 (28%), Positives = 255/547 (46%), Gaps = 65/547 (11%)

Query: 199  VVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVV 258
            + GAT    +  L  I G     ++ + ++ + +H  + FFD   +G +++RF  D   V
Sbjct: 1170 LTGATVGSLKTFLTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESV 1229

Query: 259  SRSMTQNVSDGFKAII-CGGV-----GMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKI 312
             + +T  ++  F + + C         +   F + + L S+M       LVG F      
Sbjct: 1230 DQELTPYLTGAFYSFVECFSTIILISWITPQFFVVAILISIMYY-----LVGYFYM---- 1280

Query: 313  SAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAE----KKEIRRYNDAIRQLFY-- 362
             A SR+L++    +   + +   E L G+ TI++F  E    K+ + + ++  +  FY  
Sbjct: 1281 -AGSRELKRLDSITKSPIYQHFSETLVGVTTIRAFGDEMRFLKENLFKIDENNKPFFYLW 1339

Query: 363  VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVF 422
            V  R             + G   F++  +   +  + G      LT  + +TE       
Sbjct: 1340 VANRWLSFRIDMIGSFVVFGAGVFILADIKNIDSGMAGI----SLTYAISFTE----GAL 1391

Query: 423  GLSTFYSELMKGAGAASRLFELMDHKNS---VRSNISHA---LTPTQGKIEFRDVSFSYP 476
             L  FYSE+     +  R+ E M  +     ++  I      + P +GKIE  D+S  Y 
Sbjct: 1392 WLVRFYSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTVWPDEGKIEVNDLSLRYA 1451

Query: 477  TRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFT 536
                 ++ K++SFT+EP S V +VG +G GKSTI + L RF DP  G I IDN DI+   
Sbjct: 1452 ANLP-RVIKNVSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIP 1510

Query: 537  TKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-----PTMDEIRVVSKQCFCHGFITKF 591
               LRR + ++ Q+PTL +GT++ N+     Y        +  + +VS +   +G  T  
Sbjct: 1511 LTRLRRAITIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEEL-NGETTAV 1569

Query: 592  PD-------------GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
             D                  I   G +LS GQRQ I +AR+L++ PKIL+LDEAT+++D 
Sbjct: 1570 SDQGSMHSNNENRFLDLSNEITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDY 1629

Query: 639  ESEGAINYTL-GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNE 697
            ES+  +  T+ G    S   TI++IAHRL ++   + I+V+ + G V+E      L  N 
Sbjct: 1630 ESDARLQATIRGEFGNS---TILTIAHRLRSVIDYDKILVM-DAGEVIEYDHPYSLLLNR 1685

Query: 698  ESELFKL 704
             SE +K+
Sbjct: 1686 NSEFYKM 1692

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 116/239 (48%), Gaps = 17/239 (7%)

Query: 465 KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGS 524
           K+ F + + S+ T  S    ++++   + G    ++G +G GK+++   LL       G 
Sbjct: 758 KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGR 817

Query: 525 ILIDNHDI-SKFTTKS--LRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV--VS 579
           I++ + +  S  T  S      +    Q   L++ T+R+NI +  S+    DE R   V 
Sbjct: 818 IIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSF----DENRYHKVV 873

Query: 580 KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVE 639
           + C           G  T IG +G +LSGGQ+QRI++ARAL    K L+LD+  SA+D  
Sbjct: 874 EACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSH 933

Query: 640 SEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK----FDK 692
           +   I  N   G LM  +  T I ++H ++   R+  ++V+  DG V + G     FDK
Sbjct: 934 TASWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILEDGRVKDQGDPLNLFDK 990

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  174 bits (442), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 141/502 (28%), Positives = 243/502 (48%), Gaps = 57/502 (11%)

Query: 227  VIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHI 286
            ++K+ ++  + FFD   +G +++RF  D   V + +T  V   F +++     + ++ +I
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 287  SSTLTSVMLLFAPPLLVGAFIY--GKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTI 340
            +         F   + +G F Y  G    A SR+L++    S   + +   E L GI TI
Sbjct: 1193 TPDF------FFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTI 1246

Query: 341  KSFVAEKK----EIRRYNDAIRQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGA 394
            ++F  E++     + + ++  +  FY  V  R             I     FV++ +   
Sbjct: 1247 RAFGDERRFMQENLTKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSL 1306

Query: 395  NLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSN 454
            +  L G      LT  + +TE        L   YS +     +  RL E M+ +      
Sbjct: 1307 DSGLAGI----SLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQ 1358

Query: 455  ISH---ALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTI 510
             +H      P+QGKIE  D+S  Y P+ P  ++ K+++FT++P   V IVG +G GKSTI
Sbjct: 1359 STHNPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGKSTI 1416

Query: 511  TSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT- 569
             + L RF DP  G I IDN DI+    K LR+ + ++ Q+PTL +GT++ N+     Y+ 
Sbjct: 1417 ITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSD 1476

Query: 570  ----PTMDEIRVVSKQCFCHGFITKFPDGYDTV-------------IGPRGASLSGGQRQ 612
                  +  + +V+++   H      PD    V             I   G++LS GQRQ
Sbjct: 1477 KQIFEALKRVNLVTQEELDHA-ANPSPDNASAVSENVNKFLFLENEISEGGSNLSQGQRQ 1535

Query: 613  RIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRS 672
             + +AR+L++ PK+++LDEAT+++D +S+  I  T+ +     + TI++IAHRL +I   
Sbjct: 1536 LVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLRSIIDY 1593

Query: 673  ENIIVVGNDGSVVEVGKFDKLY 694
            + I+V+       EV ++D  Y
Sbjct: 1594 DKILVMDAG----EVKEYDHPY 1611

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 114/241 (47%), Gaps = 9/241 (3%)

Query: 459 LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFY 518
           +T  + KI F + +FS+  +  +   K+M+   + G    ++GP+G GK+++   LL   
Sbjct: 682 ITVHRNKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEM 741

Query: 519 DPNYGSI---LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEI 575
           D   G +    +D  +        +   +    Q   L++ T+++NI +   +       
Sbjct: 742 DLLEGKVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFSSPFNE--GRY 799

Query: 576 RVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSA 635
             V + C           G  T IG +G +LSGGQ+QR+++ARAL    + L+LD+  SA
Sbjct: 800 NAVIEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSA 859

Query: 636 LDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKL 693
           +D  +   I  N   G LM  +  T I ++H ++   ++   +V   +G V + G+  +L
Sbjct: 860 VDSHTALWIYENCISGPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLEL 917

Query: 694 Y 694
           Y
Sbjct: 918 Y 918

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  173 bits (439), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 153/544 (28%), Positives = 253/544 (46%), Gaps = 35/544 (6%)

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFDRNK--VGDLISRFGSDAYVVSRSMTQNVSDGFKA 272
           +GER   R+R+ +I      D++++D N+   GD I +       V  S  +  +  F+ 
Sbjct: 91  LGERQGFRIRNSLIMFYFEKDLKWYDSNENLEGDFI-QINRCIEEVRASSAEASAIFFQN 149

Query: 273 IICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEE 332
           +I     +    + S +LT ++L   P L   A     K+   S+     S   + V   
Sbjct: 150 VISIIALIATSMYYSWSLTLIILCSLPLLATLAVFLSMKVEKFSKLENLESSKASSVLAW 209

Query: 333 QLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLY 392
            L+  + I+ F     E +++   + +      +              L    FV    +
Sbjct: 210 SLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSALNASSLRFLTLCMFVQGFWF 269

Query: 393 GANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRL--FELMDHKNS 450
           G   + +G +  GD+          GSS+         + KG  A  R+  F + + K++
Sbjct: 270 GNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQKGKAAIQRINQFLVPNSKSA 329

Query: 451 V----------RSNISHALTP--TQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVC 498
           V           ++ S  L P    G IEFRDVSF+YPTRP + + K++S  I+ G+   
Sbjct: 330 VGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCF 389

Query: 499 IVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTI 558
           IVG SG GKST+ SLLL+ Y    G I    ++I       L  ++ +V+Q  TL +GT+
Sbjct: 390 IVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTL 449

Query: 559 RDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIAR 618
           +DN+T    Y  +  E++   +    +  +   P+G DT++G  G +LSGGQ+QR+A+AR
Sbjct: 450 KDNLTIVNKYA-SCTEVKQACQFALLNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALAR 508

Query: 619 ALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVV 678
           A ++   +LILDE+ SALD+ S   I   +    + K  T I + H  + I+  E + ++
Sbjct: 509 AYLRNTPVLILDESLSALDIMSRELIVEAIRHWRKGK--TTIILTHEYTQIKDDEYVYLM 566

Query: 679 GNDGSVVEVG-KFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIP--PDS--PKNDDAS 733
            ++G+VVE G K+D L  N +S  F  LN       S  E   ++P  PD   P + D++
Sbjct: 567 -SEGTVVESGFKYD-LLENPDS-YFAQLN-------SLQETRYEVPVSPDVELPYSPDSA 616

Query: 734 GLEH 737
              H
Sbjct: 617 TYNH 620

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 131/517 (25%), Positives = 242/517 (46%), Gaps = 16/517 (3%)

Query: 200  VGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFD--RNKVGDLISRFGSDAYV 257
            V   + F +  +L    E  + RLR   + +     +++F    N   +L S   +D   
Sbjct: 757  VDGISTFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRD 816

Query: 258  VSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISR 317
            +    ++ +S     +    +G+         L+ V +   P  ++ + IYG  +     
Sbjct: 817  LRGLASEFLSAITTLVFVASIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYET 876

Query: 318  QLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXX 377
              +     L     E +  ++TIK    ++     +   + ++  V K+           
Sbjct: 877  AYKTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAV 936

Query: 378  XXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGA 437
               L  +   I+  +G  LV+QG  S+  +        ++  +   L     E+ +G  A
Sbjct: 937  TNALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRA 996

Query: 438  ASRLFELMDHKNSVRSN-----ISHALTPTQGK---IEFRDVSFSYPTRPSNQIFKHMSF 489
            A+ +F++++   SV ++      + +   T G    I+  ++SF++ + P N+IF  +S 
Sbjct: 997  ATYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSC 1056

Query: 490  TIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQ 549
             I     V IVG SG GKST++ LL R Y    G + I   DI+K+   +LRR + +V+Q
Sbjct: 1057 EICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQ 1116

Query: 550  EPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGG 609
            +P    GT+R+N+ YGL    +  E+R V K      F+   P+  +T +      +SGG
Sbjct: 1117 KPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGG 1174

Query: 610  QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTI 669
            Q QR++IAR L+++PKI+ILDE TSALD  +  AI   + T++  K +T+I I H    +
Sbjct: 1175 QAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVL--KNVTVIVITHSEQLM 1232

Query: 670  RRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
            +  + ++V+   G V E G + +L+ +   EL+++++
Sbjct: 1233 QICDRVLVL-KKGKVKEEGSYAELFES-RGELYRIVS 1267

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  172 bits (437), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 149/509 (29%), Positives = 241/509 (47%), Gaps = 64/509 (12%)

Query: 222  RLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMG 281
            ++ S ++ + +H ++ FFD   +G +++RF  D   V + +   +      II       
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCII------- 1191

Query: 282  MMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAI-------SRQLQQ----SSGNLTRVA 330
                ISST+  +  +  P  L+ A +      AI       SR+L++    +   + +  
Sbjct: 1192 ---DISSTILLITYI-TPEFLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHF 1247

Query: 331  EEQLNGIRTIKSFVAEKKEIRRYNDAI----RQLFY--VGKREXXXXXXXXXXXXILGDM 384
             E L G+ T++++  E + +R     I    +  FY  V  R             I G  
Sbjct: 1248 SETLVGVTTVRAYGDEARFMRENLKMIDENNKPFFYLWVSNRWLAFRIDVVGALVIFGSG 1307

Query: 385  SFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFEL 444
             FV++ +   +  L G      L+  + +TE    S   L   YS L     +  RL E 
Sbjct: 1308 VFVLLNIDKIDSGLAGI----SLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEY 1359

Query: 445  MDHKNSVRSNISHAL---TPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIV 500
            M+ +     + S  +    P +GKIE  DVS  Y P  P  ++ K+ +FT++P   V IV
Sbjct: 1360 MEVEQEPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIV 1417

Query: 501  GPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRD 560
            G +G GKSTI + L RF DP  GSI IDN DIS    K LRR + ++ Q+PTL SGTI+ 
Sbjct: 1418 GRTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKS 1477

Query: 561  NITYGLSYT-----PTMDEIRVVS----------KQCFCHGFITKFPDGYDTVIGPRGAS 605
            N+     Y+       +  + +V+          +Q    G   KF +  +  I   G++
Sbjct: 1478 NLDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLN-VNNEISEGGSN 1536

Query: 606  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHR 665
            LS GQRQ + +AR+L++ PK+++LDEAT+++D  S+  I  T+       + TI++IAHR
Sbjct: 1537 LSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHR 1594

Query: 666  LSTIRRSENIIVVGNDGSVVEVGKFDKLY 694
            L T+   + I+V+       EV +FD  Y
Sbjct: 1595 LRTVIDYDKILVMDAG----EVKEFDHPY 1619

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 124/550 (22%), Positives = 235/550 (42%), Gaps = 73/550 (13%)

Query: 190 FVGIFAGALVVGATAN---FGRVVLLKIIGERLVSRLRSQVIKR---------------- 230
           F+  F   +V   +     FGR V +++    LVS + S+ +KR                
Sbjct: 401 FLMFFCRVIVAACSGQALFFGRRVCVRM-RSILVSEIYSKALKRKISNDKSASLKDLNEQ 459

Query: 231 -----TMHHDIEFFDRNK------VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVG 279
                 + +D+E  D ++      +G +I+    D + V+  +   +    +A++   V 
Sbjct: 460 EEVDPQIENDLENIDGDEESKSSNLGSIINLMAVDTFKVA-DICAYLHHFVEAVVMTIVA 518

Query: 280 MGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN---- 335
           + ++F     L  V  +    L++       K++++  + Q+ S  +T    ++LN    
Sbjct: 519 LILLFK----LLGVAAIVGASLIIALLPLNFKLASLLGKYQKKSLEVTDKRIQKLNEAFQ 574

Query: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI-VLLYGA 394
            IR IK F  E       ++  + +  V +RE            I   + FV   ++ GA
Sbjct: 575 AIRIIKFFSWE-------DNFEKDILEVRERELRMILIRSIVWAISSFVWFVTPTIVTGA 627

Query: 395 NLVLQGALSIGDLTAFMLYTEYTGSSVFGL--------STFYSELMKGAGAASRLFELMD 446
           +      +    LT   +   +T  S+F L        S   S +++   +  R+ E ++
Sbjct: 628 SFTYYVYVQGEVLT---IPVAFTALSLFALLKIPLDTFSDMLSFVIQSKVSLDRIQEFLE 684

Query: 447 HKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKG 506
            +++ +      +   Q KI F++ + ++     +   +++    + G    I+GP+G G
Sbjct: 685 EEDTKKYE-QLTVDKYQNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSG 743

Query: 507 KSTITSLLLRFYDPNYGSILI---DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           K+++   LL   D   G I++   D  +  K     L   +    Q   L++ T+R+NI 
Sbjct: 744 KTSLLMALLGEMDLIDGEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNIL 803

Query: 564 YGLSYTPTMDEIR--VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALI 621
           +    +P  +E    VV        F      G  T IG RG +LSGGQ+QR+++ARAL 
Sbjct: 804 FN---SPYCEERYNAVVEASGLKRDF-EILNAGDMTEIGERGITLSGGQKQRVSLARALY 859

Query: 622 KKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVG 679
              K L+LD+  SA+D  +   I  N   G LM ++  T I ++H ++   R+ + +V  
Sbjct: 860 SNSKHLLLDDCLSAVDSHTATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKL 917

Query: 680 NDGSVVEVGK 689
            +G +VE G+
Sbjct: 918 ENGKIVEHGE 927

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  172 bits (436), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 151/555 (27%), Positives = 264/555 (47%), Gaps = 53/555 (9%)

Query: 182  VGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDR 241
            VG  S+  ++ I+       +  +  + +L  + G     ++ + ++++ +H  + FFD 
Sbjct: 1137 VGPHSMFYYLAIYFLIGFAQSVLSAFKTILSFVAGLNASKKIFNLLLQKVLHAKLRFFDS 1196

Query: 242  NKVGDLISRFGSDAYVVSRSMTQNVSDGFKAII-CGGVGMGMMFHISSTLTSVMLLFAPP 300
              +G +++RF  D   V + +T      F +++ C    + + F     +T   L+ A  
Sbjct: 1197 TPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITF-----ITPQFLIVAVI 1251

Query: 301  LLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIR----R 352
            + V  +  G    A SR+L++    S   + +   E L G+ TI++F  E + I+    +
Sbjct: 1252 VAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDESRFIQENLHK 1311

Query: 353  YNDAIRQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAF 410
             ++  R  FY  V  R             + G   F+++ +   +  + G      LT  
Sbjct: 1312 IDENNRPFFYLWVANRWLAMRIDLIGSLVVFGAGVFILLNIDHIDAGMAGI----SLTYA 1367

Query: 411  MLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM-----DHKNSVRSNISHALTPTQGK 465
            + +TE        L   YS +     +  RL E M      +   + +  S    P  G+
Sbjct: 1368 ITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPIMTPPSDW--PQHGR 1421

Query: 466  IEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGS 524
            +E  DVS  Y P  P  ++ K++SFT+EP S V +VG +G GKSTI + L RF DP  G 
Sbjct: 1422 VEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKSTIITALFRFLDPETGH 1479

Query: 525  ILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-----PTMDEIRVVS 579
            I IDN DIS    + LRR + ++ Q+PTL +GTI+ N+     Y+       +  + +VS
Sbjct: 1480 IKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYSDEDIFAALKRVNLVS 1539

Query: 580  KQCFCHGFI----------TKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629
            ++      I           KF D  ++ I   G +LS GQRQ + +AR+L++ PKI++L
Sbjct: 1540 QEELDRSNIDAASVGSENVNKFLD-LNSEINEGGGNLSQGQRQLVCLARSLLRSPKIILL 1598

Query: 630  DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
            DEAT+++D +S+  I  T+    +    TI++IAHRL ++   + I+V+ + G V E   
Sbjct: 1599 DEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILVM-DQGEVKEYDH 1655

Query: 690  FDKLYRNEESELFKL 704
               L  N+ S+ + +
Sbjct: 1656 PYSLLLNKNSQFYSM 1670

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 133/272 (48%), Gaps = 14/272 (5%)

Query: 424 LSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQI 483
           LS   S +++   +  R+ E ++  ++ + N   ++ P   K+ F + + S+ +   +  
Sbjct: 705 LSDMLSFVIQSKVSLDRIQEFLEEPDTDKYN-QLSVAPGGQKLGFENATISWDSEKQDFK 763

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD---ISKFTTKSL 540
            ++++   + G    ++GP+G GK++I   LL       G+I++ + D   +       +
Sbjct: 764 LRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSLDPRALLPIDADGM 823

Query: 541 RRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV--VSKQCFCHGFITKFPDGYDTV 598
              +    Q   L++ T+R+NI +   Y+    E R   V + C           G  T 
Sbjct: 824 TNSIAYCSQAAWLLNDTVRNNILFNSPYS----EARYNDVIEACGLKRDFEILSAGDMTE 879

Query: 599 IGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKE 656
           IG RG +LSGGQ+QRI++AR+L    + L+LD+  SA+D  +   I  N   G LM+ + 
Sbjct: 880 IGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDNCITGPLMQGR- 938

Query: 657 LTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
            T I I+H ++   R+  ++V+  +G V E G
Sbjct: 939 -TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  172 bits (435), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 152/524 (29%), Positives = 246/524 (46%), Gaps = 65/524 (12%)

Query: 208  RVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVS 267
            + VL  + G     ++ + ++ + MH  + FFD   +G +++RF  D     + +T  + 
Sbjct: 1109 KTVLSFVAGINASRKIFNLLLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIE 1168

Query: 268  DGFKAII-CGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG-----KKISAISRQLQQ 321
              F +++ C    + + F     L   +L+      VG F        K++ +ISR    
Sbjct: 1169 GAFYSLVQCVSTVVLITFITPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISR---- 1224

Query: 322  SSGNLTRVAEEQLNGIRTIKSFVAEKKEIR----RYNDAIRQLFY--VGKREXXXXXXXX 375
                + +   E L G+ TI++F  E + +R    + ++  R  FY  V  R         
Sbjct: 1225 --SPIYQHFSETLVGVTTIRAFGDESRFMRENLQKIDENNRPFFYLWVANRWLSFRIDMI 1282

Query: 376  XXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGA 435
                I G   FV   L   + +  G   I  LT  + +TE        L   YS +    
Sbjct: 1283 GALVIFGAGIFV---LLNIDHIDSGKAGIS-LTYAITFTE----GALWLVRLYSNVEMNM 1334

Query: 436  GAASRLFELMD-----HKNSVRSNISHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSF 489
             +  RL E MD     +  S+ +       P QG+IE  D+S  Y P  P  ++ K++SF
Sbjct: 1335 NSVERLKEYMDVEQEPYDQSILT--PPVEWPQQGRIEVNDLSLRYAPNLP--KVIKNVSF 1390

Query: 490  TIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQ 549
            T++P S V IVG +G GKSTI + L RF DP  G+I IDN DI+    + LRR + ++ Q
Sbjct: 1391 TVDPRSKVGIVGRTGAGKSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQ 1450

Query: 550  EPTLMSGTIRDNITYGLSYT-----PTMDEIRVVSKQ-----------CFCHGFITKFPD 593
            +PTL +GTI+ N+     YT       +  + +V+++                 I KF D
Sbjct: 1451 DPTLFTGTIKSNLDPYDEYTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLD 1510

Query: 594  GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMR 653
               + I   G ++S GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+     
Sbjct: 1511 -LSSEISEGGGNISQGQRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETI----- 1564

Query: 654  SKEL---TIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY 694
             KE    TI++IAHRL ++   + I+V+       EV +FD  Y
Sbjct: 1565 RKEFGGNTILTIAHRLRSVIDYDKILVMDAG----EVKEFDHPY 1604

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 105/461 (22%), Positives = 201/461 (43%), Gaps = 32/461 (6%)

Query: 244 VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLV 303
           +G +I+    DA+ VS  +   +    +A++   V   +++H    L     +    L+V
Sbjct: 477 LGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYH----LLGFAAIVGAALIV 531

Query: 304 GAFIYGKKISAISRQLQQSSGNLTRVAEEQLN----GIRTIKSFVAE---KKEIRRYNDA 356
                  K++     LQ+ + ++T    ++LN     IR IK F  E   +K+IR   + 
Sbjct: 532 AMMPLNFKLATWLGHLQKETLSVTDKRIQKLNEAFQAIRIIKFFSWENNFEKDIRDVRET 591

Query: 357 IRQLFYVGKREXXXXXXXXXXX---XILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLY 413
             +L ++ KR                I+   +F    +Y    VL   ++   L+ F L 
Sbjct: 592 --ELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWF-YIYIQGEVLTTPIAFTALSLFSLL 648

Query: 414 TEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSF 473
                + +  LS   S +++   +  R+ E ++ K++ + N   +    + KI F + + 
Sbjct: 649 R----TPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDTEKYN-QLSTAKDKKKIGFENATI 703

Query: 474 SYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
           ++     +   K+++   + G    I+GP+G GK+++   LL       G I++ + D  
Sbjct: 704 TWDAERPDFKLKNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHLVSGKIIVPSLDPR 763

Query: 534 K---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITK 590
           +        +   +    Q   L++ T+++NI +   Y     E   V + C      + 
Sbjct: 764 QELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNEGRYE--AVVEACGLKRDFSI 821

Query: 591 FPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTL 648
              G  T IG RG +LSGGQ+QRI++AR+L    + ++LD+  SA+D  +   I  N   
Sbjct: 822 LSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVDSHTASWIYDNCIT 881

Query: 649 GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
           G LM  +  T I ++H  +   R+  ++V   +G V   G+
Sbjct: 882 GPLMEGR--TCILVSHNTALTLRNAELVVTMENGQVKNQGE 920

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  171 bits (433), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 151/547 (27%), Positives = 258/547 (47%), Gaps = 61/547 (11%)

Query: 194  FAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGS 253
            FA AL+ GA    G+ +L  + G     ++ + ++ + +H  I FFD    G +++RF  
Sbjct: 1113 FAQALL-GA----GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSK 1167

Query: 254  DAYVVSRSMTQNVSDGFKAII-CGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG--- 309
            D   + + +T  +   F ++I C    + + F     L+  +++      VG F      
Sbjct: 1168 DIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSR 1227

Query: 310  --KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAE----KKEIRRYNDAIRQLFY- 362
              K+  +ISR        + +   E L G+ TI++F  E    ++ + + ++  +  FY 
Sbjct: 1228 ELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYL 1281

Query: 363  -VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSV 421
             V  R             I G   F+   L+  N +  G   I  LT  + +TE      
Sbjct: 1282 WVANRWLAFRIDMIGSLVIFGAGLFI---LFNINNLDSGMAGIS-LTYAISFTE----GA 1333

Query: 422  FGLSTFYSELMKGAGAASRLFELMDHKN---SVRSNISHALTPTQGKIEFRDVSFSY-PT 477
              L   YSE+     +  R+ E M+ +    +    I     P  GKIE  D+S  Y P 
Sbjct: 1334 LWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKEIPPPQWPQDGKIEVNDLSLRYAPN 1393

Query: 478  RPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTT 537
             P  ++ K++SF+++  S + IVG +G GKSTI + L RF +P  G I IDN DIS    
Sbjct: 1394 LP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDL 1451

Query: 538  KSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-----PTMDEIRVVSKQCFCHGF----- 587
            + LRR + ++ Q+PTL SGTI+ N+     ++       +  + ++S++    G      
Sbjct: 1452 QRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETS 1511

Query: 588  ----------ITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALD 637
                      + KF D   + I   G++LS GQRQ + +AR+L++ PKI++LDEAT+++D
Sbjct: 1512 NEASSTNSENVNKFLD-LSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASID 1570

Query: 638  VESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNE 697
              S+  I  T+    +    TI++IAHRL ++   + I+V+ + G V E      L  N+
Sbjct: 1571 YSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNK 1627

Query: 698  ESELFKL 704
            +S  + +
Sbjct: 1628 QSAFYSM 1634

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 117/537 (21%), Positives = 215/537 (40%), Gaps = 58/537 (10%)

Query: 190 FVGIFAGALVVGATANFGRVVLLK----IIGERLVSRLRSQVI----------------K 229
           FVG    A+       FGR V ++    II E     LR ++                 +
Sbjct: 401 FVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEINDQ 460

Query: 230 RTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISST 289
           ++++ D E      +G +I+    DA+ VS  +   +    +A +   V + +++ +   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYRLLGF 519

Query: 290 LTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKE 349
              V +L    +L   +   K I  + ++    + N  +   E    IR IK F  E+  
Sbjct: 520 AAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENF 579

Query: 350 IRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI----------VLLYGANLVLQ 399
            +  N  IR+       E            I   + FV             +Y    VL 
Sbjct: 580 EKDIN-TIRE------NELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYVQGEVLT 632

Query: 400 GALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL 459
             ++   L+ F L  +     +  LS   S +++   +  R+ + ++ +N  +      +
Sbjct: 633 TPVAFTALSLFTLLRD----PLDRLSDMLSFVVQSKVSLDRVQDFLN-ENDTKKYDQLTI 687

Query: 460 TPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIE--PGSNVCIVGPSGKGK-STITSLLLR 516
            P   +  F + + S+     NQ FK     IE   G    ++GP+G GK S + +LL  
Sbjct: 688 DPNGNRFAFENSTISWDK--DNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGE 745

Query: 517 FYDPNYGSILIDNHDISK---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMD 573
            Y  N G +++   +  +            +    Q   L++ T+++NI +   +     
Sbjct: 746 MYLLN-GKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEA-- 802

Query: 574 EIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEAT 633
             + V + C           G  T IG +G +LSGGQ+QR+++ARAL    + ++LD+  
Sbjct: 803 RYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCL 862

Query: 634 SALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           SA+D  +   I  N   G LM  +  T I ++H ++   R+  ++V+  DG V + G
Sbjct: 863 SAVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  170 bits (431), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 152/532 (28%), Positives = 248/532 (46%), Gaps = 25/532 (4%)

Query: 197  ALVVGATA-----NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLIS 249
             +V+G  A     NF +  LL    E  +  LR++V+++     + +F  + NK  ++ +
Sbjct: 790  CIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSA 849

Query: 250  RFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG 309
               +D   +   +++ +S     I    +G+         L+ V +   P +++ + IYG
Sbjct: 850  LVLNDLRDLRSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFSAIYG 909

Query: 310  KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXX 369
              +       + S   L     + +  I+TIK   AE      Y+    ++  +  +   
Sbjct: 910  SILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAI 969

Query: 370  XXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYS 429
                      ++      I+  YG  LV+    +   +        +T  S   L +   
Sbjct: 970  ATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIP 1029

Query: 430  ELMKGAGAASRLFELMDHK--------NSVRS----NISHALTPTQGKIEFRDVSFSYPT 477
            ++ +G  AAS ++ ++D K        N+ RS      ++    T   +  ++++F+YP+
Sbjct: 1030 DISRGQRAASWIYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNLTFAYPS 1089

Query: 478  RPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTT 537
             PS  I+K+M+  +  G  + IVG SG GKST+  LL R YD   GSI +D  D++ +  
Sbjct: 1090 APSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNL 1149

Query: 538  KSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDT 597
              LRR + VV+Q+P L +GTIRDN+TYG        EI    K    + F+   P G  T
Sbjct: 1150 TVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGT 1209

Query: 598  VIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKEL 657
             I      LSGGQ QR+ IARAL++KPKILILDE TSALD  S   I   +        L
Sbjct: 1210 RIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIKEIVKK--GPPAL 1265

Query: 658  TIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKD 709
              + I H    +R  ++I V   DG V+E G FD LY N   E+F++++EK+
Sbjct: 1266 LTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLY-NNCGEMFRIVSEKN 1315

 Score =  167 bits (424), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 134/515 (26%), Positives = 239/515 (46%), Gaps = 24/515 (4%)

Query: 215 IGERLVSRLRSQVIKRTMHHD-IEFFDRNK--VGDLISRFGSDAYVVSRSMTQNVSDGFK 271
           IGE+   R+RSQ+++  +    ++++D N   +GD  ++       +  S  +  +  F+
Sbjct: 125 IGEKQGLRIRSQLLEAYLEKKPMKWYDVNDTLLGDF-TQINRCVEELRSSSAEASAITFQ 183

Query: 272 AIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAE 331
            ++     +G  F+ S +LT ++L  +P +   A  + + +   S++  + +    ++  
Sbjct: 184 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFA 243

Query: 332 EQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLL 391
             +N  + ++ +  +  E +++   I        +              L    FV    
Sbjct: 244 WSMNAAQLVRLYCTQPLERKKFQRIILSCNTFFIKSCLFVAANAGILRFLTLTMFVQGFW 303

Query: 392 YGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDH---- 447
           +G+ ++ QG L+I D+          GS++         L KG  A  ++  L+++    
Sbjct: 304 FGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENGPKC 363

Query: 448 --KNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGK 505
              N +  +  + L      + F +VSFSYP+RPS  + ++ S     G    IVG SG 
Sbjct: 364 NPPNEIELH-QYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKSGS 422

Query: 506 GKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYG 565
           GKST++SLLL+FYD   GSI I+  +I     K L +++ VV+Q  TL + T+R NI  G
Sbjct: 423 GKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNILLG 482

Query: 566 ---------LSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAI 616
                     S     + I+   +       I   PDG +T+IG  G +LSGGQ+QR+A+
Sbjct: 483 STELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQRVAM 542

Query: 617 ARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENII 676
           ARA I+   IL LDEA SALD+     +   +    + K  T I + H L  +   +++ 
Sbjct: 543 ARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGK--TTIILTHELGQVESDDHLY 600

Query: 677 VVGNDGSVVEVGKFDKLYRNEESELFKLLN-EKDH 710
           ++  +G V+E G   +L  +  S   K    +KD+
Sbjct: 601 LM-QEGKVIESGTQSELLADSTSTFSKWYCLQKDY 634

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  170 bits (430), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 135/505 (26%), Positives = 233/505 (46%), Gaps = 16/505 (3%)

Query: 199  VVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISRFGSDAY 256
            V      F +  +L +  E  +  LR + + R  + D+ +F  D NK  ++ +   +D  
Sbjct: 801  VTDGCFTFLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLR 860

Query: 257  VVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF-IYGKKISAI 315
             +   ++  +S     I    +G+   F +S    S++ +   PL +G   IYG  +   
Sbjct: 861  DLRYLVSGFLSAVTTLIFVSAIGLAWAF-VSGWKLSLVCISTIPLFIGVTGIYGGVLQKY 919

Query: 316  SRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXX 375
                + +   L     E + GI+T++    E     +Y      + +  +R         
Sbjct: 920  ETDYKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGV 979

Query: 376  XXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGA 435
                 L      I+  YG  LV+ G  +  +L        +T  +   L        +G 
Sbjct: 980  ALSNALVIGVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFSRGR 1039

Query: 436  GAASRLFELMDHK-------NSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMS 488
             AA+ +F +++ +       +  R+      +     I  +D++F+YP+    +++K +S
Sbjct: 1040 RAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEVYKKLS 1099

Query: 489  FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQ 548
             TI  G N+ IVG SG GKST+  +L   Y  N  ++ ID+ DI K+   SLR+H+ +V+
Sbjct: 1100 LTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKHISMVE 1159

Query: 549  QEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSG 608
            Q+     G+IRDN+ YGL    T  +I  V        F+ + P G +T I      +SG
Sbjct: 1160 QKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN--LISG 1217

Query: 609  GQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLST 668
            GQ QRI+I RAL+++PK+LILDE TS+LD ++  AI   +G+ +    +T I I H  + 
Sbjct: 1218 GQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLYG--ITTIVITHN-TQ 1274

Query: 669  IRRSENIIVVGNDGSVVEVGKFDKL 693
            + +S N I+   +G + E G F +L
Sbjct: 1275 MMKSCNRILFFKNGRISEEGTFQEL 1299

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 121/498 (24%), Positives = 228/498 (45%), Gaps = 33/498 (6%)

Query: 214 IIGERLVSRLRSQVIKRTMHHDIEFFDRNK--VGDLISRFGSDAYVVSRSMTQNVSDGFK 271
           ++GER   R+R +++   +   + ++D N+   GD  ++       +  S  ++ +  F 
Sbjct: 101 LLGERQGFRVRRRLLGAYLSKTMAWYDTNENLEGDF-TQIHRGVEELRSSAAESSAVTFL 159

Query: 272 AIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAE 331
             +     +    + S +LT V+L   P ++  A I+ K +   +      + +   +  
Sbjct: 160 NAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEKYTELENTETSHAASILT 219

Query: 332 EQLNGIRTIKSFVAEKKEIRRYNDAIRQL--FYVGKREXXXXXXXXXXXXILGDMSFVIV 389
             +   + I+ F  E+ E+++++ ++++   F++   +             L  + FV  
Sbjct: 220 WSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAANQASLRG--LSLIMFVQG 277

Query: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK- 448
             +G  ++ +G L+ G +          G+++         + KG  A  ++  +++ + 
Sbjct: 278 FWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVIMQKGKVALQKILSMVESES 337

Query: 449 NSVRSNISHAL----TPTQG---------KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGS 495
           +++R           +P  G         +I F +VSFSYP+RP+     ++S T  P  
Sbjct: 338 DALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVSFSYPSRPNEYALDNVSLTFYPEK 397

Query: 496 NVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMS 555
              IVG SG GKST+++LLL+ Y    G+I +   DI       L  ++ +V+Q  TL +
Sbjct: 398 ITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLLENITLVEQSCTLFN 457

Query: 556 GTIRDNITYGLSYTPTMDE-----IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQ 610
               D++   L  T   D      I+   +       +   PDG  TVIG  G SLSGGQ
Sbjct: 458 ----DSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQ 513

Query: 611 RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIR 670
           +QR+A+ARA+++   +LILDE+ SALD+     +   +    R+ + TII + H LS I 
Sbjct: 514 QQRVALARAILRDTPVLILDESISALDIIHRDLLMEVIRN-WRAGKTTII-LTHELSHI- 570

Query: 671 RSENIIVVGNDGSVVEVG 688
             ++ + +  DG V E G
Sbjct: 571 LDDDYLYLMEDGKVGEHG 588

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  170 bits (430), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 150/543 (27%), Positives = 260/543 (47%), Gaps = 61/543 (11%)

Query: 185  LSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            L I  F+G F  ALV  +     + ++  + G     ++ + ++K+ ++  + FFD   +
Sbjct: 884  LLIYFFIG-FTQALVASS-----KTIINFMAGLNASRKIFNLILKKVLYAKLRFFDSTPI 937

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
            G +++RF  D   V + +T  V   F +++     + ++ +I+     V +  A    + 
Sbjct: 938  GRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYITPGFFVVAIFIA----IL 993

Query: 305  AFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKK----EIRRYNDA 356
             ++ G    A SR+L++    S   + +   E L GI TI++F  E++     + + ++ 
Sbjct: 994  YYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAFGDERRFMQENLEKIDEN 1053

Query: 357  IRQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYT 414
             +  FY  V  R             I     FV++ +   +  L G      LT  + +T
Sbjct: 1054 NKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSGLAGI----SLTYAISFT 1109

Query: 415  EYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHA---LTPTQGKIEFRDV 471
            E        L   YS +     +  RL E M+ +       +H      P+QGKIE  D+
Sbjct: 1110 E----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHTPPPEWPSQGKIEVNDL 1165

Query: 472  SFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
            S  Y P+ P  ++ K++SFT++P   V IVG +G GKSTI + L RF DP  G I IDN 
Sbjct: 1166 SLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGKSTIITALFRFLDPESGYIKIDNV 1223

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-----PTMDEIRVVSKQCFCH 585
            DI+    K LR+ + ++ Q+PTL +GT++ N+     Y+       +  + +++++    
Sbjct: 1224 DITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQIFEALKRVNLLTEEELNS 1283

Query: 586  G-------------FITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEA 632
                           + KF    D  I   GA+LS GQRQ + +AR+L++ PK+++LDEA
Sbjct: 1284 AGSPAPGNSSIHSENVNKFLR-LDNEITEGGANLSQGQRQLVCLARSLLRSPKVMLLDEA 1342

Query: 633  TSALDVESEGAINYTL-GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
            T+++D  S+  I  T+ G    S   TI++IAHRL +I   + I+V+       EV ++D
Sbjct: 1343 TASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKILVMDAG----EVKEYD 1395

Query: 692  KLY 694
              Y
Sbjct: 1396 HPY 1398

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 123/255 (48%), Gaps = 16/255 (6%)

Query: 459 LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFY 518
           +T ++ +I F + +FS+  +  +   K+MS     G    ++GP+G GK+++   LL   
Sbjct: 468 ITVSRKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEM 527

Query: 519 DPNYGSI---LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEI 575
           D   G +    +D  +        +   +    Q   L++ T+++NI +    +   +E 
Sbjct: 528 DLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILF----SSPFNEA 583

Query: 576 R--VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEAT 633
           R   V + C           G  T IG +G +LSGGQ+QR+++ARAL    + L+LD+  
Sbjct: 584 RYDAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCL 643

Query: 634 SALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
           SA+D  +   I  N   G LM  +  T I ++H ++   ++ + +V   +G V + G+  
Sbjct: 644 SAVDSHTALWIYENCITGPLMEGR--TCILVSHNVALTLKNADWVVFMENGKVKDQGEPL 701

Query: 692 KLYRN---EESELFK 703
           +L++     E EL K
Sbjct: 702 ELFQKGLLGEDELVK 716

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  169 bits (428), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 153/557 (27%), Positives = 263/557 (47%), Gaps = 52/557 (9%)

Query: 185  LSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            LSI   +GI A AL+ G+     +V++   +G +   ++   ++K+ MH  + FFD   +
Sbjct: 1109 LSIYFLIGI-AQALL-GSL----KVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPI 1162

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKAII-CGGVGMGMMFHISSTLTSVMLLFAPPLLV 303
            G +++RF  D   + + +   V   F +++ C    + + F     L+  +L+     L+
Sbjct: 1163 GRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFITPQFLSVAILVTGLYYLI 1222

Query: 304  GAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAE----KKEIRRYND 355
            G F       A SR+ ++    +   + +   E L G+ TI++F  E    ++ + + ++
Sbjct: 1223 GYFYL-----AASREFKRFDSITKSPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDE 1277

Query: 356  AIRQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLY 413
              R  FY  V  R             + G  SF+I  +   +  + G      LT  + +
Sbjct: 1278 NNRPFFYLWVANRWLSFRIDMVGALVVFGSGSFIIWNIKNIDAGMAGI----SLTYAISF 1333

Query: 414  TEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHA---LTPTQGKIEFRD 470
            TE        L   YS +     +  RL E M  +     + +       P +GKIE  D
Sbjct: 1334 TE----GALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCD 1389

Query: 471  VSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
            +S  Y      ++ K+++FT+ P + + IVG +G GKSTI + L RF DP  G I IDN 
Sbjct: 1390 LSLRY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNI 1448

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI-TYGLSYTPTM------------DEIRV 577
            DI+      LRR + ++ Q+PTL +GTI+ N+  YG      M            D    
Sbjct: 1449 DITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSN 1508

Query: 578  VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALD 637
            +  +      + KF +  +  I   G++LS GQRQ + +AR+L++ PKI++LDEAT+++D
Sbjct: 1509 IETESISSQNVNKFLN-LNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASID 1567

Query: 638  VESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNE 697
              S+  I  T+     S   TI++IAHRL ++   + I+V+ + G V E      L  N+
Sbjct: 1568 YNSDAKIQETIRKEFNSS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNK 1624

Query: 698  ESELFKLL-NEKDHDLV 713
            +S  + +  N  + DL+
Sbjct: 1625 KSIFYNMCENSGELDLL 1641

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 102/476 (21%), Positives = 203/476 (42%), Gaps = 64/476 (13%)

Query: 244 VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHI---SSTLTSVMLLFAPP 300
           +G +I+    DA+ VS  +   +    +A +   + + +++ +   S+ + ++++L A P
Sbjct: 490 LGGIINLMAVDAFKVSE-VCAYLFAFVEATVMAIISLTLLYRLIGSSAIIGTIVILIAAP 548

Query: 301 LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQ- 359
                + +   +  I +     +    +   E L  IR IK F  E    +  ND   Q 
Sbjct: 549 ---ANYYFATLLGKIQKATLLVTDKRIQKLNESLQAIRIIKFFSWEDNFEKSINDVREQE 605

Query: 360 LFYVGKREXXXXXXXXXXXXILGDMSFV---IVLLYGANLVLQGALSIGDLTAFMLYTE- 415
           L  + KR                 M++V    V     +LV   A       AF +Y + 
Sbjct: 606 LQLLLKRS----------------MAWVCSSFVWFVTPSLVTAAAF------AFYIYVQK 643

Query: 416 --------YTGSSVFGL--------STFYSELMKGAGAASRLFELMDHKNSVRSNISHAL 459
                   +T  S+F L        S   S +++   +  R+ + +   ++ + +    +
Sbjct: 644 EVLTTPIAFTALSLFTLLRNPLDQLSDMLSFVIQSKVSLDRIRDFLLETDTAKYD-QLTV 702

Query: 460 TPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYD 519
            P   ++EF++ + S+ +   +   K ++   + G    ++GP+G GK+++   LL    
Sbjct: 703 APQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMK 762

Query: 520 PNYGSILIDNHDISK---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576
              G I++ + D  +            +    Q   L++ T+R+NI +   Y    +E R
Sbjct: 763 IMEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSPY----NEAR 818

Query: 577 VVS--KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATS 634
             S  + C           G  T IG +G +LSGGQ+QR+++ARA+    + ++LD+  S
Sbjct: 819 YTSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLS 878

Query: 635 ALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           A+D  +   I  N   G LM  +  T I ++H ++   ++ +++V+  DG V + G
Sbjct: 879 AVDSHTALWIYDNCITGPLMDGR--TCILVSHNIALTLKNADLVVILEDGKVKDQG 932

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 146/536 (27%), Positives = 255/536 (47%), Gaps = 28/536 (5%)

Query: 193  IFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFF--DRNKVGDLISR 250
            I  G  V    +NF +  +L    E  +  LR++ ++  ++ D+ +F  D NK  +L + 
Sbjct: 763  IVLGVAVADGVSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSAL 822

Query: 251  FGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGK 310
              +D   +   +++ +S     ++   +G+         L+ V L   P ++  + +YG 
Sbjct: 823  LLNDLRDLRSLVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGT 882

Query: 311  KISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXX 370
             +       + S   L     E + GI+TI+S  AE   I+ Y+     +  +  +    
Sbjct: 883  MLQKYETTYKTSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIA 942

Query: 371  XXXXXXXXXILGDMSFVIVLLYGANLVLQGALS---IGDLTAFMLYTEYTGSSVFGLSTF 427
                     ++      I+  YG  LV +G  S   + +    +L+T  T +S   L   
Sbjct: 943  TGFGISVTNMITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTS---LVNQ 999

Query: 428  YSELMKGAGAASRLFELMDHK-NSVRSNI-----SHALTPTQGK-----IEFRDVSFSYP 476
              ++ +G  +A+ L+ ++D    S  S       +  + P Q       I+ ++++F+YP
Sbjct: 1000 IPDISRGQRSATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNPLIKIQNLTFAYP 1059

Query: 477  TRPSNQIFKHMSFTIEPGS-NVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKF 535
            +  +  +++ ++  +      + +VG SG GKST+  LL + Y     SI +D  D++ +
Sbjct: 1060 SETNVNVYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDW 1119

Query: 536  TTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMD-EIRVVSKQCFCHGFITKFPDG 594
               +LR  + VV+Q+PTL  GT+R+N++YG+S T  +D E+  + K    + F+   P G
Sbjct: 1120 GLMNLRTQISVVEQKPTLFDGTVRENLSYGIS-TDILDMELFDMLKYVGIYEFVESLPFG 1178

Query: 595  YDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRS 654
             DT I  +   LSGGQ QRI IARAL++KPKILILDE TSALD  S   I   +      
Sbjct: 1179 LDTRIDTK--LLSGGQAQRICIARALLRKPKILILDECTSALDALSANIIIDIVKN--GP 1234

Query: 655  KELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDH 710
              L  I I H    + R+ N I V  +G ++E G F +L  N   EL K+++ ++ 
Sbjct: 1235 PALLTIVITHS-EKMMRACNTIAVLKNGKIIEKGGFKELV-NGNGELKKIIDLQEE 1288

 Score =  158 bits (399), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 151/571 (26%), Positives = 258/571 (45%), Gaps = 53/571 (9%)

Query: 215 IGERLVSRLRSQVIKRTMHHDIEFFDRN--------KVGDLISRFGSDAYVVSRSMTQNV 266
           +GER    +R ++++  +   I ++D N        ++   +    S +   S  + QN+
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSNDNLSGDFTQINRCVEELRSSSAEASAIIFQNL 161

Query: 267 SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL 326
                 I       G  F+ S +LT ++L  AP ++  A  +   I   +      +G  
Sbjct: 162 VSILALI-------GTSFYYSWSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKA 214

Query: 327 TRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSF 386
            ++A   ++ I+ +K +  + +E+R + +       +  +              L    F
Sbjct: 215 AQLANWAMDSIQLVKLYCTQFREVRNFRELTSNCNDLFIKCCLYVSANTALLRFLSLSMF 274

Query: 387 VIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM- 445
           +    +GA +V +G L I ++          GS++         L KG  A  ++   + 
Sbjct: 275 IQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGFLS 334

Query: 446 ---DHKNSVRSNISHALTPTQ-GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVG 501
              DH       I    TP +   I F +++FSYP+RPS+ + K++S   EP     I+G
Sbjct: 335 TSVDH--GADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIG 392

Query: 502 PSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN 561
            SG GKST+++LLL+FYD   G+I +  +D+ +     L  ++ VV+Q  TL + T+R+N
Sbjct: 393 KSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNN 452

Query: 562 ITYGLSYTPTMDEIRVVSK---QC---FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
           I  G+S     D   +  K    C        +   P G +T+IG  G SLSGGQ+QR+A
Sbjct: 453 ILLGVSKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVA 512

Query: 616 IARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENI 675
           IARA ++   ILILDEA SALD+     +   +    RS + TI+ + H LS I   +  
Sbjct: 513 IARAFMRNKPILILDEAVSALDIIHRELLMKNIRQ-WRSGKTTIL-LTHELSQIEPDDYT 570

Query: 676 IVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGL 735
            V+  +G V E G + K  + +++ +F      +H L  ++ N      DS    D + L
Sbjct: 571 YVI-QEGEVKENG-YQKDLKQKKTSVF------NHMLNLQTNNR-----DSYAISDRTAL 617

Query: 736 EHLVAEDVASINDKVVKNVLNDITHDKNSST 766
           E  + E+          N+  D T D +S +
Sbjct: 618 ETPIKEN----------NIFADTTIDSDSES 638

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 155/570 (27%), Positives = 267/570 (46%), Gaps = 61/570 (10%)

Query: 171  PIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKR 230
            P+   +A    +  LSI   +GI   AL  G      + V+  + G     R+  +++ +
Sbjct: 1096 PLKGKNATHTTLYYLSIYFAIGI-TQALFAGT-----KTVINFVAGINASRRIFKKLLSK 1149

Query: 231  TMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAII-CGGVGMGMMFHISST 289
             +H  + F D   +G +++RF  D   V + +T  +   F  ++ C    + + F     
Sbjct: 1150 VLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTIILITFITPQF 1209

Query: 290  LTSVMLLFAPPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVA 345
            L   +L+     LVG F         SR+L++    +   + +   E L G+ TI++F  
Sbjct: 1210 LFVAVLVCVLYYLVGYFYINT-----SRELKRIESITKSPIYQHFSETLTGVATIRAFGD 1264

Query: 346  EKKEI----RRYNDAIRQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQ 399
            E + I     + ++  +  FY  V  R             I G   F+++ L   N +  
Sbjct: 1265 EIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSGVFILLNL---NRIDS 1321

Query: 400  GALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMD------HKNSVRS 453
            G   I  LT  + +TE        L  FYS +     +  RL E MD      ++ ++ +
Sbjct: 1322 GMAGIS-LTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMDVPQEPYNEGTITT 1376

Query: 454  NISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSL 513
            + +    PT+GKIE +D+S  Y      ++ K +SF IEP + V IVG +G GKSTI + 
Sbjct: 1377 STNW---PTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGRTGAGKSTIITA 1432

Query: 514  LLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMD 573
            L RF +P  GSI ID  DI+    ++LRR + ++ Q+PTL +GTIR N+     Y P  +
Sbjct: 1433 LFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFGKY-PDEE 1491

Query: 574  EIRVVSKQCFCHG----------------FITKFPDGYDTVIGPRGASLSGGQRQRIAIA 617
              RV+ +                       + KF +  +  I   G +LS GQ+Q + +A
Sbjct: 1492 IFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLN-LENEITEGGNNLSQGQKQLMCLA 1550

Query: 618  RALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIV 677
            RAL++ PK+++LDEAT+++D  S+  I  T+  +      T+++IAHRL ++   + I+V
Sbjct: 1551 RALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYDKILV 1608

Query: 678  VGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            + + G V+E  +   L  ++ S  + +  +
Sbjct: 1609 M-DAGEVIEYDQPYTLLLDKNSHFYSMCEQ 1637

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 106/460 (23%), Positives = 200/460 (43%), Gaps = 32/460 (6%)

Query: 244 VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLV 303
           +G +I+    DA+ VS  +   +    +A++   V   +++ +      V +L    +++
Sbjct: 494 IGAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKLLGYAAIVGIL----IVI 548

Query: 304 GAFIYGKKISAISRQLQQSSGNLT--RVAE--EQLNGIRTIKSFVAEKK---EIRRYNDA 356
           G      K+ ++  + Q+ +  +T  R+ +  E L  IR IK F  E     EI    +A
Sbjct: 549 GMIPVNFKLVSLMGKYQKKALGITDKRIQKLNEALQAIRIIKFFSWEDNFFSEIDEIREA 608

Query: 357 IRQLFYVGKREXXXXXXXXXXXX--ILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYT 414
             Q+ Y+ K                I+   SF  V +Y    VL   ++   L  F L  
Sbjct: 609 EIQM-YINKAYAWAFSAFIWFLTPTIVTGASFT-VYIYVQKQVLTAPVAFTALALFQLLK 666

Query: 415 EYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFS 474
           +        LS   S +++   +  R+   +D +++ + N    + P   K+ F + + +
Sbjct: 667 QPLDQ----LSNMLSYVIQSKVSLDRVQNFLDEEDTQKYN-QLKVAPDGNKLAFENATIA 721

Query: 475 YPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISK 534
           +     +   K +    + G    ++GP+G GK+++   LL       G I++ + D   
Sbjct: 722 WSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARH 781

Query: 535 ---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTP-TMDEIRVVSKQCFCHGFITK 590
                +  +   +    Q   L++ T+R+NI   L Y+P   D  + V   C        
Sbjct: 782 EMLIDSDGMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVIIACGLKRDFEL 838

Query: 591 FPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTL 648
           F  G  T IG +G +LSGGQ+QRI++ARAL    + L+LD+  SA+D  +   I  N   
Sbjct: 839 FDAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCIT 898

Query: 649 GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           G LM  +  T + ++H ++   ++  ++V+  +G +   G
Sbjct: 899 GPLMEGR--TCVLVSHNIALTLKNAELVVMLENGRITNRG 936

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  167 bits (424), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 156/565 (27%), Positives = 261/565 (46%), Gaps = 73/565 (12%)

Query: 186  SITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            S   ++ I+    V+ A     + ++  I G     ++ + V+K+ ++  + FFD   +G
Sbjct: 1097 STLYYLAIYFAIGVLHAVIASSKTIINFIAGLNASRKIFNLVLKKVLYAKLRFFDSTPIG 1156

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLL--FAPPLLV 303
             +++RF  D   V + +T  V   F +++               L++V+L+    P  LV
Sbjct: 1157 RIMNRFSKDIEAVDQELTPFVEGAFVSLV-------------QCLSTVILIAYITPGFLV 1203

Query: 304  GA----FIY---GKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKK---- 348
             A    F+Y   G    A SR+L++    S   + +   E L GI TI++F  E++    
Sbjct: 1204 VAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRAFGDERRFMLE 1263

Query: 349  EIRRYNDAIRQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGD 406
             +++ ++  +  FY  V  R             +     F+++ +   +  L G      
Sbjct: 1264 NLQKIDENNKPFFYLWVANRWLAFRIDMIGACVVFAAGVFILLNIKKLDSGLAGI----S 1319

Query: 407  LTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM--DHKNSVRSNISHAL-TPTQ 463
            LT  + +TE        L   YS +     +  RL E M  + + S     +  +  P Q
Sbjct: 1320 LTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGAFNPPIEWPDQ 1375

Query: 464  GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYG 523
            GKIE  D+S  Y T    ++ K++SFT++P   V IVG +G GKSTI + L RF DP  G
Sbjct: 1376 GKIEVNDLSLRYATNLP-RVIKNVSFTVDPKCKVGIVGRTGAGKSTIITALFRFLDPETG 1434

Query: 524  SILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-----PTMDEIRVV 578
             I IDN DI+    K LR+ + ++ Q+PTL SGT++ N+     YT       +  + +V
Sbjct: 1435 HIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEYTDEQIFKALKRVNLV 1494

Query: 579  SKQCFCHGFITKFPDGYDTV----------------IGPRGASLSGGQRQRIAIARALIK 622
            +     H      PD  D                  I   GA+LS GQRQ + +AR+L++
Sbjct: 1495 TADELDH-----VPDSADNASVNSENVNKFLDLRNEITEGGANLSQGQRQLVCLARSLLR 1549

Query: 623  KPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDG 682
             PKI++LDEAT+++D  S+  I  T+       + TI++IAHRL +I   + I+V+ + G
Sbjct: 1550 SPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRSIIDYDKILVM-DAG 1606

Query: 683  SVVEVGKFDKLYRNEESELFKLLNE 707
             V E      L  N+ S  + +  +
Sbjct: 1607 EVREYDHPYSLLLNKSSIFYSMCED 1631

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 106/463 (22%), Positives = 213/463 (46%), Gaps = 38/463 (8%)

Query: 244 VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHI---SSTLTSVMLLFAPP 300
           +G +I+    DA+ VS  +   +    +A I   V + +++ +   ++ + +++++   P
Sbjct: 475 LGGIINLMAVDAFKVSE-ICAYLHAFVEATIMTIVALTLLYKLLGWAAVIGAILIVCMLP 533

Query: 301 LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN----GIRTIKSFVAEKKEIRRYNDA 356
           L         K++ +  +LQ+ +  +T    ++LN     IR IK F  E+    R   A
Sbjct: 534 L-------NFKLANLIGKLQKDNLGVTDKRIQKLNETFQSIRIIKFFSWEEN-FERDIKA 585

Query: 357 IR--QLFYVGKREXXXXXXXXXXX---XILGDMSFVIVLLYGANLVLQGALSIGDLTAFM 411
           IR  +L  + KR                I+  +SF   + Y    VL   ++   L+ F 
Sbjct: 586 IRTEELKILLKRSIVWALMSLVWFITPSIVTSVSFAFYI-YVQGEVLTTPIAFTALSLFT 644

Query: 412 LYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDV 471
           L      + +  LS   S +++   +  R+ E +D + + + N    LT ++ KI F + 
Sbjct: 645 LLR----NPLDQLSDMLSFVIQSKVSLDRVQEFLDEEETEKYN---QLTISRNKIAFENA 697

Query: 472 SFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD 531
           +F++  +  +   K+++   + G    ++G +G GK+++   LL   D   G + + + D
Sbjct: 698 TFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKVYVPSLD 757

Query: 532 ISK---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFI 588
             +     +  +   +    Q   L++ T+R+NI +   Y  T    + V + C      
Sbjct: 758 PREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNET--RYKAVVEACGLKRDF 815

Query: 589 TKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NY 646
                G  T IG +G +LSGGQ+QR+++ARAL    + ++LD+  SA+D  +   I  N 
Sbjct: 816 EILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTALWIYENC 875

Query: 647 TLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
             G LM+ +  T I ++H ++   ++   +VV ++G + + G+
Sbjct: 876 ITGPLMQGR--TCILVSHNVALTLKNAEWVVVLDNGRIKDQGE 916

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  167 bits (423), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 138/529 (26%), Positives = 252/529 (47%), Gaps = 46/529 (8%)

Query: 207  GRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNV 266
            G+ +L  + G     ++ + ++ + +H  + FFD    G +++RF  D   + + +T  +
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 267  SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL 326
               F ++I     + ++  I+    SV ++ +       + Y      + R    S   +
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSPI 1240

Query: 327  TRVAEEQLNGIRTIKSFVAE----KKEIRRYNDAIRQLFY--VGKREXXXXXXXXXXXXI 380
             +   E L G+ TI++F  E    ++ +++ ++  +  FY  V  R             I
Sbjct: 1241 YQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVI 1300

Query: 381  LGDMSFVIVLLYGANL-VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAAS 439
             G   F++     +N+  L   ++   LT  + +TE        L   YSE+     +  
Sbjct: 1301 FGAGLFIL-----SNIDHLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVE 1351

Query: 440  RLFELMDHKN---SVRSNISHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGS 495
            R+ E M+ +    +    +     P  GKIE  D+S  Y P  P  ++ K++SF+++  S
Sbjct: 1352 RVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQS 1409

Query: 496  NVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMS 555
             V IVG +G GKSTI + L RF +P+ G I IDN DIS    + LRR + ++ Q+PTL S
Sbjct: 1410 KVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLFS 1469

Query: 556  GTIRDNITYGLSYT-----PTMDEIRVVSKQCFCHGF---------------ITKFPDGY 595
            GTI+ N+     ++       +  + +VS++    G                + KF D  
Sbjct: 1470 GTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKFLD-L 1528

Query: 596  DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK 655
            ++ +   G++LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+    +  
Sbjct: 1529 ESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS 1588

Query: 656  ELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
              TI++IAHRL ++   + I+V+ + G V E      L  N++S  + +
Sbjct: 1589 --TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 128/273 (46%), Gaps = 16/273 (5%)

Query: 424 LSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQI 483
           LS   S +++   +  R+ + ++ K++ + +    + P   +  F + + S+     NQ 
Sbjct: 653 LSDMLSFVVQSKVSLDRVQDFLNEKDTEKYD-QLTIDPNGKRFAFENSTISWDK--DNQD 709

Query: 484 FKHMSFTIE--PGSNVCIVGPSGKGK-STITSLLLRFYDPNYGSILIDNHDISK---FTT 537
           FK     IE   G    ++GP+G GK S + +LL   Y  N G +++   D  +      
Sbjct: 710 FKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLN-GKVVVPALDPRQELVVEA 768

Query: 538 KSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDT 597
                 +    Q   L++ T+++NI +   +  T    + V + C           G  T
Sbjct: 769 NGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNET--RYKAVVEACGLKRDFEILKAGDLT 826

Query: 598 VIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSK 655
            IG +G +LSGGQ+QR+++ARAL    + ++LD+  SA+D  +   I  N   G LM  +
Sbjct: 827 EIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDR 886

Query: 656 ELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
             T I ++H ++   R+  ++V+  DG V + G
Sbjct: 887 --TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 163/642 (25%), Positives = 299/642 (46%), Gaps = 64/642 (9%)

Query: 111  WKLLAVAIG---LLSVSCTIGM-----AVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNE 162
            +K  AV  G   ++S  C I +     ++ +   L   A+ NTLK     G Q +     
Sbjct: 1006 YKWYAVFFGGWKMISFLCFIFLFAQMISISQAWWLRAWASNNTLKVFSNLGLQTMRPFAL 1065

Query: 163  DKESLIAGPIASLDALPPIVGTLSITQ-------FVGIFAGALVVGATANFGRVVLLKII 215
              +   A P+ +L A+ P     + T+       ++ I+ G  V  A  +  + ++  + 
Sbjct: 1066 SLQGKEASPV-TLSAVFPNGSLTTATEPNHSNAYYLSIYLGIGVFQALCSSSKAIINFVA 1124

Query: 216  GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
            G R   ++ + ++K  ++  + FFD   +G +++RF  D   + + +T  +   F ++I 
Sbjct: 1125 GIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSLIQ 1184

Query: 276  GGVGMGMMFHISSTL----TSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAE 331
                + ++ +I+         VMLLF       A+ Y      + R    S   + +   
Sbjct: 1185 CVSTIIVIAYITPQFLIVAAIVMLLF----YFVAYFYMSGARELKRLESMSRSPIHQHFS 1240

Query: 332  EQLNGIRTIKSFVAEKK----EIRRYNDAIRQLFY--VGKREXXXXXXXXXXXXILGDMS 385
            E L GI TI++F  E++     +++ +D  R  FY  V  R             +L   S
Sbjct: 1241 ETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRIELIGALIVLAAGS 1300

Query: 386  FVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFE-- 443
            F+++ +   +  L G +S+G         ++T  +++ +   YS +     +  RL E  
Sbjct: 1301 FILLNIKSIDSGLAG-ISLG------FAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYT 1352

Query: 444  -LMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPT-RPSNQIFKHMSFTIEPGSNVCIVG 501
             +    ++V + +     P  GKIE +D+S  Y    P  ++ K+++FT++    V IVG
Sbjct: 1353 TIEQEPSNVGALVPPCEWPQNGKIEVKDLSLRYAAGLP--KVIKNVTFTVDSKCKVGIVG 1410

Query: 502  PSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN 561
             +G GKSTI + L RF DP  G I ID+ DI+    K LR+ + ++ Q+PTL +GT++ N
Sbjct: 1411 RTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTN 1470

Query: 562  ITYGLSYT-----PTMDEIRVVSKQCFCH-----------GFITKFPDGYDTVIGPRGAS 605
            +     Y+       +  + +VS +   +             + KF D  +  +   G++
Sbjct: 1471 LDPYNEYSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLD-LENEVSEGGSN 1529

Query: 606  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHR 665
            LS GQRQ I +AR+L++ PK+++LDEAT+++D  S+  I  T+     +   TI++IAHR
Sbjct: 1530 LSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--TILTIAHR 1587

Query: 666  LSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            L +I   + I+V+ + G V E      L  N +S  + +  +
Sbjct: 1588 LRSIIDYDKILVM-DAGEVKEYDHPYSLLLNRDSIFYHMCED 1628

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 123/534 (23%), Positives = 238/534 (44%), Gaps = 50/534 (9%)

Query: 244 VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHI---SSTLTSVMLLFAPP 300
           +G +I+    DA+ VS  +   +    +AII   V + +++ +   S+ + S M++   P
Sbjct: 482 LGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALFLLYRLIGWSALVGSAMIICFLP 540

Query: 301 LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN----GIRTIKSFVAEK---KEIRRY 353
           L         K++++   LQ+ S  +T    ++LN     IR IK F  E+   K+I+  
Sbjct: 541 L-------NFKLASLLGTLQKKSLAITDKRIQKLNEAFQAIRIIKFFSWEENFEKDIQNT 593

Query: 354 NDAIRQLFYVGKREXXXXXXXXXXX---XILGDMSFVIVLLYGANLVLQGALSIGDLTAF 410
            D   +L  + KR                I+   SF  V +Y     L   ++   L+ F
Sbjct: 594 RD--EELNMLLKRSIVWALSSLVWFITPSIVTSASFA-VYIYVQGQTLTTPVAFTALSLF 650

Query: 411 MLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRD 470
            L      + +  LS   S +++   +  R+ E ++ + + +      LT ++ K+  ++
Sbjct: 651 ALLR----NPLDMLSDMLSFVIQSKVSLDRVQEFLNEEETKKY---EQLTVSRNKLGLQN 703

Query: 471 VSFSYPTRPSNQIFKHMSFTIE--PGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILID 528
            +F++    +NQ FK  + TI+   G    IVGP+G GK+++   LL   +   G + + 
Sbjct: 704 ATFTWDK--NNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELLNGKVFVP 761

Query: 529 NHDISK---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCH 585
           + +  +        +   +    Q   L++ T+R+NI +   Y    +    V   C   
Sbjct: 762 SLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNAPYNE--NRYNAVISACGLK 819

Query: 586 GFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI- 644
                   G  T IG +G +LSGGQ+QR+++AR+L    + L+LD+  SA+D  +   I 
Sbjct: 820 RDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDSHTALWIY 879

Query: 645 -NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN----EES 699
            N   G LM  +  T + ++H ++   ++ + +++  +G V E G+  +L +     ++S
Sbjct: 880 ENCITGPLMEGR--TCVLVSHNVALTLKNADWVIIMENGRVKEQGEPVELLQKGSLGDDS 937

Query: 700 ELFKLLNEKDHDLVSKSENTSDIP--PDSPKNDDASGLEHLVAEDVASINDKVV 751
            +   +  +    V+ SE  S I   P +P   D +  E     D +  + K++
Sbjct: 938 MVKSSILSRTASSVNISETNSKISSGPKAPAESDNANEESTTCGDRSKSSGKLI 991

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  165 bits (418), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 142/534 (26%), Positives = 252/534 (47%), Gaps = 56/534 (10%)

Query: 207  GRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNV 266
            G+ +L  + G     ++ + ++ + +H  I FFD    G +++RF  D   + + +T  +
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 267  SDGFKAII-CGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG-----KKISAISRQLQ 320
               F ++I C    + + F     L+  +++      VG F        K+  +ISR   
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISR--- 1237

Query: 321  QSSGNLTRVAEEQLNGIRTIKSFVAE----KKEIRRYNDAIRQLFY--VGKREXXXXXXX 374
                 + +   E L G+ TI++F  E    ++ +++ ++  +  FY  V  R        
Sbjct: 1238 ---SPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDM 1294

Query: 375  XXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKG 434
                 I G   F+   L+  N +  G   I  LT  + +TE        L   Y+E+   
Sbjct: 1295 IGSLVIFGAGLFI---LFNINHLDSGMAGIS-LTYAISFTE----GALWLVRLYAEVEMN 1346

Query: 435  AGAASRLFELMDHKN---SVRSNISHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFT 490
              +  R+ E M+ +    +    +     P  GKIE  D+S  Y P  P  ++ K++SF+
Sbjct: 1347 MNSVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFS 1404

Query: 491  IEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQE 550
            ++  S + IVG +G GKSTI + L RF +P  G I IDN DIS    + LRR + ++ Q+
Sbjct: 1405 VDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQD 1464

Query: 551  PTLMSGTIRDNITYGLSYT-----PTMDEIRVVSKQCFCHGF---------------ITK 590
            PTL SGTI+ N+     ++       +  + ++S++    G                + K
Sbjct: 1465 PTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSENVNK 1524

Query: 591  FPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGT 650
            F D   + +   G++LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+  
Sbjct: 1525 FLD-LSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRK 1583

Query: 651  LMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
              +    TI++IAHRL ++   + I+V+ + G V E      L  N++S  + +
Sbjct: 1584 EFQGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 119/536 (22%), Positives = 218/536 (40%), Gaps = 52/536 (9%)

Query: 188 TQFVGIFAGALVVGATANFGRVVLLK----IIGERLVSRLRSQVI--------------- 228
           T FVG    A+       FGR V ++    II E     LR ++                
Sbjct: 399 TMFVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPINEDPQEIN 458

Query: 229 -KRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHIS 287
            +++++ D E      +G +I+    DA+ VS  +   +    +A +   V + +++ + 
Sbjct: 459 DQKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLL 517

Query: 288 STLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEK 347
                V +L    +L   +   K I  + ++    + N  +   E    IR IK F  E+
Sbjct: 518 GFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEE 577

Query: 348 KEIRRYNDAIRQ-----LFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGAL 402
              +  N AIR+     L                   I+   SF    +Y    VL   +
Sbjct: 578 NFEKDIN-AIRENELSLLLMRSIVWSISSFVWFVTPTIVTAASFA-YYIYVQGEVLTTPV 635

Query: 403 SIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPT 462
           +   L+ F L  +     +  LS   S +++   +  R+ + ++ K++ + +    + P 
Sbjct: 636 AFTALSLFTLLRD----PLDRLSDMLSFVVQSKVSLDRVQDFLNEKDTKKYD-QLTIDPN 690

Query: 463 QGKIEFRDVSFSYPTRPSNQIFKHMSFTIE--PGSNVCIVGPSGKGKSTITSLLLRFYDP 520
             +  F + + S+     NQ FK     IE   G    ++GP+G GK   TSLL+     
Sbjct: 691 GKRFAFENSTISWDK--DNQDFKLKDLNIEFKTGKLNVVIGPTGSGK---TSLLMALLGE 745

Query: 521 NY---GSILIDNHDISK---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE 574
            Y   G +++   +  +            +    Q   L++ T+++NI +   +      
Sbjct: 746 MYLLSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEA--R 803

Query: 575 IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATS 634
            + V + C           G  T IG +G +LSGGQ+QR+++ARAL    + ++LD+  S
Sbjct: 804 YKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLS 863

Query: 635 ALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           A+D  +   I  N   G LM  +  T I ++H ++   R+  ++V+  DG V + G
Sbjct: 864 AVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  163 bits (413), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 144/535 (26%), Positives = 247/535 (46%), Gaps = 52/535 (9%)

Query: 208  RVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVS 267
            +V+L  I G +   ++ + ++K+ ++  + FFD    G +++RF  D   +   +     
Sbjct: 1144 KVILSYISGLKASRKIFTLLLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFE 1203

Query: 268  DGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQ----SS 323
              F +++     + ++ +I    T V L FA  + V  +I G      SR+LQ+    + 
Sbjct: 1204 GAFASLVQCITTILLIGYI----TPVFLFFAIVICVSYYIVGYFYLVGSRELQRFESITK 1259

Query: 324  GNLTRVAEEQLNGIRTIKSFVAEKK----EIRRYNDAIRQLFY--VGKREXXXXXXXXXX 377
              + +   E L G+ TI++F  E++     + + +   R  FY  V  R           
Sbjct: 1260 SPIHQHFSETLVGVTTIRAFGDERRFLADNLSKVDTHNRPFFYLWVTNRWLAFRIDFIGA 1319

Query: 378  XXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGA 437
              IL    F+   L   N +  G   I      ++Y          L   YS +     +
Sbjct: 1320 FVILASGIFI---LLNVNSLDAGLAGIS-----LIYAISFTEGALWLVRLYSNVEMTMNS 1371

Query: 438  ASRLFELMDHKNSVRSNISHA--LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGS 495
              RL E M  +    + +       P +GKIE  ++S  Y +    ++ K+++FT+EP S
Sbjct: 1372 VERLKEYMKIEQEPSTGLYEPPPEWPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQS 1430

Query: 496  NVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMS 555
             V IVG +G GKSTI + L RF DP+ G+I +DN DI+    K LR+ + ++ Q+P L +
Sbjct: 1431 KVGIVGRTGAGKSTIITALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFA 1490

Query: 556  GTIRDNITYGLSY--------------------TPTMDEIRVVSKQCFCHGFITKFPDGY 595
            GTI+ N+     Y                    TPT D     S   F +  + KF D  
Sbjct: 1491 GTIKSNLDPYSEYADDRIFEALKRVNLIVQEELTPT-DIPSSSSSLSFEN--VNKFLD-L 1546

Query: 596  DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK 655
             + I   G++LS GQRQ + +AR+L++ PK ++LDEAT+++D  S+  I  T+       
Sbjct: 1547 TSEITEGGSNLSQGQRQLVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIREEFSGS 1606

Query: 656  ELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDH 710
              TI++IAHRL +I   + ++V+ + G + E      L  N+ S  +++  + D 
Sbjct: 1607 --TILTIAHRLRSIIDYDKVLVI-DSGELAEYDHPYTLLLNKGSLFYRMCEDSDE 1658

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 141/310 (45%), Gaps = 26/310 (8%)

Query: 459  LTPTQGKIEFRDVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRF 517
            LT  + ++ F + +  +    +     K+++   + G    IVGP+G GK+++   LL  
Sbjct: 704  LTVKKDRLGFSNATIGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGE 763

Query: 518  YDPNYGSILIDNHDISK---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE 574
             + + G I +   +  +        +   +G   Q   L++ T+R+NI +   Y    + 
Sbjct: 764  INLSEGKIYVPALNPREDLVVDADGMTDSIGYCSQSAWLLNDTLRNNILFSAPYEA--NR 821

Query: 575  IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATS 634
               V   C     +     G  T +G +G +LSGGQ+QR+++ARA+  + + ++LD+  S
Sbjct: 822  YNAVIHACGLTRDLEILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLS 881

Query: 635  ALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDK 692
            A+D  +   I  +   G LM  +  T + ++H  +   ++ + +V+  +  V   G    
Sbjct: 882  AVDSHTAQWIYKHCITGPLMEGR--TCVLVSHNTALTLKNADWVVILENAKVTAQG---- 935

Query: 693  LYRNEESELFK--LLNEKD---HDLVSKSENTSDIPP-DSPKNDDASGLEH--LVAEDVA 744
                E  ELF   LL E D     L+S   ++ ++   D  ++D   G  H  +  E ++
Sbjct: 936  ----EPLELFNRGLLGEDDLLKSSLMSTKTSSVNLKRMDDNRSDLDLGKLHKKISKEGIS 991

Query: 745  SINDKVVKNV 754
            SIN    K+V
Sbjct: 992  SINGATQKSV 1001

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 142/534 (26%), Positives = 249/534 (46%), Gaps = 56/534 (10%)

Query: 207  GRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNV 266
            G+ +L    G     ++ + ++ + +H  I FFD    G +++RF  D   + + +T  +
Sbjct: 1121 GKTILNFAAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 267  SDGFKAII-CGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG-----KKISAISRQLQ 320
               F ++I C    + + F     L+  +++      VG F        K+  +ISR   
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISR--- 1237

Query: 321  QSSGNLTRVAEEQLNGIRTIKSFVAE----KKEIRRYNDAIRQLFY--VGKREXXXXXXX 374
                 + +   E L G+ TI++F  E    ++ +++ ++  +  FY  V  R        
Sbjct: 1238 ---SPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDM 1294

Query: 375  XXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKG 434
                 I G   F+   L+  + +  G   I  LT  + +TE        L   YSE+   
Sbjct: 1295 IGSLVIFGAGLFI---LFNIDHIDSGMAGIS-LTYAISFTE----GALWLVRLYSEVEMN 1346

Query: 435  AGAASRLFELM---DHKNSVRSNISHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFT 490
              +  R+ E M       +    +  +  P  GKIE  D+S  Y P  P  ++  ++SF+
Sbjct: 1347 MNSVERVKEYMKIEQEPYNQHKEVPPSQWPQDGKIEVNDLSLRYAPNLP--RVINNVSFS 1404

Query: 491  IEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQE 550
            ++  S + IVG +G GKSTI + L RF +P  G I IDN DIS    + LRR + ++ Q+
Sbjct: 1405 VDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQD 1464

Query: 551  PTLMSGTIRDNITYGLSYT-----PTMDEIRVVSKQCFCHGF---------------ITK 590
            PTL SGTI+ N+     ++       +  + ++S++    G                I K
Sbjct: 1465 PTLFSGTIKTNLDPYDEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSENINK 1524

Query: 591  FPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGT 650
            F D   + +   G++LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+  
Sbjct: 1525 FLD-LSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK 1583

Query: 651  LMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
              +    TI++IAHRL ++   + I+V+ + G V E      L  N++S  + +
Sbjct: 1584 EFQGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 121/538 (22%), Positives = 220/538 (40%), Gaps = 56/538 (10%)

Query: 188 TQFVGIFAGALVVGATANFGRVVLLK----IIGERLVSRLRSQVI--------------- 228
           T FVG    A+       FGR V ++    II E     LR  +                
Sbjct: 399 TMFVGRILVAVCQAQALFFGRRVCIRMKSIIISEIYTKALRRMISTNKAKPTNEDPQEIN 458

Query: 229 -KRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHIS 287
            +++++ D E      +G +I+    DA+ VS  +   +    +A +   V + +++H+ 
Sbjct: 459 DQKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYHLL 517

Query: 288 STLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEK 347
                V +L    +L   +   K I  + ++    + N  +   E    IR IK F  E+
Sbjct: 518 GFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEE 577

Query: 348 ---KEIR--RYNDA----IRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVL 398
              KEI   R N+     +R + +                 I+   SF    +Y    VL
Sbjct: 578 NFEKEINTIRENELSLLLMRSIIW-----SISSFVWFVTPTIVTAASFA-YYIYVQGEVL 631

Query: 399 QGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHA 458
              ++   L+ F L  +     +  LS   S +++   +  R+ + ++ K++ + +    
Sbjct: 632 TTPVAFTALSLFTLLRD----PLDRLSDMLSFVVQSKVSLDRVQDFLNEKDTKKYD-QLT 686

Query: 459 LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIE--PGSNVCIVGPSGKGK-STITSLLL 515
           + P   +    + + S+     NQ FK     IE   G    ++GP+G GK S + +LL 
Sbjct: 687 IDPNGKRFALENSTISWDK--DNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLG 744

Query: 516 RFYDPNYGSILIDNHDISK---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTM 572
             Y  N G I++   +  +            +    Q   L++ TI+ NI +   +    
Sbjct: 745 EMYLLN-GKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILFNSPFNEA- 802

Query: 573 DEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEA 632
              + V + C           G  T IG +G +LSGGQ+QR+++ARAL    + ++LD+ 
Sbjct: 803 -RYKAVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDC 861

Query: 633 TSALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
            SA+D  +   I  N   G LM  +  T I ++H ++   R+  ++V+  DG + + G
Sbjct: 862 LSAVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRIKDQG 917

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 150/517 (29%), Positives = 239/517 (46%), Gaps = 42/517 (8%)

Query: 210  VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269
            V   I G R +  L +  + R     + FF+   +G +++RF +D Y V   + +  S  
Sbjct: 1018 VFCTIQGSRYLHTLMTNAVLRA---PMSFFETTPIGRILNRFSNDIYKVDSVLGRTFSQF 1074

Query: 270  FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329
            F       V +     +    T   +    PL V    Y +     SR+L++   ++TR 
Sbjct: 1075 F----VNAVKVSFTIGVICVTTWQFIFVIVPLGVFYIYYQQYYLRTSRELRRLD-SITRS 1129

Query: 330  A-----EEQLNGIRTIKSFVAEKKEIRRYN----DAIRQLFYV---GKREXXXXXXXXXX 377
                  +E L GI TI+ +  ++K   + N    D     FY      R           
Sbjct: 1130 PVYSHFQETLGGIVTIRGY-GQQKRFSQINQCRVDNNMSAFYPSVNANRWLAYRLELIGS 1188

Query: 378  XXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGA 437
              ILG  +  ++ L       QG L+ G +   + Y      S+  +     E+     +
Sbjct: 1189 IIILGAATLSVMRLK------QGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVS 1242

Query: 438  ASRLFELMDHKNS----VRSNISHALTPTQGKIEFRDVSFSYPTRPS-NQIFKHMSFTIE 492
              R+ E  D K+     +  +      P +G I+F   S  Y  RP  + + K ++F I+
Sbjct: 1243 VERIKEYADLKSEAPEIIEDHRPQETWPEEGDIKFEHYSTRY--RPELDLVLKDINFHIK 1300

Query: 493  PGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPT 552
            P   + IVG +G GKS++T  L R  + + G+I+IDN DIS      LR  L ++ Q+  
Sbjct: 1301 PKEKIGIVGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQ 1360

Query: 553  LMSGTIRDNITYGLSYTPTMDE--IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQ 610
            +  GTIR+NI     YT   DE   RV+          T   DG DT +   G++LS GQ
Sbjct: 1361 VFEGTIRENIDPTNQYT---DEQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQ 1417

Query: 611  RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIR 670
            RQ + +ARAL+   KIL+LDEAT+A+DVE++  +  T+ T  + +  TI++IAHR++TI 
Sbjct: 1418 RQLMCLARALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILTIAHRINTIM 1475

Query: 671  RSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
             ++ I+V+ N GS+ E  +  KL  N+ S  + L  E
Sbjct: 1476 DNDRIMVLDN-GSIKEFDEPKKLLENKSSLFYSLCEE 1511

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 120/500 (24%), Positives = 221/500 (44%), Gaps = 58/500 (11%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQSSGNL----TRVAEEQ 333
           F I   L S+  L    + VG  I          +    ++LQ+S        TRV  E 
Sbjct: 430 FQIVLCLISLYKLLGHSMWVGVIILVIMMPLNSFLMKTQKKLQKSQMQFKDERTRVISEI 489

Query: 334 LNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN I+++K +  E     K E  R N  ++ L  +G               ++   +F  
Sbjct: 490 LNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLVSCSTFA- 548

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           V +Y  +  L   L    LT F L        +  +    + L++ + +  RLF  + ++
Sbjct: 549 VFVYTEDRPLTTDLVFPALTLFNL----LHFPLMVIPNVLTALIECSVSVGRLFSFLTNE 604

Query: 449 NSVRSNISHALTPTQ-GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPS 503
              + ++      T+ G +      D +F +  +P  ++  K+++F  + G   CIVG  
Sbjct: 605 ELQKDSVQRLPKVTEIGDVAINVGDDATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRV 664

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKS +             SIL D   +  F T  +  ++  V Q   +M+GT++DNI 
Sbjct: 665 GSGKSALIQ-----------SILGDLFRVKGFAT--IHGNVAYVSQVAWIMNGTVKDNIL 711

Query: 564 YGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
           +G  Y     E  +  K C     ++   DG  T++G +G SLSGGQ+ R+++ARA+  +
Sbjct: 712 FGHKYDAEFYEKTI--KACALTIDLSVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSR 769

Query: 624 PKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVGN 680
               +LD+  +A+D   +   I + LG   L+ +K  T +   +++S +  ++++ ++ N
Sbjct: 770 ADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TKVLATNKVSVLSVADSVSLLEN 827

Query: 681 DGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDS----------PKND 730
            G +V+ G +D++ ++  S+L KL+ E          +++ I P S          P  D
Sbjct: 828 -GEIVQQGSYDEIMKDGASQLNKLIMEYGKKSNGNPASSNAITPASSSTNIREQTIPLED 886

Query: 731 DASGLEHLVAEDVASINDKV 750
           +   L+ L  ED+  + ++V
Sbjct: 887 ELKELKKL--EDINLVGNEV 904

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  160 bits (406), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 143/538 (26%), Positives = 258/538 (47%), Gaps = 49/538 (9%)

Query: 187  ITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGD 246
            I +F+ ++    V+ +     +  +  + G R    +   ++ R +H  + FFD   +G 
Sbjct: 1089 IAKFLVVYCLIGVMSSIIGSIKTFVNSLFGIRASKLIFDSLLDRVLHARVRFFDSTPIGR 1148

Query: 247  LISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF 306
            +++RF  D   + + +  N+   F + I     + ++ +I+     V ++    +++G  
Sbjct: 1149 IMNRFSKDIESIDQEIPPNIQSVFYSAIEVFATLLLISYITPAFFPVAII----IVLGYS 1204

Query: 307  IYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQ--- 359
            I G      SR+L++    S   + +   E L G+ TI++F  E++ I+     I Q   
Sbjct: 1205 IVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRAFGDEQRFIKENLSMIDQNSM 1264

Query: 360  -LFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTG 418
              FY+                ++   S V +LL   N+     L+   LT  + +TE   
Sbjct: 1265 PFFYLWVVNRWLSFRIDLIGALVIFSSGVFILLNINNI--DAGLAGISLTYAISFTE--- 1319

Query: 419  SSVFGLSTFYSELMKGAGAASRLFELMD-HKNSVRSNISHALTPT-----QGKIEFRDVS 472
             +   L   YSEL     +  R+ E M+  +  + ++ ++A+TP       GK+E  ++S
Sbjct: 1320 -AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIADPANAVTPPPQWPDSGKVEVNNLS 1378

Query: 473  FSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD 531
              Y P  P   + K ++FTIEP   V IVG +G GKSTI + L RF + + GSI +D  +
Sbjct: 1379 LKYAPHLP--YVIKDVTFTIEPLEKVGIVGRTGAGKSTIITALFRFLEADTGSIKLDGVN 1436

Query: 532  ISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-----PTMDEIRVVSK------ 580
            I+    K LRR + ++ Q+PTL +G+IR N+     Y+       +  + +VS       
Sbjct: 1437 IANIDLKRLRRSITIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEMEAS 1496

Query: 581  ----QCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
                Q      + KF +  ++ I   G++ S GQRQ + +AR+L++ PK+++LDEAT+++
Sbjct: 1497 TSEIQSNSSKNVNKFLN-LESEIAEGGSNFSQGQRQLMCLARSLLRMPKVILLDEATASI 1555

Query: 637  DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY 694
            D  S+  I  T+     +   T+++IAHRL +I   + I+V+       EV +FD  Y
Sbjct: 1556 DYNSDAKIQETIRQEFNNS--TVLTIAHRLRSIVDYDKILVMDAG----EVKEFDHPY 1607

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 108/232 (46%), Gaps = 15/232 (6%)

Query: 465 KIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGS 524
           ++ F +V+  + +   + + +++      G    IVG +G GK++I   LL     + G 
Sbjct: 705 RLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGK 764

Query: 525 ILIDN----HDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR--VV 578
           I++ +    H+        +   +    Q   L++ T+R+NI +   +    D+ R   V
Sbjct: 765 IIVPSLSPRHEYQS-QAGVINDSIAYCSQAAWLLNDTVRNNILFNAPF----DQARYDAV 819

Query: 579 SKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
            + C           G  T IG +G +LSGGQ+QR+++ARAL      L+LD+  SA+D 
Sbjct: 820 VEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDS 879

Query: 639 ESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
            +   I      G LM  +  T I + H ++   ++ + +V+  DG V E G
Sbjct: 880 HTALWIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKG 929

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  160 bits (405), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 155/554 (27%), Positives = 255/554 (46%), Gaps = 66/554 (11%)

Query: 186  SITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            S + ++G+++  +  G      +  LL  IG R    L  + + R +H  + + D   +G
Sbjct: 947  STSFYMGLYSFFVFAGYLFTSSQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLG 1006

Query: 246  DLISRFGSDAYVVSRSMTQNVSDG-FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
             +++RF  D   +   +T+++    F+     GV +  + ++     ++  LF    L+ 
Sbjct: 1007 RILNRFTKDTDSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAIAIPFLFIGFTLIT 1066

Query: 305  AFIYG-----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQ 359
                      K++ AI R    ++ N      E L G+ TIKS+ +E++ + + +  I +
Sbjct: 1067 DHYQSTGREVKRLEAIQRSFVYNNFN------EILGGMDTIKSYGSEERFLAKSDYLINK 1120

Query: 360  LFYVGKREXXXXXXXXXXXXILG-DMSFVIVLLYGANLVLQGALSIGDLTAFMLY----- 413
            +   G               ++    + +I LL         A+S+G L  ++L      
Sbjct: 1121 MNEAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQLPGLL 1180

Query: 414  ---------TEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQG 464
                     TE   +S   L ++ +EL     AA R  E+   +N           P++G
Sbjct: 1181 NGVLRALTQTENDMNSAERLVSYATEL--PLEAAYRRPEVSPPEN----------WPSEG 1228

Query: 465  KIEFRDVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYG 523
            KIEF+ V FSY  RP   I  K +   I+ G  + I G +G GKSTI S L R  + + G
Sbjct: 1229 KIEFKHVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQG 1286

Query: 524  SILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN----------------ITYGLS 567
             ILIDN DISK     LRR L ++ Q+P L  GTIR N                +  G  
Sbjct: 1287 EILIDNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHDDDLLWDSLVRGGAI 1346

Query: 568  YTPTMDEIR--VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPK 625
                +++I+   V K    H  + KF    D ++   GA+ S G+RQ +A+ RAL+++ K
Sbjct: 1347 ERAALNKIKNQKVDKDG-THADMFKF--HLDQLVEEEGANFSLGERQLLALTRALVRQAK 1403

Query: 626  ILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVV 685
            +LILDEATS++D E++G I   +  +    + TI+ IAHRL+TI   + I+V+   G V 
Sbjct: 1404 VLILDEATSSVDYETDGKIQARI--VKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVA 1460

Query: 686  EVGKFDKLYRNEES 699
            E  K   L+  E+S
Sbjct: 1461 EFEKPKVLFDQEDS 1474

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 117/241 (48%), Gaps = 25/241 (10%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F  ++  I+ G  + +VGP G GK++  + L  F +   G I + N D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQV-NGDL----------- 674

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
             ++   P + + T+RDNI +G  Y     E   V + C     +   P G  T IG RG
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIIS 661
            +LSGGQ+ RI +AR + KK  I + D+  SA+D      I     LG L   K  T I 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLL---KNETRIL 787

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSD 721
             H+LS + R+  +IV+G DGS  E+G  D L R  ++ L  LL   + +  SK E+T +
Sbjct: 788 ATHQLSLLERASRVIVLGTDGS-FEIGPVDVLKRTNQT-LINLLLFSNQE--SKEEDTEN 843

Query: 722 I 722
           I
Sbjct: 844 I 844

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 135/515 (26%), Positives = 234/515 (45%), Gaps = 27/515 (5%)

Query: 206  FGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFD--RNKVGDLISRFGSDAYVVSRSMT 263
            F +  +L   GE  +  LR    +  M  D  +F    N   ++ S   +D     R + 
Sbjct: 790  FLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL----RDLR 845

Query: 264  QNVSDGFKAI----ICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQL 319
               S+   A+    +    G+         L+ V +   P  ++ + IYG  +     + 
Sbjct: 846  ALASEFLAALSTLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARY 905

Query: 320  QQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXX 379
            +     L     + +  ++TIK    E K  R Y           ++             
Sbjct: 906  KTCIAELENELYKAIRCMKTIKCLQMENKVARSYEMLEVTSKGAARKRAMGTGFGVASSN 965

Query: 380  ILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAAS 439
             L  ++  I+L +G  LV+ G  + G +   +    +T  +   L +   E+ +G  AA+
Sbjct: 966  ALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAAT 1025

Query: 440  RLFELMDHKNSVRSNI---SHA----LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIE 492
             LF+L  +++   +++    HA        Q  I  + + FSY    +  ++K++S  ++
Sbjct: 1026 YLFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKNLSLKVD 1085

Query: 493  PGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPT 552
             G  V ++G SG GKST+ SLL R Y    GSI ID  DI+++  K+LR  + VV+Q+P 
Sbjct: 1086 RGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKPL 1145

Query: 553  LMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQ 612
              SG+I +N+TYGL    + +E+  +        F+   P    +VI  +   LSGGQ Q
Sbjct: 1146 FFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LLSGGQVQ 1203

Query: 613  RIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK--ELTIISIAHRLSTIR 670
            R+AI RAL++KP++L+LDE TSALD       ++ +   ++      T + + H    +R
Sbjct: 1204 RLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSEQMMR 1259

Query: 671  RSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLL 705
                I+   N G +VE G  D L+ N++ EL+++L
Sbjct: 1260 SCHRILTF-NKGEIVEEGSIDNLF-NQKGELYRIL 1292

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 168/645 (26%), Positives = 288/645 (44%), Gaps = 63/645 (9%)

Query: 110 DWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIA 169
           DW LL + I + SV+  I   VP V  +++ A  N L+       Q  + VN     L  
Sbjct: 25  DWWLLMI-ISICSVAYGI---VPAVTSILMGAVFNLLQKPV---IQQFDSVNTLMRDLTI 77

Query: 170 GPIASLDALPPIVGTLSIT-QFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVI 228
             +A L     I G  SI   ++ I+A                   +GER   RLR +++
Sbjct: 78  RTMAIL-----ITGIASIPFCWLSIYAWM----------------SLGERQGFRLRRKLL 116

Query: 229 KRTMHHDIEFFDRN-KVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHIS 287
           +      + ++D N ++    ++       +  S  +  +  F+ ++     +G   + S
Sbjct: 117 RSYFEKSMAWYDINEQISGEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYS 176

Query: 288 STLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTR-VAEEQLNGIRTIKSFVAE 346
            +LT V++    PL++G  IY  +      +++ S  ++   +    LN  + ++    +
Sbjct: 177 WSLTLVIMA-NSPLVIGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQ 235

Query: 347 KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGD 406
             EI ++  ++ +      +              L    FV    YG   +  G L  GD
Sbjct: 236 DYEIAKFRASVLKCRMNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGD 295

Query: 407 -LTAF---MLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDH-----KNSVRSNISH 457
            +T F   +L      S++  + T    L KGA    ++ E +       K  V +++  
Sbjct: 296 VMTCFSSCILLASTLNSTLHQVVT----LQKGAVGLKKIQEFLTSDVVQGKECVVNSMHL 351

Query: 458 ALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRF 517
            L   Q +I F +VSF+YP+R  + + K+++  +  G    IVG SG GKSTI++LLL+ 
Sbjct: 352 PLLWEQAQISFENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKL 411

Query: 518 YDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR- 576
           Y P  G I +++ DI +   + L R + +V+Q   L   +I++NI        T DE R 
Sbjct: 412 YRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQL------TSDEHRD 465

Query: 577 --VVSKQC---FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDE 631
              +S+ C      G I     G DT+IG  G  LSGG++QR+A+ARA ++   ILILDE
Sbjct: 466 DGRLSQACQAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDE 525

Query: 632 ATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
           A SA D   +  +   +    R    TII + H L+ I   ++ +++  DG+V+E G+  
Sbjct: 526 ALSAQDRMHKDLLMEAI-RFWRKGRTTII-LTHELNDILE-DDFVLLMEDGNVIERGQKS 582

Query: 692 KLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLE 736
            L  +  S+ F LL+     L  + E+ +    DS +    + LE
Sbjct: 583 DLLSDSTSK-FSLLHA--FQLCDEIEDEASTITDSNRLSLGAKLE 624

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 151/558 (27%), Positives = 259/558 (46%), Gaps = 65/558 (11%)

Query: 190  FVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLIS 249
            ++ I+ G  V+ ++    + +L    G     ++ + ++K ++H  + FFD   +G +++
Sbjct: 1137 YLSIYFGIGVLHSSIFAIKDILCTYAGLAASRKMFNSLLKNSLHAKLRFFDSTPLGRIMN 1196

Query: 250  RFGSDAYVVSRSMTQNVSDGFKAII-CGGVGMGMMFHISSTLTSVMLLFAPPLLVGA-FI 307
            RF  D   V + +   +   F  ++ C  + + +       L   + +      VGA +I
Sbjct: 1197 RFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLITLITPQFLGVAIFIAVFYWFVGAVYI 1256

Query: 308  YGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAI----RQ 359
             G      SR+L++    +   + +   E L GI T++++  E + +R   + I    + 
Sbjct: 1257 SG------SRELKRFDSITKSPIYQHFSETLAGITTVRAYGDESRFMRENLEKIDENNKP 1310

Query: 360  LFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYT 417
             FY  V  R             ILG   F I   +  N +  G   I  LT  + +++  
Sbjct: 1311 FFYMWVSNRWLSFRTQIIGAFVILGAGGFSI---WNINKIDSGLAGIS-LTYALTFSD-- 1364

Query: 418  GSSVFGLSTFYSELMKGAGAASRLFELM--DHKNSVRSNISH-ALTPTQGKIEFRDVSFS 474
              +   L  FY +      +  R+ E M  D +      +   A  P  GKIE  DVS  
Sbjct: 1365 --AALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPADWPENGKIEINDVSLR 1422

Query: 475  Y-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
            Y P  P  ++ K++SFT++  S V IVG +G GKSTI + L RF +P  G+I IDN DI 
Sbjct: 1423 YAPNLP--RVIKNVSFTVDSKSKVGIVGRTGAGKSTIITALFRFLEPETGNIKIDNIDIV 1480

Query: 534  KFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE--------IRVVSKQCFCH 585
                + LRR + ++ Q+PTL +GTIR N+     YT   D+        + +VS++    
Sbjct: 1481 SIDLQKLRRSISIIPQDPTLFTGTIRSNLD---PYTQYSDKEIFDSLICVNLVSREELAQ 1537

Query: 586  GFITKFPDGYDTV----------------IGPRGASLSGGQRQRIAIARALIKKPKILIL 629
                + P   DT                 +   G+++S GQRQ + +AR+L+ KPKI++L
Sbjct: 1538 ---VQSPSSNDTSSIVSENFNHFLDLEYNVSEGGSNISQGQRQLLCLARSLLGKPKIILL 1594

Query: 630  DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
            DEAT+++D ES+  I  T+     +   TI++IAHRL ++   + I+V+ + G V E   
Sbjct: 1595 DEATASIDYESDKKIQETIRNEFGNS--TILTIAHRLRSVIDYDKILVM-DAGEVEEYDH 1651

Query: 690  FDKLYRNEESELFKLLNE 707
               L  N+ S  + +  +
Sbjct: 1652 PYSLLLNKNSIFYSMCEQ 1669

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 113/235 (48%), Gaps = 17/235 (7%)

Query: 463 QGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNY 522
           + K+ F++ + S+     +   +++    + G    ++GP+G GK+++   LL       
Sbjct: 755 KNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTE 814

Query: 523 GSILIDN----HDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVV 578
           G I I +    HD+    +      +    Q   L++ T+R+NI +   Y     +  +V
Sbjct: 815 GQINIPSLDPRHDLI-IESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYNKDRYDAAIV 873

Query: 579 SKQCFCHGFITKF---PDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSA 635
           +      G    F     G  T IG RG +LSGGQ+QRI++ARAL    + ++LD+  SA
Sbjct: 874 AA-----GLKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSA 928

Query: 636 LDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           +D  +   I  N   G LM  +  T + ++H ++   ++ +++V+  +G V + G
Sbjct: 929 VDAHTAAWIYDNCISGPLMEGR--TCVLVSHNIALTLKNASLVVMLKNGRVADQG 981

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  159 bits (401), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 141/513 (27%), Positives = 251/513 (48%), Gaps = 56/513 (10%)

Query: 227  VIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHI 286
            ++ + +H  + FFD   +G +++RF  D   + + +T  V    ++++   V +     +
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYV----ESVVYNSVQLIATVLL 1191

Query: 287  SSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKS 342
             + +T+  ++ A  +++  +  G    + SR+L++    +   + +   E L G+ TI++
Sbjct: 1192 ITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRA 1251

Query: 343  FVAE----KKEIRRYNDAIRQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
            +  E    K+ + + ++  +  FY  V  R             I G  + V+VL+   N 
Sbjct: 1252 YGDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFG--AGVLVLM-NINK 1308

Query: 397  VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRS--- 453
            +  G   I  LT  + +TE    S   L   YS +     +  R+ E MD +    S   
Sbjct: 1309 IDSGLAGIS-LTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQEPYSAGI 1363

Query: 454  -NISHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTIT 511
             N+  +  P++GKIE  D+S  Y P+ P  ++ K++SFT+EP   V +VG +G GKSTI 
Sbjct: 1364 VNVDKSW-PSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGKSTII 1420

Query: 512  SLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPT 571
            + L RF DP  G I IDN DI+    K LR+ + ++ Q+PTL +GTI+ N+     Y   
Sbjct: 1421 TALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNEYNDD 1480

Query: 572  M-----------------DEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRI 614
                               ++  VS +      + KF +   + I   G++LS GQRQ +
Sbjct: 1481 QIFKALRRVNLIVDGNLNSDVTSVSSEN-----VNKFLN-LQSEISEGGSNLSQGQRQLM 1534

Query: 615  AIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSEN 674
             +AR+L++ P I++LDEAT+++D  S+  I  T+      K+ TI++IAHRL ++   + 
Sbjct: 1535 CLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYDK 1592

Query: 675  IIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            I+V+ + G V E      L  N+ S  + +  +
Sbjct: 1593 ILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCEQ 1624

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 114/231 (49%), Gaps = 11/231 (4%)

Query: 464 GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYG 523
            KI   +V+ S+  +  +   ++++   + G    ++GP+G GK+++   LL       G
Sbjct: 696 NKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEG 755

Query: 524 SILIDNHDIS---KFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSK 580
            I + + D      F +  L   +    Q   L++ T+++NI +   Y    +    V  
Sbjct: 756 KITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEYNE--ERYLAVIS 813

Query: 581 QCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
            C           G  T IG RG +LSGGQ+QRI++ARAL    K ++LD+  SA+D  +
Sbjct: 814 ACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHT 873

Query: 641 EGAI--NYTLGTLMRSKELTIISIAHRLS-TIRRSENIIVVGNDGSVVEVG 688
              I  N  +G LM ++  T I ++H ++ T++ +E +I++ N G +  +G
Sbjct: 874 AAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMIDN-GKISHIG 921

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 149/560 (26%), Positives = 258/560 (46%), Gaps = 56/560 (10%)

Query: 183  GTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDR 241
            G  ++  F+G++A   + GA  N  R + + + G    SR L +++ K  M   + FF+ 
Sbjct: 987  GNYNLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFET 1046

Query: 242  NKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPL 301
               G +I+RF SD   V  ++    S  F++I+               +T +++ F  PL
Sbjct: 1047 TPTGRIINRFSSDMDSVDTTLQNVFSLFFRSIL------------DYIITVILVTFNMPL 1094

Query: 302  --------LVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKE 349
                    LV    Y      +SR+L++    S   +  +  E L+G  TI ++    ++
Sbjct: 1095 FFLLNAGLLVIYLYYQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQ 1150

Query: 350  IRRYNDAIRQLFYVGKREXXXXXXXXXXXXI-LGDMSFVIVLLYG----ANLVLQGALSI 404
            IRR++    +                    + L  +  +IVL  G    ++L     LS 
Sbjct: 1151 IRRFSHLNYERIQFSINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSS 1210

Query: 405  GDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMD-HKNSVRSNISHAL---T 460
            G +   M Y     SS+  +      +     +  R+ E  D    +      H L    
Sbjct: 1211 GLVGLLMSYALQVTSSLIWIIRSSVLIETNIVSVERIVEYCDISPEAPEVKEEHRLDDNW 1270

Query: 461  PTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDP 520
            P QG+IEF++ S SY     + + KH++  I PG  + +VG +G GKST++  L R  +P
Sbjct: 1271 PNQGQIEFKNYSTSY-RENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEP 1329

Query: 521  NYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIR-----------DNITYGLSYT 569
              G+I IDN DI+    + LR H+ ++ Q+     GTIR           D++ + +  +
Sbjct: 1330 TAGTISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELS 1389

Query: 570  PTMDEIRVVSKQC---FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKI 626
                 +  ++K+      +   ++     D  +   G++LS GQ+Q + +ARAL+ K KI
Sbjct: 1390 HLKFHLETIAKEINDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKI 1449

Query: 627  LILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVE 686
            L+LDEAT+++DVE++  I  T+      +  TI++IAHRL T+  S+ IIV+ + G V E
Sbjct: 1450 LVLDEATASVDVETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL-DGGEVKE 1506

Query: 687  VGKFDKLYRNEESELFKLLN 706
              K + L   ++S  +KL +
Sbjct: 1507 FDKPETLLEQKDSIFYKLCD 1526

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 131/267 (49%), Gaps = 31/267 (11%)

Query: 488 SFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVV 547
           +F +   S +C+VG  G GKSTI   +L       G+   ++H   +F   +    +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISGN---NDHLSPQFQINA--TTVAYC 693

Query: 548 QQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLS 607
            QE  +M+ +++DNI +G  Y       +   K C     I   PDG +T++G +G  LS
Sbjct: 694 PQEAWIMNASVKDNILFGHKYDEAF--YKATIKACQLLPDIKVLPDGDETMVGEKGIVLS 751

Query: 608 GGQRQRIAIARALIKKPKILILDEATSALDVES-----EGAINYTLGTLMRSKELTIISI 662
           GGQ+ R+++ARA+  +  + +LD+  SA+D E      +  ++   G L   K+ +I+  
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLL---KDKSIVLA 808

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE-SELFKLLNEKDHDLVSKSENTSD 721
            + +S ++ S  I ++ N  S+ + G +D +  N++ S+L  +L+E D +          
Sbjct: 809 TNTISVLKHSTKIYLLENK-SIAQEGNYDDIMNNQQDSKLKNILHEFDLE---------- 857

Query: 722 IPPDSP---KNDDASGLEHLVAEDVAS 745
             PD+P   +  D +   +L+ ED  S
Sbjct: 858 -KPDTPAVQEGTDPTSAINLLLEDALS 883

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  155 bits (391), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 146/544 (26%), Positives = 258/544 (47%), Gaps = 32/544 (5%)

Query: 187  ITQFVGIFAGALVVGATANFGR-VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            + +FVGI+A   V  A  N  R +VLL     R  ++L   + K  +   + FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGA 305
             +I+RF SD   V  ++    +  F++I+   V + +   IS  +   +++ A  L++  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVIL---ISYNMPWFLIVNAVLLII-- 1107

Query: 306  FIYGKKIS-AISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVA-EKKEIRRYNDAIRQ 359
            +IY +     +SR+L++    S+  +  +  E L G   I +F   ++ +   +N+    
Sbjct: 1108 YIYYQAFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAFKHFDRFDFINFNNVQFN 1167

Query: 360  LFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGS 419
            +                   I   +     LL  + +  +  LS G +   M Y     S
Sbjct: 1168 INCSFNFRSTNRWLSVRLQTIGAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTS 1227

Query: 420  SVFGLSTFYSELMKGAGAASRLFELM----DHKNSVRSNISHALTPTQGKIEFRDVSFSY 475
            S+  +     ++     +  R++E      +    + S       P++G+I F++ S  Y
Sbjct: 1228 SLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKY 1287

Query: 476  PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKF 535
             T+  +   K ++ +I+P   + +VG +G GKST++  L R  +   G+I ID  DISK 
Sbjct: 1288 KTK-GDLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKM 1346

Query: 536  TTKSLRRHLGVVQQEPTLMSGTIRDNI-------TYGLSYTPTMDEIRVVSKQCFCHGFI 588
              K LR HLG++ Q+     GT+R N+       T  L  +  +  ++    + F     
Sbjct: 1347 GLKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYSTEELWASIELSHLKPHIVEMFRKEDN 1406

Query: 589  TKFPDG----YDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 644
            ++ P       D  I   G +LS GQRQ + ++RAL+   K+L+LDEAT+A+D+E++  I
Sbjct: 1407 SELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKII 1466

Query: 645  NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
              T+ + +  KE TI++IAHR+ T+  S+ IIV+ + G V E    + L  N++S +F  
Sbjct: 1467 QETIRSEL--KEKTILTIAHRIDTVLDSDKIIVL-DAGQVKEFDTPENLLSNKQS-IFYA 1522

Query: 705  LNEK 708
            L EK
Sbjct: 1523 LCEK 1526

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 141/276 (51%), Gaps = 40/276 (14%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH--LGV 546
           F  + G   CIVG  G GKST+   +L       G +   N  +     K L R   +  
Sbjct: 644 FQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAY 696

Query: 547 VQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASL 606
             QEP +M+ +I+DNIT+G  Y  T     +  K C     +   P+  +T++G +G SL
Sbjct: 697 CPQEPWIMNASIKDNITFGFRYDETYYNATI--KACQLLPDLDILPERDNTLVGEKGISL 754

Query: 607 SGGQRQRIAIARALIKKPKILILDEATSALDVE-----SEGAINYTLGTLMRSKELTIIS 661
           SGGQ+ RI++ARA+  +  + +LD+  SA+D E      E  ++  +G L+R+K  T++ 
Sbjct: 755 SGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMG-LLRNK--TVVL 811

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN-EESELFKLLNE------------- 707
             + +S + RS+ I ++   GS+VE G F ++  + E S+L K+++E             
Sbjct: 812 TTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDEFGGNMNYPPSESA 870

Query: 708 KDHDLVSKSENTSDIPPDSPKNDDASGL--EHLVAE 741
            +H +    E+T+   P S  ND A+ L  E+++A+
Sbjct: 871 DNHSI----ESTNSKVPSSEINDTAASLYSENMLAD 902

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  155 bits (391), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 141/537 (26%), Positives = 238/537 (44%), Gaps = 66/537 (12%)

Query: 222  RLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMG 281
            ++  +++ + +H  + FFD   +G +++RF  D   + + +       F + I     + 
Sbjct: 1129 KIFRKLLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTII 1188

Query: 282  MMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIK 341
            ++  I+    SV ++      +  + Y      + R    +   + +   E L G+ TI+
Sbjct: 1189 LITFITPQFLSVAIIVGMLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTTIR 1248

Query: 342  SFVAEKKEIR----RYNDAIRQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
            +F  E + +R    + ++  R  FY  V  R             + G   F+   L   N
Sbjct: 1249 AFGDESRFLRENLLKIDENNRPFFYLWVANRWLSFRIDVIGALVVFGSGIFI---LTNIN 1305

Query: 396  LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455
             +  G   I  LT  + +TE        L  FYSE+     +  R+ E M  +      +
Sbjct: 1306 TIDSGMAGIS-LTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQEPYDEV 1360

Query: 456  S------HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKST 509
                    A  P +G+IE  D+S  Y      ++ K+++F ++P + V +VG +G GKST
Sbjct: 1361 QVSDSKVPADWPEEGRIEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVGRTGAGKST 1419

Query: 510  ITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569
            I + L RF +   G I ID  DI+      LRR + ++ Q+PTL SGTI+ N+     Y 
Sbjct: 1420 IITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYDEYK 1479

Query: 570  P------------------------TMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGAS 605
                                       DE  V SK       I +F D  ++ I   G +
Sbjct: 1480 DEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKN------INRFLD-LESEIAEGGTN 1532

Query: 606  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHR 665
             S GQRQ I +AR+L++ PKIL+LDEAT+++D +S+  +  T+ T     E TI++IAHR
Sbjct: 1533 FSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFSESTILTIAHR 1590

Query: 666  LSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDI 722
            L ++   + I+V+G      EV ++D  Y         LL  K+    S  EN+ ++
Sbjct: 1591 LRSVIDYDKILVMGAG----EVKEYDHPY--------SLLLNKNSIFYSMCENSGEL 1635

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 134/274 (48%), Gaps = 18/274 (6%)

Query: 424 LSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQI 483
           LS   S +++   +  R+ + ++ +++ + N    +   + +I F++ + ++     +  
Sbjct: 660 LSDMLSFVIQSKVSLDRVQDFLNEEDTDKYN-QLTVATNKNQIAFKNTTVAWDNSRDSFK 718

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILID----NHDI---SKFT 536
            ++++   + G    I+GP+G GK+++   LL   +   G I++      HD+   S  T
Sbjct: 719 LRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLLEGQIVVPALNARHDLIVESDGT 778

Query: 537 TKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYD 596
           T S+        Q   L++ T+R+NI +   Y  T      V + C           G  
Sbjct: 779 TNSI----AYCSQAAWLLNDTVRNNILFNSPYNET--RYHNVVEACGLRRDFEILKAGDM 832

Query: 597 TVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRS 654
           T IG +G +LSGGQ+QRI++ARAL    + ++LD+  SA+D  +   +  N   G LM  
Sbjct: 833 TEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDAHTALWVYDNCITGPLMEG 892

Query: 655 KELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
           +  T I ++H ++   R+ +++V+  DG V + G
Sbjct: 893 R--TCILVSHNIALTLRNADLVVMLEDGQVKDQG 924

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  154 bits (390), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 142/519 (27%), Positives = 247/519 (47%), Gaps = 46/519 (8%)

Query: 216  GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVS-DGFKAII 274
            G +   ++ + ++   +H  I FFD   VG +++RF  D   + + +   +    F  I 
Sbjct: 1067 GMQASKKIFNSMLDLVLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQ 1126

Query: 275  CGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQL 334
            C  + + ++       +  +++F     VG + Y K    + R    +   + +   E L
Sbjct: 1127 CSSILLLIVVITPRFFSVAVIVFILYYFVGKW-YLKASRDLKRIDSITKSPIFQHFSETL 1185

Query: 335  NGIRTIKSFVAEKKEIRRYNDAIRQ----LFY--VGKREXXXXXXXXXXXXILGDMSFVI 388
             G+ TI++F  EK+ I    + I Q     FY  V  +             +LG  SF+ 
Sbjct: 1186 VGVCTIRAFGDEKRFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFI- 1244

Query: 389  VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFEL---- 444
              L+  + +  G   I  LT  +L+T+    S   L   YS       +  RL E     
Sbjct: 1245 --LFNIDNIDSGLAGIS-LTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEYSSIV 1297

Query: 445  ----MDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIV 500
                + +       ++ +  P  GKIE  ++S  Y +     + K++ F ++P S V IV
Sbjct: 1298 QEKYLGYDEDHIQALNDSSWPKHGKIEVENLSLRYASNLP-LVLKNVCFKVDPQSKVGIV 1356

Query: 501  GPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRD 560
            G +G GKSTI + L R  +P  G I ID+ DISK    +LRR + ++ Q+P L +GTI+ 
Sbjct: 1357 GRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKS 1416

Query: 561  NITYGLSYTP-----TMDEIRVVS----KQCF----CHGFITKFPDGYDTVIGPRGASLS 607
            NI     Y        + ++ ++S    KQ F          KF +    ++   G +LS
Sbjct: 1417 NIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIV-EGGLNLS 1475

Query: 608  GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK--ELTIISIAHR 665
             G+RQ + IAR+L+++ KI++LDEATS++D +S+  I     +++RSK  + TI++IAHR
Sbjct: 1476 QGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIAHR 1531

Query: 666  LSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
            L ++   + I+V+ + G + E G   +L +NE S  +++
Sbjct: 1532 LRSVIYYDKILVM-DAGEIKEYGHPYELLKNERSTFYRM 1569

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 129/282 (45%), Gaps = 17/282 (6%)

Query: 424 LSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQI 483
           LS   S + +   +  R+   ++  ++ + N    ++P + KIEF+  +  +     N I
Sbjct: 623 LSNMLSFINQSKVSLRRIISFLNLDDTEKYN-QLTISPDRNKIEFKKANLVW-NENDNDI 680

Query: 484 FKH----MSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILID----NHDISKF 535
            K     ++     G    ++G +G GKS +   LL   D   G I+I      HD+   
Sbjct: 681 NKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGELDLVSGFIIIPGLEPRHDLIP- 739

Query: 536 TTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGY 595
               L        Q   L+S TI++NI +  SY  +    + V   C  +  +   P G 
Sbjct: 740 DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYDKS--RYKKVIDACGLNRDLNILPAGD 797

Query: 596 DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMR 653
            T IG +G +LSGGQ+QRI++ARA+    K ++LD+  SA+D  +   I  N   G LM+
Sbjct: 798 LTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCLSAVDSHTAVWIYENCITGQLMK 857

Query: 654 SKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR 695
           ++  T I + H +    R+ +  ++  DG V   G   +L +
Sbjct: 858 NR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTIKELQK 897

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  154 bits (389), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 149/565 (26%), Positives = 265/565 (46%), Gaps = 55/565 (9%)

Query: 175  LDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHH 234
            L+ L P+    ++  ++G++     + A     + +     G +   ++   ++   +H 
Sbjct: 1032 LERLGPLKNKHTMLYYLGMYFAIGFIQALLGGIKNIATFFSGIQASRKIFDNMLDLVLHA 1091

Query: 235  DIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVS-DGFKAIICGGVGMGMMFHISSTLTSV 293
             I FFD   +G +++RF  D   V + +T  +    F  I C  +    +F I+  +T  
Sbjct: 1092 KIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSI----IFLIT-IITPH 1146

Query: 294  MLLFAPPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKE 349
             L+ A  + +  +  G      SR+L++    +   + +   E L G+ TI++F  EK+ 
Sbjct: 1147 FLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAFGDEKRF 1206

Query: 350  IRRYNDAI----RQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALS 403
            I    D I    R  FY  V  +             +L   SF+++ +   +  L G   
Sbjct: 1207 ILENLDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFIVLASGSFILINIGNIDSGLAGI-- 1264

Query: 404  IGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFEL--MDHKNSVRSNISH---- 457
               LT  +L+T+        L   YS       +  RL E   ++ +N    N  H    
Sbjct: 1265 --SLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYNKDHIQEL 1318

Query: 458  --ALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLL 515
              +  P  G+IE  ++S  Y +     + K++SFTIEP S V IVG +G GKSTI + L 
Sbjct: 1319 QQSSWPEHGQIEVDNLSLRYASNLP-PVIKNVSFTIEPQSKVGIVGRTGAGKSTIITALF 1377

Query: 516  RFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-----P 570
            R  +P  G I ID +DIS+    +LRR + ++ Q+P L +GTI+ N+     Y       
Sbjct: 1378 RLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDPCDEYDNKKIFK 1437

Query: 571  TMDEIRVVSKQCF---------CHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALI 621
             + ++ ++S              +    KF +   T I   G ++S G+RQ + IAR+L+
Sbjct: 1438 VLSQVNLISTGEMEAAQNMGDDSNTARNKFVN-LQTEITEGGQNISQGERQLLFIARSLL 1496

Query: 622  KKPKILILDEATSALDVESEGAINYTLGTLMRSK--ELTIISIAHRLSTIRRSENIIVVG 679
            ++PKI++LDEATS++D ES+  I      ++R++  + TI++IAHRL ++   + ++V+ 
Sbjct: 1497 REPKIILLDEATSSIDYESDHLIQ----GIIRNEFNKSTILTIAHRLRSVIDYDRVLVM- 1551

Query: 680  NDGSVVEVGKFDKLYRNEESELFKL 704
            + G + E      L +NE+S  + +
Sbjct: 1552 DAGEIKEYDHPYNLLKNEQSIFYSM 1576

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 136/573 (23%), Positives = 249/573 (43%), Gaps = 59/573 (10%)

Query: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANF-GRVVLLKI- 214
           LE V++  ES+ +  +A L      +  L+I           +  + A F    + LKI 
Sbjct: 365 LEIVDDPGESVSSMNLAWLYIFAMFICRLTIA----------ICNSQAQFIADKICLKIR 414

Query: 215 ---IGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFK 271
              IGE     LR ++     ++D        +G +I+    D++ VS  ++       +
Sbjct: 415 TILIGEIYSKGLRRKLFTPPKNNDDSSSVSANLGTIINLISIDSFKVSE-ISTYFYMTVQ 473

Query: 272 AIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLT--RV 329
           AII   + +G++F        +  L    +++  F    +++ +  + Q+S+   T  R+
Sbjct: 474 AIIMVLIVVGLLFK----FLGISALAGISIILMMFPLNFRLAELLGKFQKSALQCTDKRI 529

Query: 330 AE--EQLNGIRTIKSFVAEK------KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXIL 381
           A+  E L  IR +K F  E       K IR+  + +R LF                  ++
Sbjct: 530 AKLNECLQNIRIVKYFAWENNISKDIKSIRQ--NELRFLFQKALVWALSSFLWFVTPTLV 587

Query: 382 GDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRL 441
             ++F I + +  +  L   L+   L+ F L      + +  LS   S + +   +  R+
Sbjct: 588 TGVTFAIYI-FVQHQELNAPLAFTTLSLFTL----LKTPLDQLSNMLSFMNQSIVSLDRI 642

Query: 442 FELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQ-IFK--HMSFTIEPGSNVC 498
            + ++  ++ + N    ++P + KIEF++ + ++     +  IFK   ++ T + G    
Sbjct: 643 VKFINEDDTEKYN-QLTVSPDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNL 701

Query: 499 IVGPSGKGKSTITSLLLRFYDPNYGSILID----NHDISKFTTKSLRRHLGVVQQEPTLM 554
           I+G +G GKS +   LL       GSI +      HD+       L        Q   L+
Sbjct: 702 ILGSTGSGKSALLMGLLGELHLISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLL 760

Query: 555 SGTIRDNITYGLSYTPTMDEIRV--VSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQ 612
           + T+++NI +  +Y    D++R   V   C     +   P G  T IG +G +LSGGQ+Q
Sbjct: 761 NDTVKNNIIFNGAY----DDVRYKEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQ 816

Query: 613 RIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIR 670
           RI++ARA+    K ++LD+  SA+D  +   I  N   G +M ++  T I + H +S   
Sbjct: 817 RISLARAVYSNAKHVLLDDCLSAVDSHTAVWIYENCITGPIMENR--TCILVTHNVSLTI 874

Query: 671 RSENIIVVGNDGSVVEVGKFDKLYRNEESELFK 703
           R     V+  +G V   G   +L   E++ +FK
Sbjct: 875 REAYFAVILENGKVKNQGTIKQL---EKTGIFK 904

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 146/523 (27%), Positives = 251/523 (47%), Gaps = 53/523 (10%)

Query: 216  GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
            G R   ++ + ++   +H  I FFD   VG +++RF  D   V + +   +      I C
Sbjct: 1067 GMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLE---VTIFC 1123

Query: 276  GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAE 331
                  ++F I+  +T   L  A  + V  F  GK     SR+L++    +   + +   
Sbjct: 1124 LIQCASIIFLIT-VITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFS 1182

Query: 332  EQLNGIRTIKSFVAEKKEIRRYNDAI----RQLFY--VGKREXXXXXXXXXXXXILGDMS 385
            E L G+ TI++F  E++ I    + I    R  FY  V  +             +L   S
Sbjct: 1183 ETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGAFIVLASGS 1242

Query: 386  FVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFEL- 444
            F+  LL  AN+     L+   LT  +L+T+        L   YS       +  RL E  
Sbjct: 1243 FI--LLNIANI--DSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERLKEYS 1294

Query: 445  -MDHKNSVRSN------ISHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSN 496
             ++ +N +  +      ++    P  G+IE  ++S  Y P  P   + +++SF ++P S 
Sbjct: 1295 SIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPP--VIRNVSFKVDPQSK 1352

Query: 497  VCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSG 556
            + IVG +G GKSTI + L R  +P  G I ID  DISK    +LRR + ++ Q+P L +G
Sbjct: 1353 IGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAG 1412

Query: 557  TIRDNITYGLSYTP-----TMDEIRVVSKQCFCHGFIT--KFPDGYD------TVIGPRG 603
            TI+ N+     Y        + ++ ++S   F     +  +F   ++      T I   G
Sbjct: 1413 TIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGG 1472

Query: 604  ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK--ELTIIS 661
             +LS G+RQ + IAR+L+++PKI++LDEATS++D +S+  I      ++RS+  + TI++
Sbjct: 1473 LNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQ----GIIRSEFNKSTILT 1528

Query: 662  IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
            IAHRL ++   + IIV+ + G V E  +  +L ++E    + +
Sbjct: 1529 IAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKDERGIFYSM 1570

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 126/530 (23%), Positives = 230/530 (43%), Gaps = 50/530 (9%)

Query: 244 VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFH---ISSTLTSVMLLFAPP 300
           +G +I+    D++ VS  +   +    +A+I   V +G++F+   +S+     ++L   P
Sbjct: 445 LGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMFP 503

Query: 301 LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQL 360
           L    F+    +    +Q  + +        E L  IR +K F  E+  I     +IRQ 
Sbjct: 504 L---NFLLANLLGKFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIK-SIRQ- 558

Query: 361 FYVGKREXXXXXXXXXXXXILGDMSFVI-VLLYGANLVLQGALSIGDLTAFMLYTEYTGS 419
                +E            +   + FV   L+ G    +   +   DL A + +T  +  
Sbjct: 559 -----KELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHEDLNAPLAFTTLSLF 613

Query: 420 SVFG-----LSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFS 474
           ++       LS   S + +   +  R+ + +   ++ + N    ++P + KIEF++ + +
Sbjct: 614 TLLKTPLDQLSNMLSFINQSKVSLKRISDFLRMDDTEKYN-QLTISPDKNKIEFKNATLT 672

Query: 475 YPTRPSN-QIFKHMSFTI--EPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDN-- 529
           +    S+   FK     I  + G    I+G +G GKS +   LL   +   GSI++ +  
Sbjct: 673 WNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLE 732

Query: 530 --HDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGF 587
             HD+     + L        Q   L++ T+++NI +   Y    D    V   C     
Sbjct: 733 PKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYNE--DRYNKVIDACGLKRD 789

Query: 588 ITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--N 645
           +   P G  T IG +G +LSGGQ+QRI++ARA+    K ++LD+  SA+D  +   I  N
Sbjct: 790 LEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYEN 849

Query: 646 YTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLL 705
              G LM+++  T I + H +S   R+ +  +V  +G V   G   +L   +   LFK  
Sbjct: 850 CITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITEL---QSKGLFK-- 902

Query: 706 NEKDHDLVSK----SENTSDIPPDSPKNDDASGLEHLVAE---DVASIND 748
            EK   L S+     +N + +   +P+ +D+  +E +      D   +ND
Sbjct: 903 -EKYVQLSSRDSINEKNANRLK--APRKNDSQKIEPVTENINFDANFVND 949

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  152 bits (384), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 139/523 (26%), Positives = 247/523 (47%), Gaps = 58/523 (11%)

Query: 222  RLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAII-CGGVGM 280
            ++   ++   +H  + FFD   +G +++RF  D   V + +T  +   F  ++ C    +
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 281  GMMFHISSTLTSVMLLFAPPLLVGAFIY--GKKISAISRQLQQ----SSGNLTRVAEEQL 334
             + F     +T   L+ A  + +G   Y  G    A SR+L++    +   + +   E L
Sbjct: 1219 LIAF-----ITPQFLILA--IFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETL 1271

Query: 335  NGIRTIKSFVAEKK----EIRRYNDAIRQLFYVG--KREXXXXXXXXXXXXILGDMSFVI 388
             GI TI+++  EK+     + + ++  +  FY+    R             + G   F+I
Sbjct: 1272 VGIVTIRAYGDEKRFMLENLHKIDENNKPFFYLWAFNRWLSFRIDMIGSLVVFGAGVFII 1331

Query: 389  VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMD-- 446
            + +      L   L+   LT  + +TE    +   L  FY+++     +  RL E M+  
Sbjct: 1332 LNIDN----LDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEID 1383

Query: 447  ----HKNSVRSNI-SHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIV 500
                 ++  RS + +    P  GKIE  ++S  Y P  P  ++ K+++F +EP   V +V
Sbjct: 1384 QEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVV 1441

Query: 501  GPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRD 560
            G +G GKSTI + L RF D   G I ID+ DI+      LRR + ++ Q+PTL SGTIR 
Sbjct: 1442 GRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRS 1501

Query: 561  NITYGLSYT-----PTMDEIRVVSKQ-----------CFCHGFITKFPDGYDTVIGPRGA 604
            N+     ++       +  + ++++                  + KF +  +  I   G 
Sbjct: 1502 NLDPYNEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKNE-ITEGGN 1560

Query: 605  SLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAH 664
            +LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+      KE TI++IAH
Sbjct: 1561 NLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAH 1618

Query: 665  RLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            RL ++   + I+V+ + G V E      L  N+ S  + +  +
Sbjct: 1619 RLRSVCDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCEQ 1660

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 111/463 (23%), Positives = 205/463 (44%), Gaps = 38/463 (8%)

Query: 244 VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLV 303
           +G +I+    DA+ VS  +   +    +A++   V + +++H    L     L    L+V
Sbjct: 512 LGAIINLMAVDAFKVSE-ICGYLHFFVEALLMVVVALALLYH----LLGYAALVGGALVV 566

Query: 304 GAFIYGKKISAISRQLQQSSGNLTRVAEEQLN----GIRTIKSFVAEKKEIRRYNDAIRQ 359
                  K++ +  + Q+ S  +T    ++LN     IR IK F  E    R   + +R+
Sbjct: 567 AFLPLNLKLATLLGEYQKKSLAVTDKRIQKLNETFQAIRIIKYFSWEDNFTRDI-ETVRE 625

Query: 360 --LFYVGKREXXXXXXXXXXX---XILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYT 414
             L  + KR                I+   SF   + Y     L   ++   L+ F L  
Sbjct: 626 KELHLLFKRSLIWAFSSFIWFITPSIVTSCSFAFYI-YVQGETLTTPVAFTALSLFTL-- 682

Query: 415 EYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFS 474
               + +  LS   S +++   +  R+ +L+  K + + +    +     +I F++ + +
Sbjct: 683 --LKTPLDQLSNMISFVIQSKVSLDRIQDLLQEKETEKYS-QLTIDKNGNRIAFQNATVA 739

Query: 475 YPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI---DNHD 531
           +  + S    + ++   +PG    ++GP+G GKS++   LL       G+I++   D  D
Sbjct: 740 WDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNIIVPSLDPRD 799

Query: 532 ISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR---VVSKQCFCHGF- 587
                   +   +    Q   L++ T+R+NI +   Y    +E R   VV   C    F 
Sbjct: 800 ELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPY----NEARYNAVVEACCLKRDFE 855

Query: 588 ITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--N 645
           I K  D   T IG +G +LSGGQ+QR+++ARAL    + ++LD+  SA+D  +   I  N
Sbjct: 856 ILKAGDM--TEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTALWIYDN 913

Query: 646 YTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
              G LM ++  T I ++H ++   R+  ++V+  DG V + G
Sbjct: 914 CITGPLMENR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 954

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 150/546 (27%), Positives = 253/546 (46%), Gaps = 42/546 (7%)

Query: 187  ITQFVGIFAGALVVGATA--NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            +  FVG+++  + VG+ A  N   +++L     R   +L   + K  +   + FF+   V
Sbjct: 1017 VWMFVGVYS-LIGVGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPV 1075

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMM-FHISSTLTSVMLLFAPPLLV 303
            G +I+RF SD   V  S+    S  FK+I+   V + ++ +++   L   M       L+
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNM------FLL 1129

Query: 304  GAFIYGKKIS-AISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIR-RYNDAI 357
            G +IY +     +SR+L++    S   +  +  E LNG   I ++   ++ I   Y    
Sbjct: 1130 GIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQ 1189

Query: 358  RQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYT-EY 416
              + +V                I   +     +L  A +  +  LS G +   M Y+ E 
Sbjct: 1190 YNIDFVFNFRSTNRWLSVRLQTIGATIVLATAMLTLATMNTKKQLSSGMVGLLMSYSLEV 1249

Query: 417  TGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRS----NISHALTPTQGKIEFRDVS 472
            TGS  + + T    +     +  R+ E  +  +  +S           P++G IEF+D S
Sbjct: 1250 TGSLTWIVRTTVM-IETNIVSVERIVEYCELPSEAQSINPEKRPDKNWPSRGSIEFKDYS 1308

Query: 473  FSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDI 532
              Y     + + K ++  IEP   V IVG +G GKST++  L R  +P  G I+ID  +I
Sbjct: 1309 TKY-RENLDPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINI 1367

Query: 533  SKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKF- 591
            S      LR HL ++ Q+     GT++ N+     Y+   DE++   +       + K  
Sbjct: 1368 SDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSE--DELKKAVELAHLKPHLEKML 1425

Query: 592  -------------PDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
                          D  D  I   G++LS GQRQ + +ARAL+ + KIL+LDEAT+++D+
Sbjct: 1426 ENEPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDM 1485

Query: 639  ESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE 698
            E++  I  T+      K+ TI++IAHR+ T+  S+ IIV+ ++GSV E     KL  N+ 
Sbjct: 1486 ETDKIIQDTIRR--EFKDRTILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKLLSNKA 1542

Query: 699  SELFKL 704
            S  + L
Sbjct: 1543 SIFYSL 1548

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 118/487 (24%), Positives = 218/487 (44%), Gaps = 74/487 (15%)

Query: 271 KAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA 330
           KA+I G + M +M  I++ L+                  +K+  +S+   +      +  
Sbjct: 434 KAVIGGLITMAIMMPINAFLS------------------RKVKKLSKTQMRYKDMRIKTI 475

Query: 331 EEQLNGIRTIKSFVAEKKEIRRYNDA-----IRQLFYVGKREXXXXXXXXXXXXILGDMS 385
            E LN I++IK +  E+  ++R N       ++    +G               ++   +
Sbjct: 476 TELLNAIKSIKLYAWEEPMMKRLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVACST 535

Query: 386 FVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRL--FE 443
           F +  L+  +  L  A+    L+ F +      S+++ + +  + +++ + +  RL  F 
Sbjct: 536 FGLFSLFNDS-PLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMKRLKSFL 590

Query: 444 LMDH-KNSVRSNISHALTP-TQGKIEFRDVSFSYPTRP--------------------SN 481
           L D   +S    I  ++   T   IE  +++F + ++                     S+
Sbjct: 591 LSDEIDDSFIERIDPSVDERTLPVIEMNNITFLWKSKEALASSQLENNSRADEESAMGSS 650

Query: 482 QI-FKHMS-FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKS 539
           QI  K++  F  + G+ VCIVG  G GKST    +L       G +   +        K 
Sbjct: 651 QIALKNIDHFEAKRGNLVCIVGRVGAGKSTFLKAIL-------GQLPCMSGSKESIPPKL 703

Query: 540 LRRH--LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDT 597
           + R   L    QE  +M+ ++++NI +G  +     ++ +  K C     +   PDG +T
Sbjct: 704 IIRSSSLAYCSQESWIMNASVKENILFGHKFDKAYYDLTI--KACQLLPDLRILPDGDET 761

Query: 598 VIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL---GTLMR 653
           ++G +G SLSGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  I Y L     L++
Sbjct: 762 LVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLK 821

Query: 654 SKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY--RNEESELFKLLNEKDHD 711
           +K  TII   + +S ++ S+ I  + N G +VE G +D +    N  S+L KLL E D  
Sbjct: 822 NK--TIILTTNTVSILKHSQMIYALEN-GEIVEQGNYDSVMNRENSTSKLKKLLEEFDSP 878

Query: 712 LVSKSEN 718
           +   +EN
Sbjct: 879 IDKGNEN 885

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 144/543 (26%), Positives = 248/543 (45%), Gaps = 36/543 (6%)

Query: 187  ITQFVGIFAG-ALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            + +FVGI+A   +   A  N   V++L     R    L +++    +   + FF+   +G
Sbjct: 1025 LWKFVGIYALLGISSAAFDNIRAVIILLYSSIRGSKVLHNKMAVSVLKSPMGFFESTPIG 1084

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGA 305
             +I+RF SD   V R++  N +  FK ++   V + ++ +         L+F   LLV  
Sbjct: 1085 RIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYN----MPWFLVFNAGLLVVY 1140

Query: 306  FIYGKKISAISRQLQQSSGN----LTRVAEEQLNGIRTIKSFV-AEKKEIRRYNDAIRQL 360
              Y      +SR+L++ S      +  +  E L G   I +F  +E+     +N    Q+
Sbjct: 1141 VYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAFRHSERFHFLNFNKTQFQI 1200

Query: 361  FYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSS 420
                               I G M  +  LL  A +  +  ++ G +   M Y     +S
Sbjct: 1201 DAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMTAGLVGLLMSYVLQVTNS 1260

Query: 421  VFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALTPTQGKIEFRDVSFSYP 476
            +  +    + +     +  R++E     +     + S+      P+ G+I F+D S  Y 
Sbjct: 1261 LMWIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSRPEKSWPSMGEIIFKDYSTKY- 1319

Query: 477  TRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKF 535
             RP  + + K ++ +I+P   + +VG +G GKS+++  L R  +   GSI ID  DISK 
Sbjct: 1320 -RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTGGSIEIDGVDISKI 1378

Query: 536  TTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKF---- 591
                LR HL ++ Q+     GT+R N+     Y  ++ EI    +       I K     
Sbjct: 1379 GLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQY--SVQEIWKAVELAHLKPHIIKMMTDE 1436

Query: 592  -PD---------GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 641
             PD           D  I   G ++S GQRQ + ++RAL+ K K+L+LDEAT+A+D+E++
Sbjct: 1437 DPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLVLDEATAAVDMETD 1496

Query: 642  GAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESEL 701
              I  T+    + K  TI++IAHR+ T+  S+ I+V+ + G V E    D L ++E+S  
Sbjct: 1497 QIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DKGEVKEFESPDTLLKDEKSLF 1553

Query: 702  FKL 704
            + L
Sbjct: 1554 YGL 1556

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 132/262 (50%), Gaps = 31/262 (11%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSL---RRHLG 545
           F  + G+  C+VG  G GKST+   +L       G          +F +  +    R + 
Sbjct: 662 FEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGP--------KEFISPEILVRARSVA 713

Query: 546 VVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGAS 605
              Q P +M+ +I+DNI +G  Y  T   + +  K C     +    +G +T++G +G S
Sbjct: 714 YCPQAPWVMNASIKDNILFGHRYDETYYNLTI--KACQLIPDLKILSEGDETLVGEKGIS 771

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGT---LMRSKELTIIS 661
           LSGGQ+ R+++ARA+  +  + ++D+  SA+D E S+  I+  LG    L++ K  TII 
Sbjct: 772 LSGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIIL 829

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDK-LYRNEESELFKLLNEKDHDLVSKSENTS 720
             + +S ++ S N+I     G +VE G +++ + R ++S L KL+ E D    + +EN S
Sbjct: 830 TTNAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEFD----TFAENPS 884

Query: 721 DIPPDSPKNDDASGLEHLVAED 742
           D      K  D     H ++ED
Sbjct: 885 D------KKKDEENDSHSISED 900

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 143/532 (26%), Positives = 239/532 (44%), Gaps = 22/532 (4%)

Query: 187  ITQFVGIFAGALVVGATANFGRVVLLKIIGE-RLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            I +++GI+       + +   R + L +    +  +RL   + K  +   + FF+   VG
Sbjct: 980  IWKYLGIYFLLCFSASLSTLLRSITLCMFCTIKASARLHDAMAKAVLRAPMSFFETTPVG 1039

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGA 305
             +++RF +D Y V   + ++ S  F  I    V   M+  +  ++T   + F  PL V  
Sbjct: 1040 RILNRFSNDIYKVDELLGRSFSQFF--IHVTKVVFTMI--VICSITWQFIFFILPLSVLY 1095

Query: 306  FIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLF 361
              Y +     SR+L++    +   +    +E L G+ T++SF  + + I      I    
Sbjct: 1096 LFYQQYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTVRSFKKQDRFIHINQSRINTYM 1155

Query: 362  YVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSV 421
                               +G +  +   +     + QG L+ G L   + Y      S+
Sbjct: 1156 CAYYLSINANRWLAFRLEFMGSIVILAAAVLSVFRLKQGKLTAGMLGLGLSYALQITQSL 1215

Query: 422  FGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL----TPTQGKIEFRDVSFSYPT 477
              +     E+     +  R+ E  D K      I  +      P  G I+F   S  Y  
Sbjct: 1216 NWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRPPKNWPANGDIKFEHFSTRY-- 1273

Query: 478  RPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFT 536
            RP  + I + ++  I P   V IVG +G GKS++T  L R  +   G ILID+  I    
Sbjct: 1274 RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLFRLIEAAAGRILIDDLPIDSIG 1333

Query: 537  TKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEI-RVVSKQCFCHGFITKFPDGY 595
               LR  L ++ Q+  +  GT R+NI     +T   DEI   +         +T   +G 
Sbjct: 1334 LNDLRSSLSIIPQDSEVFEGTFRENIDPCNKFTD--DEIWNALELAHLKQHVMTLGTEGL 1391

Query: 596  DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK 655
            +T +   G++LS GQRQ + +ARAL+   KIL+LDEAT+A+DVE++  I  T+ T  + +
Sbjct: 1392 NTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAIDVETDKLIQRTIRTAFKDR 1451

Query: 656  ELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
              TI++IAHRL+TI  S+ I+V+ + G + E      L ++E S  + L NE
Sbjct: 1452 --TILTIAHRLNTIMDSDKIVVL-DKGRIAEFDTPCNLLKDETSIFYSLCNE 1500

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 135/561 (24%), Positives = 234/561 (41%), Gaps = 57/561 (10%)

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
           G  + S + S V ++++    E    +  GD+++    D   V R   Q++S     I  
Sbjct: 361 GMHVSSSMTSMVYQKSLKLSNEASQTSMTGDIVNLMSVD---VQR--LQDLSQWGHLIWS 415

Query: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQ----QSSGN 325
           G       F I   L S+  L  P +  G FI          I  I ++LQ    ++   
Sbjct: 416 GP------FQIILCLFSLYKLLGPCMWAGVFIMVITIPLNSLIMGIQKKLQGVQMKNKDK 469

Query: 326 LTRVAEEQLNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXI 380
            TR+  E LN I+++K +  E     K +  R    ++ L  +G               +
Sbjct: 470 RTRIISEILNNIKSLKLYAWEQPYKAKLDYVRNEKELKNLVKIGITNTISVFQFSVVPFM 529

Query: 381 LGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASR 440
           +   +F   +L   +  L   L    L  F L +   G      ++F    ++ + +  R
Sbjct: 530 VSCATFGTFVLTQKDKALSTDLIFPALALFNLLSFPLGFIPMAATSF----IEASVSIKR 585

Query: 441 LFELMDHKNSVRSNISHALTPTQ-GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGS 495
           L   +      R  I H     + G I      D ++ +  +P  ++  K+++F    G 
Sbjct: 586 LHSFLTSGEIQRDAIQHLPKVEEIGDISVNISGDATYLWQRQPEYKVALKNINFQARKGE 645

Query: 496 NVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFT-TKSLRRHLGVVQQEPTLM 554
             CIVG  G GKS +   +L               D+ +   + +L   +  V Q   +M
Sbjct: 646 LSCIVGKVGTGKSALIQAML--------------GDLFRVKGSATLHGSVAYVSQVSWIM 691

Query: 555 SGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRI 614
           +GTI+DNI +G  Y     E  +  K C     +   PDG  T +G RG SLSGGQ+ R+
Sbjct: 692 NGTIKDNILFGYKYDAEFYEKTI--KACALSLDLNTLPDGDQTFVGERGISLSGGQKARL 749

Query: 615 AIARALIKKPKILILDEATSALDVE-SEGAINYTLGTLMRSKELTIISIAHRLSTIRRSE 673
           A+ARA+  K  +  LD+  +A+D   S+  + Y +G     K  T I   +++  +  ++
Sbjct: 750 ALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYVIGPTGLLKTKTRILTTNKIHVLSVAD 809

Query: 674 NIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDAS 733
           +I ++ N G +V+ G +D++  N++S LFKL+           EN  D   +   +  +S
Sbjct: 810 SITLLDN-GVIVQQGSYDQVNSNKDSPLFKLIANFGKQKSQAIENNEDTVAEVKTSSSSS 868

Query: 734 GLEHLVAEDVASINDKVVKNV 754
               LV ED+   +    K++
Sbjct: 869 P---LVQEDIIDWSKSASKDM 886

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 148/551 (26%), Positives = 247/551 (44%), Gaps = 68/551 (12%)

Query: 190  FVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLIS 249
            ++G+++  +         +  LL  IG      L  + +KR +H  + + D   +G +++
Sbjct: 966  YMGLYSFFVFFSYILTTSQFTLLCCIGVLSSKWLNLRAVKRILHTPMSYLDTTPLGRILN 1025

Query: 250  RFGSDAYVVSRSMTQNVS---DGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF 306
            RF  D   +   +T++V      F  I+  GV +  + ++     ++  LF   +L+   
Sbjct: 1026 RFTKDTDSLDNELTESVRMLLYQFANIV--GVCIMCIIYLPWFAIAIPFLFVGFVLIADH 1083

Query: 307  IYG-----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLF 361
                    K++ AI R    ++ N      E L G+ TIKS+ +E + I + +  I ++ 
Sbjct: 1084 YQSSGREIKRLEAIQRSFVYNNFN------EVLGGMDTIKSYRSENRFIAKSDFLIDKMN 1137

Query: 362  YVGKREXXXXXXXXXXXXILG-DMSFVIVLLYGANLVLQGALSIGDLTAFMLY------- 413
              G               ++    + +I LL         A S+G L  ++L        
Sbjct: 1138 EAGYLVVAVQRWVAIFLDVIAVCFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNG 1197

Query: 414  -------TEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKI 466
                   TE   +S   L T+ +EL   A          D++    S       PT+G+I
Sbjct: 1198 VLRSLTQTENDMNSAERLVTYATELPLEA----------DYRKPEVSPPEEW--PTKGEI 1245

Query: 467  EFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
             F +V FSY P  P+  + K++S  I+ G  + I G +G GKSTI S L R  + + G +
Sbjct: 1246 HFENVDFSYRPGLPT--VLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKM 1303

Query: 526  LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITY----------------GLSYT 569
            +ID+ DIS      LRR L ++ Q+P L  GTIR N+                  G    
Sbjct: 1304 IIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQ 1363

Query: 570  PTMDEIRVVS-KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI 628
              ++EI+     +   H  + KF    D ++   GA+ S G+RQ +A+ RAL+++ +ILI
Sbjct: 1364 KELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGERQLLALTRALVRQARILI 1421

Query: 629  LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
            LDEATS++D E++G I   +  +      TI+ IAHRL TI   + I+V+   G V E  
Sbjct: 1422 LDEATSSVDYETDGKIQARI--VEEFGHCTILCIAHRLKTILTYDRILVL-EKGEVAEFD 1478

Query: 689  KFDKLYRNEES 699
                L+  E+S
Sbjct: 1479 TPKTLFAQEDS 1489

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/227 (32%), Positives = 114/227 (50%), Gaps = 27/227 (11%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F  ++F I+ G  + +VGP G GK+++ +    F +   G I I N D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQI-NGDL----------- 696

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPT-MDE-IRVVSKQCFCHGFITKFPDGYDTVIGP 601
             ++   P + + +++DNI +G  Y     DE IRV    C     +   P G  T IG 
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYDEVIRV----CSLKSDLDILPAGDLTEIGE 750

Query: 602 RGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTI 659
           RG +LSGGQ+ RI +AR++ K+  I + D+  SA+D      I     LG L   K+ T 
Sbjct: 751 RGITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLL---KDKTR 807

Query: 660 ISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
           I   H+LS + R+  +IV+GNDGS  ++G  ++L +   S L  LL 
Sbjct: 808 ILATHQLSLLERASRVIVLGNDGS-FDIGTVEEL-KQRSSTLVNLLQ 852

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 144/539 (26%), Positives = 246/539 (45%), Gaps = 40/539 (7%)

Query: 189  QFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDRNKVGDL 247
            +++ I+    +  A A   + ++L +      S+ L + +    +   + FF+   +G +
Sbjct: 990  RYLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRI 1049

Query: 248  ISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFI 307
            ++RF +D Y V   + +  S  F       V +     +    T   +    PL V    
Sbjct: 1050 LNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFIIIPLSVFYIY 1105

Query: 308  YGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEIRRYN----DAIR 358
            Y +     SR+L++   ++TR       +E L G+ T++ + +++K     N    D   
Sbjct: 1106 YQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQCRIDNNM 1163

Query: 359  QLFYV---GKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTE 415
              FY      R             ILG  +  +  L       QG L+ G +   + Y  
Sbjct: 1164 SAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLK------QGTLTAGMVGLSLSYAL 1217

Query: 416  YTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALTPTQGKIEFRDV 471
                ++  +     E+     +  R+ E  D K+     V  +      P+QG I+F + 
Sbjct: 1218 QITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIKFNNY 1277

Query: 472  SFSYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
            S  Y  RP  + + KH++  I+P   V IVG +G GKS++T  L R  + + G+I+IDN 
Sbjct: 1278 STRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNI 1335

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE--IRVVSKQCFCHGFI 588
             I++     LR  L ++ Q+  +  GT+R+NI     YT   DE   R +         +
Sbjct: 1336 AINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYT---DEAIWRALELSHLKEHVL 1392

Query: 589  TKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 648
            +   DG D  +   G +LS GQRQ + +ARA++   KIL+LDEAT+A+DVE++  +  T+
Sbjct: 1393 SMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETI 1452

Query: 649  GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
             T  + +  TI++IAHRL+TI  S+ IIV+ N G V E     +L  + +S  + L  E
Sbjct: 1453 RTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPGQLLSDNKSLFYSLCME 1508

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 109/448 (24%), Positives = 204/448 (45%), Gaps = 50/448 (11%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQSSGNL----TRVAEEQ 333
           F I   L S+  L    + VG  I          +  I ++LQ+S        TRV  E 
Sbjct: 431 FQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEI 490

Query: 334 LNGIRTIKSFVAEK------KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFV 387
           LN I+++K +  EK      +E+R  N  ++ L  +G               ++   +F 
Sbjct: 491 LNNIKSLKLYAWEKPYREKLEEVRN-NKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTFA 549

Query: 388 IVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDH 447
            V +Y  +  L   L    LT F L +      +  +    +  ++ + +  RLF    +
Sbjct: 550 -VFVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRLFTFFTN 604

Query: 448 KNSVRSNISHALTPTQ--GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVG 501
           +  ++ +    L   +  G +      D +F +  +P  ++  K+++F  + G+  CIVG
Sbjct: 605 E-ELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVG 663

Query: 502 PSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN 561
             G GK+ + S +L            D   +  F T  +   +  V Q P +M+GT+++N
Sbjct: 664 KVGSGKTALLSCMLG-----------DLFRVKGFAT--VHGSVAYVSQVPWIMNGTVKEN 710

Query: 562 ITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALI 621
           I +G  Y     E  +  K C     +    DG  T++G +G SLSGGQ+ R+++ARA+ 
Sbjct: 711 ILFGHRYDAEFYEKTI--KACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVY 768

Query: 622 KKPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVV 678
            +    +LD+  +A+D   +   I + LG   L+ +K  T +   +++S +  +++I ++
Sbjct: 769 ARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TKVLATNKVSALSIADSIALL 826

Query: 679 GNDGSVVEVGKFDKLYRNEESELFKLLN 706
            N G + + G +D++ ++ +S L+KLLN
Sbjct: 827 DN-GEITQQGTYDEITKDADSPLWKLLN 853

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 147/545 (26%), Positives = 253/545 (46%), Gaps = 33/545 (6%)

Query: 185  LSITQFVGIFAGALVVGATANFGR-VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNK 243
            + + +FVGI+A   +  A  N  R ++LL     R   +L   +    ++  ++FF+   
Sbjct: 1001 IDVWKFVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTP 1060

Query: 244  VGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLV 303
            +G +++RF +D   V  ++       FK+I    + + ++  IS  L  V  LF    L+
Sbjct: 1061 IGRILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITV-ILITISMPLFLVFCLF----LM 1115

Query: 304  GAFIYGKKISAI-SRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIR 358
              +IY +K+  + SR+L++    S   +  +  E L G+  I+++  +   + +Y +  R
Sbjct: 1116 VIYIYYQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAY--KHFSMFKYLNNER 1173

Query: 359  QLFYVG---KREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTE 415
              F +                   I   M  +  +L  + +     L+ G +   M Y  
Sbjct: 1174 VQFNINCVFDYRSTNRWLSIRLQTIGALMVLITGMLSLSTISSSKPLTAGMVGLLMSYVL 1233

Query: 416  YTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISH----ALTPTQGKIEFRDV 471
               +S+  +      +  G  +  R+ E  +  +     +      +  P++G I+F++ 
Sbjct: 1234 QVTTSLMWIVRSSVMIETGIVSVERIMEYCELPSEAEQIVDDYRPASNWPSKGAIQFKNY 1293

Query: 472  SFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD 531
            S  Y     + + K++S  I PG  V IVG +G GKST+T  L R  +P  G+I+ID  D
Sbjct: 1294 STRYRAN-LDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMD 1352

Query: 532  ISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI-TYGLSYTPTMDEIRVVS-------KQCF 583
            ISK     LR HL ++ Q+     GT+R N+  + +     +D    +S       K   
Sbjct: 1353 ISKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLME 1412

Query: 584  CHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 643
              G      D  +  I   G+SLS GQRQ + +ARAL+ + KIL+LDEAT+++DVE++  
Sbjct: 1413 ESGSELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKI 1472

Query: 644  INYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFK 703
            I  T+      +  TII+IAHR+ T+  S+ I+V+   G V E      L   ++S LF 
Sbjct: 1473 IQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPASLLA-DKSTLFY 1528

Query: 704  LLNEK 708
             L EK
Sbjct: 1529 QLCEK 1533

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 109/218 (50%), Gaps = 20/218 (9%)

Query: 498 CIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR--HLGVVQQEPTLMS 555
           C+VG  G GK+T+   +L       G +   +        K + R   +    QE  +M+
Sbjct: 663 CVVGRVGSGKTTLLKSIL-------GQLPCTSGSQKAIPPKLIIRGESVAYCPQEAWIMN 715

Query: 556 GTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
            +I++NI +G  Y  T   + V  K C         PDG +T++G +G +LSGGQ+ R++
Sbjct: 716 DSIKENILFGHRYDETFYNLTV--KACELRPDFKILPDGDNTLVGEKGITLSGGQKARLS 773

Query: 616 IARALIKKPKILILDEATSALDVESEGAINYTL----GTLMRSKELTIISIAHRLSTIRR 671
           +ARA+  +  I +LD+  SA+D     +I + +      L+++K   II   + +S +  
Sbjct: 774 LARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNK--AIILTTNDISVLEH 831

Query: 672 SENIIVVGNDGSVVEVGKFDKLYRNEESE--LFKLLNE 707
           S+ I V+  DG ++E   + +   + + +  L+KLL E
Sbjct: 832 SDRIYVL-QDGRIIEESTYAEAIEDNDVKPFLYKLLKE 868

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 143/539 (26%), Positives = 246/539 (45%), Gaps = 40/539 (7%)

Query: 189  QFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDRNKVGDL 247
            +++ I+    +  A A   + ++L +      S+ L + +    +   + FF+   +G +
Sbjct: 991  RYLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMANSVLRAPMAFFETTPIGRI 1050

Query: 248  ISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFI 307
            ++RF +D Y V   + +  S  F       V +     +    T   +    PL V    
Sbjct: 1051 LNRFSNDIYKVDALLGRTFSQFF----VNAVKVIFTITVICATTWQFIFIIIPLGVCYIY 1106

Query: 308  YGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEIRRYN----DAIR 358
            Y +     SR+L++   ++TR       +E L G+ T++ + +++K     N    D   
Sbjct: 1107 YQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQCRIDNNM 1164

Query: 359  QLFYV---GKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTE 415
              FY      R             ILG  +  +  L       QG L+ G     + Y  
Sbjct: 1165 SAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLK------QGTLTAGMAGISLSYAL 1218

Query: 416  YTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN----SVRSNISHALTPTQGKIEFRDV 471
                ++  +     E+     +  R+ E  D K+    ++  ++     P+QG I+F + 
Sbjct: 1219 QITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQGDIKFNNY 1278

Query: 472  SFSYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
            S  Y  RP  + + KH++  I+P   + IVG +G GKS++T  L R  + + G+I+ID  
Sbjct: 1279 STRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVIDGI 1336

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE--IRVVSKQCFCHGFI 588
             I++     LR  L ++ Q+  +  G++R+NI     YT   DE   R +         +
Sbjct: 1337 AINEIGLYDLRHRLSIIPQDSQVFEGSLRENIDPTNQYT---DEAIWRALELSHLKEHVL 1393

Query: 589  TKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 648
            +   DG D  +   G +LS GQRQ + +ARA++   KILILDEAT+A+DVE++  +  T+
Sbjct: 1394 SMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVVQETI 1453

Query: 649  GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
             T  + +  TI++IAHRL+TI  S+ IIV+ N G+V E     +L  N ES    L  E
Sbjct: 1454 RTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLLSNSESLFHSLCAE 1509

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 114/470 (24%), Positives = 210/470 (44%), Gaps = 52/470 (11%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQSSGNL----TRVAEEQ 333
           F I   L S+  L    + VG  I          +  I ++LQ+S        TRV  E 
Sbjct: 432 FQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEI 491

Query: 334 LNGIRTIKSFVAEKK-----EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN I+++K +  EK      E  R N  ++ L  +G               ++   +F  
Sbjct: 492 LNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLVSCCTFA- 550

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           V +Y  +  L   L    LT F L +      +  +    +  ++ + +  RLF    ++
Sbjct: 551 VFVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRLFTFFTNE 606

Query: 449 NSVRSNISHALTPTQ--GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGP 502
             ++ +    L   +  G +      D +F +  +P  ++  K+++F  + G   C+VG 
Sbjct: 607 -ELQPDSVQRLPKVENFGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGELTCVVGK 665

Query: 503 SGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI 562
            G GK+ + S +L            D   +  F T  +   +  V Q P +M+GT+ +NI
Sbjct: 666 VGSGKTALLSCMLG-----------DLFRVKGFAT--VHGSVAYVSQVPWIMNGTVMENI 712

Query: 563 TYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIK 622
            +G  Y     E  +  K C     +    DG  T++G +G SLSGGQ+ R+++ARA+  
Sbjct: 713 LFGHKYDVEFYEKTI--KACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYS 770

Query: 623 KPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVG 679
           +    +LD+  +A+D   +   I + LG   L+ +K  T +   +++S +  ++++ ++ 
Sbjct: 771 RADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TRLLATNKVSALSIADSVALLD 828

Query: 680 NDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKN 729
           N G +++ G +D++ ++ +S L+KLLN    D   K+ N  +   DS KN
Sbjct: 829 N-GEIIQKGTYDEITKDADSPLWKLLN----DYGKKNNNKRNDSGDSSKN 873

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 145/518 (27%), Positives = 252/518 (48%), Gaps = 58/518 (11%)

Query: 222  RLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMG 281
            ++ + ++   +H +I FFD   VG +++RF  D   V + +   +      I C    + 
Sbjct: 1074 KIFNNMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLE---VTIFCLIQCLS 1130

Query: 282  MMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGI 337
            ++F I+  +T   L+ A  +LV  +  GK   +  R+L++    +   + +   E L G+
Sbjct: 1131 IIFLIT-IITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETLAGV 1189

Query: 338  RTIKSFVAEKKEIRRYNDAI----RQLFY--VGKREXXXXXXXXXXXXILGDMSFVIVLL 391
             TI++F  EK+ I    D I    R  FY  V  +             +LG  SF++   
Sbjct: 1190 CTIRAFGDEKRFILENMDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFIVLGSGSFIL--- 1246

Query: 392  YGANLVLQGALSIGDLTAFMLYTEYTGSSVF-----GLSTFYSELMKGAGAASRLFEL-- 444
                      L+IGD+ + +     T S +F      L   YS       +  RL E   
Sbjct: 1247 ----------LNIGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYSG 1296

Query: 445  MDHKNSVRSNIS---HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVG 501
            ++ +N   ++I    ++L P  GKIE  ++S  Y +     + K++SFT++P + + IVG
Sbjct: 1297 IEQENYNENHIQALQNSLWPEHGKIEVDNLSLRYASNLP-PVIKNVSFTVDPQTKIGIVG 1355

Query: 502  PSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN 561
             +G GKSTI + L R   P  G I ID +DISK    +LRR + ++ Q+P L +GTI+ N
Sbjct: 1356 RTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSN 1415

Query: 562  ITYGLSYTP-----TMDEIRVVS---------KQCFCHGFITKFPDGYDTVIGPRGASLS 607
            +     Y        + ++ ++S         ++    G   +F +   T I   G +LS
Sbjct: 1416 LDPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLN-LRTEIVEGGLNLS 1474

Query: 608  GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL-GTLMRSKELTIISIAHRL 666
             G++Q + IAR+L+++PKI++LDEATS++D +S+  I   +     RS   TI++IAHRL
Sbjct: 1475 QGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSRS---TILTIAHRL 1531

Query: 667  STIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
             ++   + ++V+ + G V E     +L +NE S  + +
Sbjct: 1532 RSVIDYDKVLVM-DAGEVKEYDHPYELLKNERSIFYSM 1568

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 143/316 (45%), Gaps = 23/316 (7%)

Query: 424 LSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQI 483
           LS   S + +   +  R+ E ++ +++ + N    ++P + KI+F+  +  +     N I
Sbjct: 621 LSNMLSFMNQSKVSLERIVEFLNEEDTAKYN-QLTVSPDKNKIKFKKATLVW-NENDNDI 678

Query: 484 FKH----MSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILID----NHDISKF 535
            K     ++     G    I+G +G GKS +   LL       GSI++      HD+   
Sbjct: 679 NKFRLCDLNINFRIGKLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIP- 737

Query: 536 TTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV--VSKQCFCHGFITKFPD 593
               L        Q   L++GT+R+NI +   Y    DE R   V   C     +   P 
Sbjct: 738 DLNGLTNSFAYCSQSAWLLNGTVRNNIIFNGVY----DENRYKNVIDACGLKRDLEILPA 793

Query: 594 GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMR 653
           G  T IG +G +LSGGQ+QRI++ARA+    K ++LD+  SA+D  +   I     T + 
Sbjct: 794 GDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWIYEICITGLL 853

Query: 654 SKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE--SELFKLLNEKDHD 711
            K  T I + H +S   R     V+  +G V   G   +L +N+    E F  L+  D++
Sbjct: 854 MKNRTCILVTHNISLAIRKAYFAVILENGKVKSQGTITEL-KNKGVFKEDFGQLSYDDNN 912

Query: 712 L---VSKSENTSDIPP 724
               +++SE   +I P
Sbjct: 913 TEKNINRSEYFQEIAP 928

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  148 bits (374), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 147/521 (28%), Positives = 243/521 (46%), Gaps = 50/521 (9%)

Query: 210  VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAY----VVSRSMTQN 265
            V   I G R +  L +  + +     + FF+   +G +++RF +D Y    ++ R+ +Q 
Sbjct: 1014 VFCTIRGSRYLHDLMTDAVLKA---PMSFFETTPIGRILNRFSNDIYKIDSILGRTFSQF 1070

Query: 266  VSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGN 325
              +  K +    V       I +T T   +    PL V    Y +     SR+L++   +
Sbjct: 1071 FVNAVKVVFVMAV-------ICAT-TWQFIFVIIPLGVFYIYYQQYYLRTSRELRRLD-S 1121

Query: 326  LTRVA-----EEQLNGIRTIKSFVAEKK-----EIRRYNDAIRQLFYV---GKREXXXXX 372
            +TR       +E L GI TI+ +  EK+     + R  N+     FY      R      
Sbjct: 1122 ITRSPVYSHFQETLGGITTIRGYNQEKRFGHINQCRVDNNM--SAFYPSINANRWLAFRL 1179

Query: 373  XXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELM 432
                   ILG  +  I  L       +G L+ G +   + Y      ++  +     E+ 
Sbjct: 1180 ELIGSIIILGAATLSIFRLK------EGTLTPGMVGLSLSYALQITQTLNWIVRMTVEVE 1233

Query: 433  KGAGAASRLFELMDHKNS----VRSNISHALTPTQGKIEFRDVSFSYPTRPS-NQIFKHM 487
                +  R+ E    ++     V       + PT+G I+F + S  Y  RP  + + K++
Sbjct: 1234 TNIVSVERVKEYAQLESEAPRIVEEKRPDEMWPTEGDIKFENYSTRY--RPELDLVLKNI 1291

Query: 488  SFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVV 547
            +  I P   V IVG +G GKS++T  L R  +   G+I+ID   I++     LR  L ++
Sbjct: 1292 NVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAGNIIIDGIPINEIGLYDLRHKLSII 1351

Query: 548  QQEPTLMSGTIRDNITYGLSYTPTMDEI-RVVSKQCFCHGFITKFPDGYDTVIGPRGASL 606
             Q+  +  GT+R+NI     +T   +EI RV+         ++   DG D  +   G++L
Sbjct: 1352 PQDSQVFEGTLRENIDPTNLFTD--EEIWRVLELSHLKEHVLSMGADGLDVQLTEGGSNL 1409

Query: 607  SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRL 666
            S GQRQ + +ARAL+   KIL+LDEAT+A+DVE++  +  T+ T  + +  TI++IAHRL
Sbjct: 1410 SVGQRQLMCLARALLIPSKILVLDEATAAVDVETDKIVQETIRTAFKDR--TILTIAHRL 1467

Query: 667  STIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            +TI  S+ IIV+ + G +VE    D+L    ES  + L NE
Sbjct: 1468 NTIMDSDRIIVL-DKGEIVEFDTPDELLAKPESLFYSLCNE 1507

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 110/447 (24%), Positives = 201/447 (44%), Gaps = 46/447 (10%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQSSGNL----TRVAEEQ 333
           F I   L S+  L    + VG  I          +  I R+LQ+         T V  E 
Sbjct: 428 FQIFICLFSLYKLLGHSMWVGFIILVFMIFLNSYLVRIQRKLQKQQMQFKDERTGVISEI 487

Query: 334 LNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN I+++K +  E     K    R +  +  L  +G               ++   +F  
Sbjct: 488 LNNIKSLKLYAWEVPYQTKLNHVRNDKELHNLTKLGCYMAVTSFQFNIVPFLVSCATFA- 546

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           V +Y  N  L   L    LT F L +      +  +    +  ++ + + +RLF  + ++
Sbjct: 547 VFVYTENKPLTTDLVFPALTLFNLLS----FPLMVVPNVITSFVEASVSVNRLFSFLTNE 602

Query: 449 NSVRSNISH-ALTPTQGKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPS 503
              + +I        +G +      + +F +  +P  ++  K+++F  + G   CIVG  
Sbjct: 603 ELQKDSIQRLPKVENKGDVAINLGDNATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKV 662

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKS +             SIL D   +  F T  +  ++  V Q P +M+GT+++NI 
Sbjct: 663 GSGKSALIQ-----------SILGDLFRVKGFAT--VHGNVAYVSQVPWIMNGTVKENIL 709

Query: 564 YGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
           +G  Y     E  +  K C     +    DG  T++G +G SLSGGQ+ R+++ARA+  +
Sbjct: 710 FGHKYDQEFYEKTI--KACALTIDLGILVDGDQTLVGEKGISLSGGQKARLSLARAVYSR 767

Query: 624 PKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVGN 680
               +LD+  +A+D   S+  + + LG   L+ SK  T +   +++S +  +++I ++ N
Sbjct: 768 ADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSK--TKVLCTNKISVLSIADSITLLEN 825

Query: 681 DGSVVEVGKFDKLYRNEESELFKLLNE 707
            G +V+ G ++++  +E+S LFKL+ E
Sbjct: 826 -GEIVQQGSYEEVNSDEDSPLFKLIKE 851

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 143/539 (26%), Positives = 245/539 (45%), Gaps = 40/539 (7%)

Query: 189  QFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDRNKVGDL 247
            +++GI+    +  A A   + ++L +      S+ L + +    +   + FF+   +G +
Sbjct: 991  RYLGIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRI 1050

Query: 248  ISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFI 307
            ++RF +D Y V   + +  S  F       V +     +    T   +    PL V    
Sbjct: 1051 LNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICVTTWQFIFIIVPLGVFYIY 1106

Query: 308  YGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEIRRYN----DAIR 358
            Y +     SR+L++   ++TR       +E L G+ T++ + +++K     N    D   
Sbjct: 1107 YQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQCRIDNNM 1164

Query: 359  QLFYV---GKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTE 415
              FY      R             ILG  +  +  L       QG L+ G +   + Y  
Sbjct: 1165 SAFYPSVNANRWLAYRLELIGSVIILGAATLSVFRLK------QGTLTAGMVGLSLSYAL 1218

Query: 416  YTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALTPTQGKIEFRDV 471
                ++  +     E+     +  R+ E  D K+     +  +      P QG I+F   
Sbjct: 1219 QITQTLNWIVRMTVEVETNIVSVERIKEYADIKSEAPLVIEGHRPPKEWPGQGDIKFNQY 1278

Query: 472  SFSYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
            S  Y  RP  + + K +   I+P   + IVG +G GKS++T  L R  + + G+I+ID  
Sbjct: 1279 STRY--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGI 1336

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE--IRVVSKQCFCHGFI 588
             I++     LR  L ++ Q+  +  GT+R+NI     YT   DE   R +         +
Sbjct: 1337 PINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYT---DEAMWRALELSHLKEHIL 1393

Query: 589  TKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 648
            +   DG D+ +   G++LS GQRQ + +ARA++ + KIL+LDEAT+A+DVE++  I  T+
Sbjct: 1394 SMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQETI 1453

Query: 649  GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
             T  + +  TI++IAHRL+TI  S+ IIV+ N G V E     +L  N +S  + L  E
Sbjct: 1454 RTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPAQLLTNTKSLFYSLCAE 1509

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 110/457 (24%), Positives = 203/457 (44%), Gaps = 54/457 (11%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQSSGNL----TRVAEEQ 333
           F I   L S+  L    + VG  I          +  I ++LQ+S        TRV  E 
Sbjct: 432 FQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEI 491

Query: 334 LNGIRTIKSFVAEKK-----EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN I+++K +  EK      E  R N  +  L  +G               ++   +F  
Sbjct: 492 LNNIKSLKLYAWEKPYREKLEDVRNNKELNNLTKLGCYMAVTSFQFNIVPFLVSCCTFA- 550

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           V +Y  +  L   L    LT F L +      +  +    +  ++ + +  RLF    ++
Sbjct: 551 VFVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRLFSFFTNE 606

Query: 449 NSVRSNISHALTPTQ--GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGP 502
             ++ +    L   +  G I      D +F +  +P  ++  K+++F  + G   C+VG 
Sbjct: 607 -ELQPDSVQRLPKVENVGDIAINIGDDATFLWQRKPEYKVALKNINFQAKKGELTCVVGK 665

Query: 503 SGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI 562
            G GK+ + S           S L D   +  F   S+   +  V Q P +M+GT+++NI
Sbjct: 666 VGSGKTALLS-----------STLGDLFRVKGFA--SVHGSVAYVSQVPWIMNGTVKENI 712

Query: 563 TYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIK 622
            +G  Y     E  +  K C     +    DG  T++G +G SLSGGQ+ R+++ARA+  
Sbjct: 713 LFGHKYDAEFYEKTI--KACALTIDLAILMDGDQTLVGEKGISLSGGQKARLSLARAVYS 770

Query: 623 KPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVG 679
           +    +LD+  +A+D   +   + + LG+  L+ +K  T +   +++S +  +++I ++ 
Sbjct: 771 RADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTK--TKLLATNKVSALSVADSIALLD 828

Query: 680 NDGSVVEVGKFDKLYRNEESELFKLL------NEKDH 710
           N G +++ G +D + ++ +S L+KL+      N K H
Sbjct: 829 N-GEIIQQGTYDDITKDADSPLWKLIKDYGKKNNKTH 864

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 134/509 (26%), Positives = 238/509 (46%), Gaps = 48/509 (9%)

Query: 226  QVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFH 285
            +++ R ++  + FFD   +G +++RF  D  V+   +   +   F   I     + ++  
Sbjct: 1138 KLLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVF 1197

Query: 286  ISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIK 341
            I    T   L+ A  ++  +   G      SR+L++    S   + +   E L+G+ TI+
Sbjct: 1198 I----TPKFLIIAIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIR 1253

Query: 342  SFVAEKKEIRRYNDAIRQ----LFYVGKREXXXXXXXXXXXXI--LGDMSFVIVLLYGAN 395
            +F  E K ++   D I +     FY+                I   G  +F+   L  A+
Sbjct: 1254 AFGNEIKFLKENLDFIDENNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFI---LLNAD 1310

Query: 396  LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455
             +  G   I  LT  + +TE+       +  FYS +     +  RL E M+ +    ++ 
Sbjct: 1311 KIDAGLAGIS-LTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALAD- 1364

Query: 456  SHALTPT-----QGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKST 509
              A+TP+     QG I F + S  Y P  P   + K ++  I+ GS + +VG +G GKST
Sbjct: 1365 PGAITPSENWPVQGAITFANYSLRYAPKLP--DVLKQLNLKIDGGSKIGVVGRTGAGKST 1422

Query: 510  ITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569
            I S L RF D + G ILID+ DIS+   + LR  L ++ Q+P+L  GTIR N+     Y 
Sbjct: 1423 IISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYE 1482

Query: 570  -----PTMDEIRVVSKQCFCH---------GFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
                   + ++ ++++    +          +        D+ I   G +LS GQRQ I 
Sbjct: 1483 NKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLIC 1542

Query: 616  IARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENI 675
            +AR+++   KI++LDEAT+++D +S+  +  T+      K  TI++IAHR+ ++   + I
Sbjct: 1543 LARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKI 1600

Query: 676  IVVGNDGSVVEVGKFDKLYRNEESELFKL 704
            +V+ + G  +E      L +N+ S  + +
Sbjct: 1601 LVL-DAGQALEFDHPYVLLQNKSSIFYSM 1628

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 113/462 (24%), Positives = 205/462 (44%), Gaps = 36/462 (7%)

Query: 245 GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTL----TSVMLLFAPP 300
           G +I+   +DA  V   +   +    +A+I   V + +++ I  T     T+V++ F P 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRILGTAAFIGTAVIIFFIP- 553

Query: 301 LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQL 360
                F+  K I+   R+    +    +   E    IR IKSF  E   I++      + 
Sbjct: 554 --FNVFL-TKLIARFQRETLTFTDQRIQNLNETFQSIRIIKSFGWENNIIQKILGLRNKE 610

Query: 361 FYVGKREXXXXXXXXXXX----XILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEY 416
             V KR                 I+  +SF   +L       Q   +    TA  L+   
Sbjct: 611 ISVLKRNSITWSINALVWYLSPTIITTLSFSYYILVDK----QDLTTPVAFTALALFN-L 665

Query: 417 TGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVR-SNISHALTPTQGKIEFRDVSFSY 475
             + +  LS   + L +   +  R+ + +  K + +  N+S  +  +Q ++ F   +  +
Sbjct: 666 LKAPLDQLSNTINFLTQSKVSLDRIEKFLSVKETTKFENLS--VDSSQNRLAFSGATLGW 723

Query: 476 PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKF 535
                +   ++++   E G    ++GP+G GK+++   LL       G + + N + SKF
Sbjct: 724 CGNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKF 782

Query: 536 T----TKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKF 591
                + +L   +    Q P + + TIR+NI + + Y     E  V++  C         
Sbjct: 783 NLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYDKDRYENVVIA--CGLERDFQIL 840

Query: 592 PDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL--- 648
             G  T++G +G+ LSGGQ+QRI++ARAL  K + LILD+  SA+D  S   I Y +   
Sbjct: 841 NLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWI-YNVCIT 899

Query: 649 GTLMRSKELTIISIAHRLS-TIRRSENIIVVGNDGSVVEVGK 689
           G LM+ +  T I ++H +S TI+++  + ++ N G +V  G+
Sbjct: 900 GPLMQGR--TCILVSHNVSLTIKKASKVFMIEN-GYIVASGR 938

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 152/556 (27%), Positives = 250/556 (44%), Gaps = 58/556 (10%)

Query: 187  ITQFVGIFAGALVVGATA--NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            +  FVG+++  + VG+ A  N   +V+L     R   +L   + K  +   + FF+   V
Sbjct: 1017 VWMFVGVYS-LIGVGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKAI-------ICGGVGMGMMFHISSTLTSVMLLF 297
            G +I+RF SD   V  S+    S  FK+I       I  G  M   F           +F
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFF-----------VF 1124

Query: 298  APPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIR-R 352
               LLV    Y      +SR+L++    S   +  +  E LNG   I ++   ++ I   
Sbjct: 1125 NMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLN 1184

Query: 353  YNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFML 412
            Y      + +V                I   +     +L    +  +  LS G +   M 
Sbjct: 1185 YEKIQYNIDFVFNFRSTNRWLSVRLQTIGATIVLATAMLALTTMNTKKQLSSGMVGLLMS 1244

Query: 413  YT-EYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRS----NISHALTPTQGKIE 467
            Y+ E TGS  + + T    +     +  R+ E  +  +  RS    N      P++G IE
Sbjct: 1245 YSLEVTGSLTWIVRTTVM-IETNIVSVERIVEYCELPSEARSINPENRPDESWPSKGSIE 1303

Query: 468  FRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI 527
            F++ S  Y     + + K ++  I+P   + IVG +G GKST++  L R  +P  GSI+I
Sbjct: 1304 FKNYSTKY-RENLDPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVI 1362

Query: 528  DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT--------------PTMD 573
            D+ +IS      LR HL ++ Q+     GT+R N+     Y+              P ++
Sbjct: 1363 DDINISDLGLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLE 1422

Query: 574  -----EIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI 628
                 EIR        +G ++   D  +  I   G +LS GQRQ + +ARAL+ + KIL+
Sbjct: 1423 KMLDNEIRGADGAAEENGNVS---DVLNVKINENGTNLSVGQRQLLCLARALLNRSKILV 1479

Query: 629  LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688
            LDEAT+++D+E++  I  T+      K+ TI++IAHR+ T+  S+ IIV+ ++G+V E  
Sbjct: 1480 LDEATASVDMETDKIIQDTIRR--EFKDRTILTIAHRIDTVLDSDKIIVL-DEGTVKEFD 1536

Query: 689  KFDKLYRNEESELFKL 704
               KL  ++ S  + L
Sbjct: 1537 SPSKLLSDKASIFYSL 1552

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 126/251 (50%), Gaps = 22/251 (8%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR--HLGV 546
           F  + G  VC+VG  G GKST    +L       G +   +        K + R   L  
Sbjct: 660 FEAKRGDLVCVVGRVGAGKSTFLKGIL-------GQLPCMSGSKGSIPPKLIIRASSLAY 712

Query: 547 VQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASL 606
             QE  +M+ ++R+NI +G  +     ++ +  K C     +   PDG +T++G +G SL
Sbjct: 713 CSQESWIMNSSVRENILFGHKFDKAYYDLTI--KACQLLPDLKILPDGDETLVGEKGISL 770

Query: 607 SGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL---GTLMRSKELTIISI 662
           SGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  + Y L     L+++K  TII  
Sbjct: 771 SGGQKARLSLARAVYSRADIYLLDDVLSAVDAEVSKNIVEYVLIGKAALLKNK--TIILA 828

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY--RNEESELFKLLNEKDHDLVSKSENTS 720
            + +  ++ S+ I  + N G ++E G ++ +    N  S+L KLL E D  + + S+  S
Sbjct: 829 TNTVPILKHSQMIYALEN-GEIIEQGNYEGVMNRENTNSKLKKLLEEFDSPIDNGSK--S 885

Query: 721 DIPPDSPKNDD 731
           DI  +     D
Sbjct: 886 DIQTEHRSESD 896

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  145 bits (366), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 146/552 (26%), Positives = 247/552 (44%), Gaps = 81/552 (14%)

Query: 193  IFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFG 252
            +F G L +     F  + ++ I+  +    L  + +KR +H  + + D   +G +++RF 
Sbjct: 943  VFGGYLFMNI--QFTMLCMMGIMASKW---LNLKAVKRILHAPMSYLDTTPLGRILNRFT 997

Query: 253  SDAYVVSRSMTQNVS---DGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG 309
             D   +   +T+N+      F  II  GV +  + ++     ++  L    +L+      
Sbjct: 998  KDTDSLDNELTENIRLMMSQFANII--GVCVLCIVYLPWFAIAIPFLLLVFVLIADHYQS 1055

Query: 310  -----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364
                 K++ AI R    +  NL  V    L G+ TIK++ ++ + + + +  I ++  V 
Sbjct: 1056 AGREIKRLEAIQRSFVYN--NLIEV----LGGMDTIKAYKSQDRYMTKMDFLINKMNEVS 1109

Query: 365  KREXXXXXXXXXXXXILGDM-----SFVIVLLYGANLVLQGALSIGDLTAFMLY------ 413
                           I  DM     + +I LL           ++G L  ++L       
Sbjct: 1110 ----YMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQFHISPSAVGVLLTYVLQLPGLLN 1165

Query: 414  --------TEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGK 465
                    TE   +S   L T+ +EL + A      +   D+             PT G+
Sbjct: 1166 TVLRALTQTENDMNSAERLVTYATELPQEAAYRKSDYSPPDN------------WPTNGE 1213

Query: 466  IEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGS 524
            + F DVSF+Y P  P+  + K+++ +I  G  + I G +G GKSTI + L R  +   G 
Sbjct: 1214 VIFEDVSFAYRPGLPT--VLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNELTSGR 1271

Query: 525  ILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTP-------------T 571
            I ID  D  K     LRR L ++ Q+P L  GTIR N+     ++               
Sbjct: 1272 IFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLIRGGAIE 1331

Query: 572  MDEIRVVSKQ----CFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKIL 627
             D++  +  Q       +  + KF    D ++   GA+ S G+RQ +A+ RAL+++ KIL
Sbjct: 1332 KDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALVRQSKIL 1389

Query: 628  ILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEV 687
            ILDEATS++D E++G I   + T    ++ TI+ IAHRL TI   + I+V+   G V E 
Sbjct: 1390 ILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL-EKGEVAEF 1446

Query: 688  GKFDKLYRNEES 699
             K + L+ NE+S
Sbjct: 1447 DKPEILFNNEKS 1458

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 108/211 (51%), Gaps = 20/211 (9%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F +++F I+ G  + I GP G GKS++ + +  F     G + I+ H             
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH------------- 663

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
             ++   P + + T+RDNI +G  Y    ++ + V + C     I   P G  T IG RG
Sbjct: 664 -MLLCGYPWIQNATVRDNIIFGSPYD--REKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGTLMRSKELTIISI 662
            +LSGGQ+ RI +AR++ K   I + D+  SA+D    +  ++      ++SK  T I  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKL 693
            H+LS I +++ +IV+  +GS V++G  ++L
Sbjct: 779 THQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  145 bits (366), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 133/519 (25%), Positives = 249/519 (47%), Gaps = 59/519 (11%)

Query: 199  VVGATANF---GRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDA 255
            ++G  ++F   G+V +  + G     ++ ++++       + F D   VG +++RF  D 
Sbjct: 1047 IIGFISSFLTAGKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFHDITPVGRIMNRFSKDM 1106

Query: 256  YVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAI 315
             ++ + +  N    F +++   V + ++F I   +T   LLFA PL    +I G      
Sbjct: 1107 DIIDQQLIPNFEGLFYSVV---VCLWVIFLIG-YITPRFLLFAIPLCALYYIVGSLYLRA 1162

Query: 316  SRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQ----LFYVG-KR 366
            SR+L++    +   + ++  E + G+ TI++   E++ I +   AI +     FY+    
Sbjct: 1163 SRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDKSNAPFFYLNLAT 1222

Query: 367  EXXXXXXXXXXXXILGDMSFVIVLLYG------ANLVLQGALSIGDLTAFMLYTEYTGSS 420
            E            IL   S +IVL         A ++L  A S  + TA  +   ++G  
Sbjct: 1223 EWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTE-TAQWIIKVFSGV- 1280

Query: 421  VFGLSTFYSELMKGAGAASRLFELMD--HKNSVRSNISHALT--PTQGKIEFRDVSFSYP 476
                     EL+    +  R+ E +D   ++S  +N +  L   P  G IEF +++  Y 
Sbjct: 1281 ---------ELL--MSSVERIKEYVDVPLESSESNNYATPLANWPQTGDIEFENLTLRYS 1329

Query: 477  TRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFT 536
               S++    +SF ++ G+ V IVG +G GKS+I + + R  D   G+I+IDN DI    
Sbjct: 1330 PH-SSKALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVP 1388

Query: 537  TKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-----PTMDEIRVVSKQ---CFCHGFI 588
             + LR  +  + Q PTL  GTIR N+     Y+       ++++ ++ +    C   G  
Sbjct: 1389 LECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQK 1448

Query: 589  TKFPDGY---------DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVE 639
              +P  +         +TV+   G+++S GQRQ + +AR+++    I+++DEAT+++D  
Sbjct: 1449 LSYPSNHKLRNRFIDLNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDYV 1508

Query: 640  SEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVV 678
            S+  I  T+   MR+   T+++IAHRL ++   + I+V+
Sbjct: 1509 SDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM 1545

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 120/251 (47%), Gaps = 9/251 (3%)

Query: 444 LMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPS 503
           + D+ N   +     LT ++ K+ F + +  +    ++   K++S   +  +   I+GP+
Sbjct: 643 IQDYLNEPETRKYEILTQSKTKLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPT 702

Query: 504 GKGKSTITSLLLRFYDPNYGSI---LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRD 560
           G GKS++   LL   +   G I    + + D  +     +   +    Q P L+SGTI+D
Sbjct: 703 GSGKSSLLLGLLGELNLRSGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKD 762

Query: 561 NITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARAL 620
           NI +G  +     +   V K C     I     G  T +G  G SLSGGQ+QRIA+ARA+
Sbjct: 763 NIVFGEFFN--QQKFDDVIKCCCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAI 820

Query: 621 IKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVV 678
               + L+ D+  SA+D E+   I      G +M+ +  T I  +H +S I +    +V+
Sbjct: 821 YSSSRYLLFDDCLSAVDPETALHIYEECLCGPMMKGR--TCIVTSHNISLIIKQAQWLVI 878

Query: 679 GNDGSVVEVGK 689
            ++G V   GK
Sbjct: 879 LDNGEVKAQGK 889

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 147/556 (26%), Positives = 254/556 (45%), Gaps = 52/556 (9%)

Query: 187  ITQFVGIFAGALVVGATAN-FGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            + +FV ++A   +  A  N F  +++L     R    L   + K  +   ++FF+   +G
Sbjct: 1001 VWKFVAVYALIGLGSAAFNIFRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIG 1060

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSV----MLLFAPPL 301
             +I+RF SD   V  ++    S  F++I        + + ++  L SV     LLF   +
Sbjct: 1061 RVINRFSSDIDSVDVNLQNVFSIFFRSI--------LDYILTVILVSVAMPWFLLFNALI 1112

Query: 302  LVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKK------EIR 351
            ++  F Y K     SR+L++    +   +  +  E L G   I ++   K       E  
Sbjct: 1113 MIIYFYYEKLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISAYNHSKMFKFMNIERV 1172

Query: 352  RYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFM 411
            +YN  +   F    R             IL      +  L  ++ +  G + +      M
Sbjct: 1173 QYNLNVLFTFRSTNRWLSIRLQSIGAFIILCTGLLALTTLRTSSPIGSGLIGL-----LM 1227

Query: 412  LYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM----DHKNSVRSNISHALTPTQGKIE 467
             Y     S++  +     ++     +  R+ E      + ++ + SN      P +G IE
Sbjct: 1228 SYVLQVTSALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIE 1287

Query: 468  FRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI 527
            F++ + +Y    S  + K++S TI P   V IVG +G GKST++  L R  +   G+I I
Sbjct: 1288 FKNYTTTYRANLS-PVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFI 1346

Query: 528  DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGF 587
            D  DIS+     LR ++ ++ Q+     GT+R N+     +T    E+  V +       
Sbjct: 1347 DGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDV--ELWNVIELSHLKPH 1404

Query: 588  ITKFPD---------GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
            + +  +         G D  I   G++LS GQRQ + +ARAL+ + K+L+LDEAT+A+DV
Sbjct: 1405 VLRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDV 1464

Query: 639  ESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD--KLYRN 696
            E++  I  T+ T  + K+ TI++IAHRL TI  ++ I+V+   G    V +FD  K   +
Sbjct: 1465 ETDKIIQETIRT--QFKDRTILTIAHRLDTIMDNDKILVLDAGG----VKEFDSPKNLLS 1518

Query: 697  EESELFKLLNEKDHDL 712
            +ES LF  L +K + L
Sbjct: 1519 DESTLFYQLCDKGNYL 1534

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 129/260 (49%), Gaps = 28/260 (10%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLR-RHLGVV 547
           FT  P S  C++G  G GK+T+   +L       GS       IS     S+R   +   
Sbjct: 647 FTASPKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISP--KLSIRGESIAYC 700

Query: 548 QQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLS 607
            QE  +M+ TI++NI +G  +  T   + V +  C         PDG  T++G +G SLS
Sbjct: 701 PQEAWIMNDTIKENILFGHKFDETYYTLTVAA--CELLADFDILPDGDQTLVGEKGISLS 758

Query: 608 GGQRQRIAIARALIKKPKILILDEATSALDV-ESEGAINYTLGT---LMRSKELTIISIA 663
           GGQ+ R+++ARA+  +  I +LD+  SA+D   S+  +   L +   L+R+K  T+I   
Sbjct: 759 GGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSGLLRNK--TVILST 816

Query: 664 HRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR----NEESELFKLLNEKDHDLVSK---- 715
           + +S ++ S+ I  + N G +VE G ++ +      ++ES++  LL + D  L  +    
Sbjct: 817 NTVSVLKHSQLIYALEN-GIIVERGNYNDIIESANSDDESKISALLKQFDVSLAKRESSN 875

Query: 716 ----SENTSDIPPDSPKNDD 731
               S++ + IP DS    D
Sbjct: 876 LSLTSKSQTAIPQDSTTKSD 895

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 138/489 (28%), Positives = 222/489 (45%), Gaps = 39/489 (7%)

Query: 238  FFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLF 297
            FF+   +G +++RF +D Y V   + +  S  F       V +     +    T   +  
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFF----VNAVKVSFTIIVICFTTWQFIFI 1093

Query: 298  APPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKK----- 348
              PL V    Y +     SR+L++    +   +    +E L GI TI+ +  + +     
Sbjct: 1094 IIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGYQQQHRFTHIN 1153

Query: 349  EIRRYNDAIRQLFYV---GKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIG 405
            + R  N+     FY      R             ILG  +  +  L       QG L+ G
Sbjct: 1154 QCRVDNNM--SAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLR------QGTLTAG 1205

Query: 406  DLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISH----ALTP 461
             +   + Y      S+  +     E+     +  R+ E  D K+   + I         P
Sbjct: 1206 MVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAETWP 1265

Query: 462  TQGKIEFRDVSFSYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDP 520
             +G I+F   S  Y  RP  + I K ++  I+P   V IVG +G GKS++T  L R  + 
Sbjct: 1266 DEGDIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEA 1323

Query: 521  NYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE--IRVV 578
            + G I+IDN  I++     LR  L ++ Q+  +  GT+R+NI     YT   DE    V+
Sbjct: 1324 SSGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPTNEYT---DEQIWNVL 1380

Query: 579  SKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
            +        I+   +G +  +   G +LS GQRQ + +ARAL+   KIL+LDEAT+A+DV
Sbjct: 1381 ALSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDV 1440

Query: 639  ESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE 698
            E++  I  T+ T  + +  TI++IAHR++TI  S+ IIV+ N G++ E    +KL  N  
Sbjct: 1441 ETDKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLENPS 1497

Query: 699  SELFKLLNE 707
            S  + L  E
Sbjct: 1498 SLFYSLCQE 1506

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 109/470 (23%), Positives = 210/470 (44%), Gaps = 49/470 (10%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQSSGNL----TRVAEEQ 333
           F +   L S+  L    + VG  I          +  + ++LQ+S        TRV  E 
Sbjct: 428 FQVILCLVSLYKLLGKSMWVGVLILVIMIPINSYLVRVQKKLQKSQMTYKDERTRVISEM 487

Query: 334 LNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN I+++K +  E     K E  R N  ++ L  +G               ++   +F  
Sbjct: 488 LNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLVSCCTFA- 546

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
             +Y  N  L   L    LT F L        +  +    + +++ + +  RLF  + ++
Sbjct: 547 AFIYTENRPLTTDLVFPALTLFNL----LHFPLMVIPNVLTMIIETSVSIGRLFSFLTNE 602

Query: 449 NSVRSNISHALTPTQ-GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPS 503
              +  +      T  G +      D +F +  +P  ++  K+++F  + G   CIVG  
Sbjct: 603 ELQKDAVQRLPKVTNIGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGELTCIVGKV 662

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKS +             SIL D   +  F T  +  ++  V Q   +M+GT+++NI 
Sbjct: 663 GSGKSAMIQ-----------SILGDLFRVKGFAT--IHGNVAYVSQVAWIMNGTVKENIL 709

Query: 564 YGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
           +G  Y    D  +   K C     +    DG  T++G +G SLSGGQ+ R+++ARA+  +
Sbjct: 710 FGHKYDE--DFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSR 767

Query: 624 PKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVGN 680
               +LD+  +A+D   +   + + LG   L+ +K  T +   +++S +  ++++ ++ N
Sbjct: 768 ADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTK--TKVLATNKVSVLSIADSVSLLEN 825

Query: 681 DGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKND 730
            G +V+ G +D++ +++ S L KL+ E        +++TS++ P +  ++
Sbjct: 826 -GEIVQQGTYDEIMKDDSSPLSKLITEYGK---KSTDSTSNVTPSTSSSN 871

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 145/555 (26%), Positives = 251/555 (45%), Gaps = 76/555 (13%)

Query: 190  FVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLIS 249
            ++G+++  +        G+  +L  +G      L  + +KR +H  + + D   +G +++
Sbjct: 934  YMGLYSFFVFAAFIFMNGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILN 993

Query: 250  RFGSDAYVVSRSMTQNV---SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF 306
            RF  D   +   +T+++   +  F  I+  GV +  + ++     ++  L    +L+   
Sbjct: 994  RFTKDTDSLDNELTESLRLMTSQFANIV--GVCVMCIVYLPWFAIAIPFLLVIFVLIADH 1051

Query: 307  IYG-----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLF 361
                    K++ A+ R    ++ N      E L G+ TIK++ ++++ + + +  I ++ 
Sbjct: 1052 YQSSGREIKRLEAVQRSFVYNNLN------EVLGGMDTIKAYRSQERFLAKSDFLINKMN 1105

Query: 362  YVGKREXXXXXXXXXXXXILGDM-----SFVIVLLYGANLVLQGALSIGDLTAFMLY--- 413
              G               I  DM     + +I LL         A S+G L  ++L    
Sbjct: 1106 EAG----YLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPG 1161

Query: 414  -----------TEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPT 462
                       TE   +S   L T+ +EL     A+ R  E+   ++           P+
Sbjct: 1162 LLNTILRAMTQTENDMNSAERLVTYATEL--PLEASYRKPEMTPPES----------WPS 1209

Query: 463  QGKIEFRDVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPN 521
             G+I F +V F+Y  RP   I  K+++  I+ G  + I G +G GKSTI S L R  +  
Sbjct: 1210 MGEIIFENVDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELT 1267

Query: 522  YGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN----------------ITYG 565
             G ILIDN DIS+     LRR L ++ Q+P L  GTIR N                +  G
Sbjct: 1268 AGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGG 1327

Query: 566  LSYTPTMDEIRVVS-KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624
                  + E+++    +   HG + KF    D  +   G++ S G+RQ +A+ RAL+++ 
Sbjct: 1328 AIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQS 1385

Query: 625  KILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSV 684
            KILILDEATS++D E++G I   +  +    + TI+ IAHRL TI   + I+V+   G V
Sbjct: 1386 KILILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEV 1442

Query: 685  VEVGKFDKLYRNEES 699
             E      L+  E+S
Sbjct: 1443 AEFDTPWTLFSQEDS 1457

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 106/210 (50%), Gaps = 18/210 (8%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           FK ++F I+ G  + I GP G GKS++ + +        G + + N D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEV-NGDL----------- 651

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
             ++   P + + ++RDNI +G  +    ++   V + C     +   P G  T IG RG
Sbjct: 652 --LMCGYPWIQNASVRDNIIFGSPFNK--EKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIA 663
            +LSGGQ+ RI +AR++ KK  I + D+  SA+D      I     T M + +  I++  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILA-T 766

Query: 664 HRLSTIRRSENIIVVGNDGSVVEVGKFDKL 693
           H+LS I R+  +IV+G DG  V++G  D+L
Sbjct: 767 HQLSLIERASRVIVLGTDGQ-VDIGTVDEL 795

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 130/498 (26%), Positives = 231/498 (46%), Gaps = 52/498 (10%)

Query: 227  VIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHI 286
            V+ + +H  + FFD    G +++R   D   V + +       F A++     + ++ ++
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 287  SSTLTSVMLLFAPPL--LVGAFIYGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRT 339
            +     +M +F   L  L+G F         SR+L++   ++TR        E L GI +
Sbjct: 1174 TPQFL-IMAIFIGFLYALIGYFYV-----TTSRELKRFE-SITRSPIYQHFSETLVGITS 1226

Query: 340  IKSFVAEKK----EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGAN 395
            I+++  E++     + R +D  R  FY+                ++   S + + L    
Sbjct: 1227 IRAYGDERRFMLENLSRIDDNNRPFFYLWIANRWLAFRVDLLGALVTFFSGLFIYLNIGK 1286

Query: 396  LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN---SVR 452
            L     L+   LT  + +TE            YS +     +  RL E M+ +    +  
Sbjct: 1287 L--DAGLAGISLTYAIFFTE----GALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNEN 1340

Query: 453  SNISHALTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTIT 511
            + +     P  G+I+  D+S  Y P  P  ++ K+++F++EP   V IVG +G GKSTI 
Sbjct: 1341 AQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKSTII 1398

Query: 512  SLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT-- 569
            + + RF DP  G + IDN DI+      LR+ + ++ Q+PTL +GT++  +     Y+  
Sbjct: 1399 TAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDK 1458

Query: 570  ---PTMDEIRVVSKQCFCHGF----------ITKFPDGYDTVIGPRGASLSGGQRQRIAI 616
                 +  + ++S                  I KF D  +  +   GA+LS GQRQ + +
Sbjct: 1459 QIYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLD-LNNEVTEGGANLSQGQRQLVCL 1517

Query: 617  ARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENII 676
            AR+L++ PKI++LDEAT+++D  S+  I  T+    R    TI++IAHRL +I   + ++
Sbjct: 1518 ARSLLRSPKIIMLDEATASIDYTSDEKIQQTIREEFRDS--TILTIAHRLKSIIDYDKVL 1575

Query: 677  VVGNDGSVVEVGKFDKLY 694
            V+       EV ++D  Y
Sbjct: 1576 VMDAG----EVKEYDHPY 1589

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 97/406 (23%), Positives = 170/406 (41%), Gaps = 54/406 (13%)

Query: 315 ISRQLQQSSGNLTRVA-----------EEQLNGIRTIKSFVAE---KKEIRRYNDAIRQ- 359
           ++ +L Q  GNLT V             E L  IR IK F  E   +KE++    AIR+ 
Sbjct: 514 LNYKLAQKLGNLTVVTLGFTDKRIQKLNETLQSIRIIKFFAWETNFEKEVQ----AIRED 569

Query: 360 -LFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTG 418
            L  + KR             +    + V+   +   + +QG +         +   +T 
Sbjct: 570 ELATLLKRAIVWSAISFLWFMV---STIVVSASFACYIYIQGEV-------LTIPVAFTA 619

Query: 419 SSVFG--------LSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRD 470
            S+F         L+   S +++   +  R+   +D   + +      LT +  ++ F +
Sbjct: 620 LSLFVMLRNPLDVLADMLSYVVQSKVSLDRIQAFLDEDETTKY---EQLTISGNRLAFEN 676

Query: 471 VSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
            + ++   PS+   +++      G      GP+G GKS++   LL       G I + + 
Sbjct: 677 ATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKIYVPSL 736

Query: 531 DISK---FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV--VSKQCFCH 585
           D  +        L   +    Q   L++ T R NI +   Y    +E R   V + C   
Sbjct: 737 DPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPY----NEQRYNDVLEACGLK 792

Query: 586 GFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI- 644
                   G  T IG +G +LSGGQ+QRI++ARAL    + L+LD+  SA+D  +   I 
Sbjct: 793 KDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALLIY 852

Query: 645 -NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
            N  +G LM  +  T + ++H ++   R+ + +V+  +G V   G+
Sbjct: 853 ENCIIGPLMEGR--TCVLVSHNVALTMRNADWVVILENGRVKAQGE 896

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 140/540 (25%), Positives = 243/540 (45%), Gaps = 40/540 (7%)

Query: 183  GTLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDR 241
            G  +  +++ I+    +  A A   + ++L +      S+ L + +    +   + FF+ 
Sbjct: 985  GNPNAARYLAIYFALGIGSALATLIQTIILWVFCTIHASKYLHNLMTNSVLRAPMTFFET 1044

Query: 242  NKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPL 301
              +G +++RF +D Y V   + +  S  F       V +     +    T   +    PL
Sbjct: 1045 TPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFIIIPL 1100

Query: 302  LVGAFIYGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEIRRYN-- 354
             V    Y +     SR+L++   ++TR       +E L G+ T++ + +++K     N  
Sbjct: 1101 GVFYIYYQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQC 1158

Query: 355  --DAIRQLFYV---GKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTA 409
              D     FY      R             ILG  +  +  L       QG L+ G +  
Sbjct: 1159 RIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLK------QGTLTSGMVGL 1212

Query: 410  FMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALTPTQGK 465
             + Y      ++  +     E+     +  R+ E  D K+     +  +      P QG 
Sbjct: 1213 SLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIIEGHRPPKQWPAQGD 1272

Query: 466  IEFRDVSFSYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGS 524
            I F + S  Y  RP  + + K ++  I+P   V IVG +G GKS++T  L R  + + G+
Sbjct: 1273 IRFNNYSTRY--RPELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGN 1330

Query: 525  ILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE--IRVVSKQC 582
            I+ID   I++     LR  L ++ Q+  +  GT+R+NI     Y+   DE   R +    
Sbjct: 1331 IVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYS---DEAIWRALELSH 1387

Query: 583  FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 642
                 ++   DG D  +   G++LS GQRQ + +ARA++   KIL+LDEAT+A+DVE++ 
Sbjct: 1388 LKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDK 1447

Query: 643  AINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELF 702
             +  T+ T  + +  TI++IAHRL+TI  S+ IIV+ N G V E     +L  N +S  +
Sbjct: 1448 VVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDTPGQLLSNSKSLFY 1504

 Score =  103 bits (258), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 117/471 (24%), Positives = 209/471 (44%), Gaps = 54/471 (11%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQSSGNL----TRVAEEQ 333
           F I   L S+  L    + VG  I          +  I ++LQ+S        TRV  E 
Sbjct: 432 FQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEI 491

Query: 334 LNGIRTIKSFVAEK------KEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFV 387
           LN I+++K +  EK      +E+R  N  ++ L  +G               ++   +F 
Sbjct: 492 LNNIKSLKLYAWEKPYREKLEEVRN-NKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTFA 550

Query: 388 IVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDH 447
            V +Y  +  L   L    LT F L +      +  +    +  ++ + +  RLF    +
Sbjct: 551 -VFVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRLFSFFTN 605

Query: 448 KNSVRSNISHALTPTQ--GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVG 501
           +  ++ +    L   +  G I      D +F +  +P  ++  K++ F    G+  CIVG
Sbjct: 606 E-ELQPDSVQRLPNVENIGDIAINIGDDATFLWQRKPEYKVALKNIDFQATKGNLTCIVG 664

Query: 502 PSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN 561
             G GK+ + S +L            D   +  F T  +   +  V Q P +M+GT+++N
Sbjct: 665 KVGSGKTALLSCMLG-----------DLFRVKGFAT--VHGCIAYVSQVPWIMNGTVKEN 711

Query: 562 ITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALI 621
           I +G  Y     E  +  K C     +    DG  T++G +G SLSGGQ+ R+++ARA+ 
Sbjct: 712 ILFGHKYDAEFYEKTI--KACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVY 769

Query: 622 KKPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVV 678
            +    +LD+  +A+D   +   I + LG   L+ +K  T I   +++S +  +++I ++
Sbjct: 770 SRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TRILATNKVSALSIADSIALL 827

Query: 679 GNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKN 729
            N G +++ G +  + ++ +S L+KLLN    D   K+ N      DS KN
Sbjct: 828 DN-GEIIQQGAYSDITKDADSPLWKLLN----DYGKKNNNKQSEECDSSKN 873

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 138/551 (25%), Positives = 256/551 (46%), Gaps = 61/551 (11%)

Query: 190  FVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLIS 249
            ++G+++  +        G+  +L ++G      L  + +KR +H  + + D   +G +++
Sbjct: 934  YMGLYSFFVFAAFIFMNGQYTILCVMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILN 993

Query: 250  RFGSDAYVVSRSMTQN---VSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF 306
            RF  D   +   +T++   ++  F  I+  GV +  + ++     ++  L    +L+   
Sbjct: 994  RFTKDTDSLDNELTESLRLLTSQFANIV--GVCVMCIVYLPWFAIAIPFLLVIFVLIADH 1051

Query: 307  IYG-----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLF 361
                    K++ A+ R    ++ N      E L G+ TIK++ ++++ + + +  I ++ 
Sbjct: 1052 YQSSGREIKRLEAVQRSFVYNNLN------EVLGGMDTIKAYRSQERFLAKSDFLINKMN 1105

Query: 362  YVGKREXXXXXXXXXXXXILGDM-----SFVIVLLYGANLVLQGALSIGDLTAFMLYTEY 416
              G               +  DM     + ++ LL         A S+G L  ++L    
Sbjct: 1106 EAG----YLVVVLQRWVGVFLDMVAIVFALIVTLLCVTRAFPISAASVGVLLTYVLQLPG 1161

Query: 417  TGSSVF-GLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALT-PTQGKIEFRDVSFS 474
              +++   ++   +++       S   EL    +  +  ++   + P++G+I   +V FS
Sbjct: 1162 LLNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPPESWPSKGEIVLENVCFS 1221

Query: 475  Y-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
            Y P  P   + K+++  IE G  + I G +G GKSTI S L R  + + G ILID+ DIS
Sbjct: 1222 YRPGLPV--VLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILIDDVDIS 1279

Query: 534  KFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR-------VVSKQCF--- 583
            K     LRR L ++ Q+P L  GTIR N+      T   DE+         ++K      
Sbjct: 1280 KLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFDERTD--DELWDALVRGGAIAKNDLSEA 1337

Query: 584  ---------CHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATS 634
                      HG + KF    D  +   G++ S G+RQ +A+ RAL+++ KILILDEATS
Sbjct: 1338 KLQKPDKNGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATS 1395

Query: 635  ALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY 694
            ++D E++G I   +  +    + TI+ IAHRL TI   + I+V+       EV +FD  +
Sbjct: 1396 SVDYETDGKIQARI--VEEFGDCTILCIAHRLQTIVNYDRILVLEKG----EVAEFDTPW 1449

Query: 695  R--NEESELFK 703
                +E+ +F+
Sbjct: 1450 TLFTQENSIFR 1460

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 121/247 (48%), Gaps = 23/247 (9%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           FK ++F I+ G  + I GP G GKS++ + +        G I + N D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDL----------- 651

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
             ++   P + +  +RDNI +G  +    ++   V + C     +   P G  T IG RG
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFGSPFIK--EKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIA 663
            +LSGGQ+ RI +AR++ K+ +I + D+  SA+D      I     T M + +  I++  
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILA-T 766

Query: 664 HRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIP 723
           H+LS I R+  +IV+G DG  V++G  D+L    ++ L KLL     +    S+   D+P
Sbjct: 767 HQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT-LIKLLQFSSQN----SKEEEDVP 820

Query: 724 PDSPKND 730
            +   N+
Sbjct: 821 EEGIINE 827

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  142 bits (358), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 144/544 (26%), Positives = 243/544 (44%), Gaps = 40/544 (7%)

Query: 188  TQFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDRNKVGD 246
            T ++ I+ G  V  A A   + V+L +      S+ L S ++   +   + FF+   +G 
Sbjct: 997  THYLLIYFGFGVTSAFATLCQTVVLWVFCTIHGSKYLHSSMVSSILRAPMTFFETTPIGR 1056

Query: 247  LISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF 306
            +++RF +D Y +   + ++ S  F       V +     +    T   +L   P+ V   
Sbjct: 1057 ILNRFSNDVYKIDEVLGRSFSQFF----VNAVKVSFTILVICWNTWQFILLVIPMGVLYL 1112

Query: 307  IYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFY 362
             Y +     SR+L++    +   +    +E L G+ TI+ +  +K+ I      +     
Sbjct: 1113 YYQQYYLRTSRELRRLDSITKSPIYAHFQESLGGLATIRGYEQQKRFIHINQARVDNNMS 1172

Query: 363  VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFML-----YTEYT 417
                              LG +     +++GA  +    L  G LTA M+     Y    
Sbjct: 1173 AYYPSINSNRWLAYRLEFLGSL-----IIFGAASLSILKLRDGTLTAGMIGLSLSYALQV 1227

Query: 418  GSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL----TPTQGKIEFRDVSF 473
              S+  +     E+     +  R+ E  + K+     I         P +G I+F + S 
Sbjct: 1228 TQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPLIIEEKRPSENWPERGAIKFENYST 1287

Query: 474  SYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDI 532
             Y  RP  + + K++S  I+P   V IVG +G GKS++T  L R  +   GSI++D  +I
Sbjct: 1288 RY--RPDLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFRIIEAAEGSIIVDGLNI 1345

Query: 533  SKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFP 592
            S+     LR  L ++ Q+  +  GTIR+NI     YT   ++I    +       I +  
Sbjct: 1346 SEIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNIYTD--EQIWNALELSHLKQHILRMN 1403

Query: 593  D---------GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 643
            +            T +   G +LS GQRQ + +ARAL+   KILILDEAT+A+DVE++  
Sbjct: 1404 EESVNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDSL 1463

Query: 644  INYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFK 703
            I  T+ T  + +  TI++IAHRL+TI  S+ I+V+ + G V E      L +N ES  + 
Sbjct: 1464 IQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGEVAEFDTPQNLLKNTESLFYS 1520

Query: 704  LLNE 707
            L  +
Sbjct: 1521 LCEQ 1524

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 133/533 (24%), Positives = 247/533 (46%), Gaps = 57/533 (10%)

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQ--NV--SDGFK 271
           G  + S + S + ++ +    E  D +  GD+++    D   + + +TQ  N+  S  F+
Sbjct: 375 GMNIRSAMTSVLYQKALVLSNEASDLSSTGDVVNLMSVDVQRL-QDLTQWCNIIWSGPFQ 433

Query: 272 AIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNL----T 327
            I+C      ++ H S  +  ++L+   PL          +  I +QLQ+         T
Sbjct: 434 IILCLFSLYKLLGH-SMWVGVIVLIVMIPL-------NSYLMRIQKQLQKVQMKYKDERT 485

Query: 328 RVAEEQLNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILG 382
           RV  E LN I+++K +  E     K E  R    ++ L  +G               ++ 
Sbjct: 486 RVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQFNLVPFLVS 545

Query: 383 DMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLF 442
             +F  V +Y  +  L   L    LT F L T      +  L    +  ++ + + SRLF
Sbjct: 546 CSTFA-VFVYIEDKPLTTDLVFPALTLFNLLT----FPLAALPIVITAFIEASVSMSRLF 600

Query: 443 ELMDHKNSVRSNISHALTPT--QGKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSN 496
             M ++  ++++    L P   QG I      + +F +  +P  ++  K++ F  + G  
Sbjct: 601 SFMTNE-ELQTDAIQRLPPVKKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGEL 659

Query: 497 VCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSG 556
            CIVG  G GKS               SIL D   +  F T  +  ++  V Q P +M+G
Sbjct: 660 ACIVGKVGSGKSAFIQ-----------SILGDLFRVKGFAT--IHGNVAYVSQLPWIMNG 706

Query: 557 TIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAI 616
           T++DNI +G  Y     E  +  + C     ++  PDG  T++G +G SLSGGQ+ R+++
Sbjct: 707 TVKDNILFGHKYNQEFYEKTL--RACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSL 764

Query: 617 ARALIKKPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSE 673
           ARA+  +  + +LD+  +A+D   S+  I + +G   L+ +K  T +   +++S +  ++
Sbjct: 765 ARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTK--TRVLATNKISVLSIAD 822

Query: 674 NIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE--KDHDLVSKSENTSDIPP 724
           NI ++ +DG +V+ G ++++  N  S L KL++E    +++ S ++  S + P
Sbjct: 823 NITLL-DDGEIVQQGTYNEVTDNINSPLCKLISEYGNKNNVNSSTDTESTMTP 874

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 147/548 (26%), Positives = 248/548 (45%), Gaps = 59/548 (10%)

Query: 194  FAGALVVGATANFGRVVLLKII-----GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLI 248
            FA +L     AN  + ++L I       ++L S + S + +  M     FF+   +G ++
Sbjct: 994  FASSL-----ANLIQTIILWIFCTIQGSKQLHSSMTSSIFRAPM----SFFETTPIGRIL 1044

Query: 249  SRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIY 308
            +RF +D Y +   + ++ S  F+  I   V   ++   S+T   + L+   P+      Y
Sbjct: 1045 NRFSNDVYKIDEILGRSFSQFFQNTI--RVSFTIVVICSTTWQFIFLII--PMAFLYIYY 1100

Query: 309  GKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364
             +     SR+L++    +   L    +E L G+ TI+ F  + + I      +       
Sbjct: 1101 QQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFIHINQSRVDSNMMAY 1160

Query: 365  KREXXXXXXXXXXXXILGDMSFVIVLLYGANLVL----QGALSIGDLTAFMLYTEYTGSS 420
                            LG +    ++L  A L +     G+L+ G +   M Y      S
Sbjct: 1161 YPSINSNRWLAFRLEFLGSL----IILGAATLSIFRLKNGSLTAGMIGLSMSYALQVTQS 1216

Query: 421  VFGLSTFYSELMKGAGAASRLFELMDHKNS-----VRSNISHALTPTQGKIEFRDVSFSY 475
            +  +     ++     +  R+ E   H  S     + +N      P++G IEF++ S  Y
Sbjct: 1217 LNWIVRMTVDVESNIVSVERI-EEYSHLPSEAPLIIENNRPSEEWPSKGAIEFKNYSTRY 1275

Query: 476  PTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISK 534
              RP  + + K+++  I P   V IVG +G GKS++T  L R  + + GSI ID  +I++
Sbjct: 1276 --RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGSIEIDGVNINE 1333

Query: 535  FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKF--- 591
                 LR  L ++ Q+  +  G+IR+NI     ++    EI    +       I K    
Sbjct: 1334 LGLYDLRHKLSIIPQDSQVFEGSIRENIDPTQQFSE--QEIWNALEMAHLKPHILKMNEI 1391

Query: 592  -PDG-----------YDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVE 639
             P+             D  I   G++LS GQRQ I +ARAL+    +LILDEAT+A+DVE
Sbjct: 1392 SPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLILDEATAAVDVE 1451

Query: 640  SEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEES 699
            ++  I +T+ T  + +  TI++IAHR++TI  S+ IIV+ N G V E  K + L  N+ S
Sbjct: 1452 TDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLDN-GEVAEFDKPEILLTNKNS 1508

Query: 700  ELFKLLNE 707
              + L  E
Sbjct: 1509 LFYSLCYE 1516

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 132/531 (24%), Positives = 231/531 (43%), Gaps = 60/531 (11%)

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
           G  + S L S + ++ +    E  + +  GD+++    D   V R   Q++S     +  
Sbjct: 362 GMNIRSALTSVIYQKALLLSNEATEVSTTGDIVNLMSVD---VQR--LQDLSQWINILWS 416

Query: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG------KKISAISRQLQQSSGNL--- 326
           G       F ++  L S+  L    + +G FI G        I  I ++LQ+        
Sbjct: 417 GP------FQLTLCLISLYNLLGHSMWIGVFILGIMIPINSYIMRIQKKLQKDQMKYKDE 470

Query: 327 -TRVAEEQLNGIRTIKSFVAEKK-----EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXI 380
            T +  E LN I+++K +  EK      E  R    ++ L  +G               +
Sbjct: 471 RTGLVNEILNNIKSLKLYAWEKPFQEKLEFVRNEKELKNLKKIGVFNAMIAFQFNIVPFL 530

Query: 381 LGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASR 440
           +   +F I  ++  +  L   L    LT F L      +    +S F    ++ + + SR
Sbjct: 531 VSCCTFAI-FVWVEDKPLTTDLVFPALTLFNLLNFPLVAVPITISAF----IEASVSISR 585

Query: 441 LFELMDHKNSVRSNISH-ALTPTQGKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGS 495
           L+  + ++   +  I         G+   +   + +F +  +P  ++  K+++F    G 
Sbjct: 586 LYSYLTNEELQKDAIQRLPFVKQNGETTVKIGDNATFLWKRKPEYKVALKNINFEARKGE 645

Query: 496 NVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMS 555
             CIVG  G GKS               SIL D   +  F   S+  ++  V Q   +M+
Sbjct: 646 LACIVGKVGSGKSAFIQ-----------SILGDLFRVKGFA--SIHGNVAYVSQLAWIMN 692

Query: 556 GTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
           GT++DNI +G  Y P   E  +  K C     ++  PDG  T++G +G SLSGGQ+ R++
Sbjct: 693 GTVKDNIIFGHRYDPEFYEKTI--KACALTIDLSILPDGDQTLVGEKGISLSGGQKARLS 750

Query: 616 IARALIKKPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRS 672
           +ARA+  +  I +LD+  +A+D   S+  I   LG   L++SK  T I   +++  +  +
Sbjct: 751 LARAVYARADIYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSK--TRILTTNKIPVLSIA 808

Query: 673 ENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE--KDHDLVSKSENTSD 721
           ++I ++ N G + E G +  +   E S L KL+ E  K  D  S+SE   D
Sbjct: 809 DSITLLEN-GEITEQGTYFDVMATEGSSLSKLITEYGKKKD-SSESEAAKD 857

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 138/547 (25%), Positives = 257/547 (46%), Gaps = 53/547 (9%)

Query: 190  FVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLIS 249
            ++G+++  +        G+  +L  +G      L  + +KR +H  + + D   +G +++
Sbjct: 935  YMGLYSFFVFAAFIFMNGQYTILCAMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILN 994

Query: 250  RFGSDAYVVSRSMTQNV---SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF 306
            RF  D   +   +T+++   +  F  I+  GV +  + ++     ++  L    +L+   
Sbjct: 995  RFTKDTDSLDNELTESLRLMTSQFANIV--GVCVMCIVYLPWFAIAIPFLLIIFVLIADH 1052

Query: 307  IYG-----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLF 361
                    K++ A+ R    ++ N      E L G+ TIK++ ++++ + + +  I ++ 
Sbjct: 1053 YQSSGREIKRLEAVQRSFVYNNLN------EVLGGMDTIKAYRSQERFLAKSDFLINKMN 1106

Query: 362  YVGKREXXXXXXXXXXXXILGDM-----SFVIVLLYGANLVLQGALSIGDLTAFMLYTEY 416
              G               I  DM     + +I LL         A S+G +  ++L    
Sbjct: 1107 EAG----YLVVVLQRWVGIFLDMVAIVFALIITLLCVTRAFPISAASVGVMLTYVLQLPG 1162

Query: 417  TGSSVF-GLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALT-PTQGKIEFRDVSFS 474
              +++   L+   +++       S   EL    +  +  ++   + P++G+I F++V FS
Sbjct: 1163 LLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPPESWPSKGEIAFKNVDFS 1222

Query: 475  Y-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
            Y P  P   + K+++  I+ G  + I G +G GKSTI S L R  + + G ILID+ +IS
Sbjct: 1223 YRPGLPV--VLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILIDDVNIS 1280

Query: 534  KFTTKSLRRHLGVVQQEPTLMSGTIRDN----------------ITYGLSYTPTMDEIRV 577
            +     LRR L ++ Q+P L  GTIR N                +  G      + E+++
Sbjct: 1281 QIGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTEDELWDALVRGGAIAKNDLPEVKL 1340

Query: 578  VS-KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
               ++   HG + KF    D  +   G++ S G+RQ +A+ RAL+++ KILILDEATS++
Sbjct: 1341 QKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSV 1398

Query: 637  DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
            D E++G I   +  +    + TI+ IAHRL TI   + I+V+   G V E      L+  
Sbjct: 1399 DYETDGKIQVRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEFDTPWALFSQ 1455

Query: 697  EESELFK 703
            E+S +FK
Sbjct: 1456 EDS-IFK 1461

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 107/212 (50%), Gaps = 22/212 (10%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           FK + F I+ G  + I GP G GKS++ + +        G I + N D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDL----------- 651

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYT-PTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPR 602
             ++   P + + T++DNI +G  +     DE+  V   C     +   P G  T IG R
Sbjct: 652 --LMCGYPWIQNATVKDNIIFGSPFNKEKYDEVIHV---CSLKADLDILPAGDMTEIGER 706

Query: 603 GASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGTLMRSKELTIIS 661
           G +LSGGQ+ RI +AR++ K+  I + D+  SA+D    +  ++  L  L+ +K  T + 
Sbjct: 707 GITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVL 764

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKL 693
             H+LS I ++  +IV+G DG  V++G  D+L
Sbjct: 765 ATHQLSLIEKASRVIVLGTDGD-VDIGTVDEL 795

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 151/560 (26%), Positives = 249/560 (44%), Gaps = 87/560 (15%)

Query: 184  TLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNK 243
            T S + ++G+++  +  G      +  ++  IG     +L    ++R +H  + F D   
Sbjct: 913  TRSTSFYMGLYSFFVFGGYIFMTSQFTIVCFIGVNASKKLNLSAVRRILHTPMAFLDTTP 972

Query: 244  VGDLISRFGSDAYVVSRSMTQNVS---DGFKAIICGGVGMGMMFHISSTLTSVMLLFAPP 300
            +G +++RF  D   +   +T+NV      F  II  GV +  + ++     ++  +    
Sbjct: 973  LGRILNRFTKDTDSLDNELTENVRLMLAQFANII--GVCVMCIIYLPWFAIAIPFILLIF 1030

Query: 301  LLVGAFIYG-----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYND 355
            +LV           K++ AI R    ++ N      E L G+ TI+ + +E++ + + + 
Sbjct: 1031 VLVSNHYQSAGREIKRLEAIQRSFVYNNLN------EVLGGMDTIRFYNSEERFMAKSDY 1084

Query: 356  AIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTE 415
             I ++   G               +L DM  V   L  A L +     I           
Sbjct: 1085 LIDKMNEAG----YLVVCVQRWVAVLLDMIAVCFALIIALLCVTRQFHI----------- 1129

Query: 416  YTGSSVFGLSTFYSELMKGAGAASR-LFELMDHKNSVRSNISHALT-------------- 460
             + SSV  L T+  +L        R L +  +  NSV   +S+A                
Sbjct: 1130 -SASSVGVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVSYATELPTEAAYRKPESSP 1188

Query: 461  ----PTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLL 515
                P +GKI+F +VSF+Y P  P+  + K++S +I  G  + I G +G GKSTI S L 
Sbjct: 1189 DPSWPQEGKIDFEEVSFAYRPGLPA--VLKNLSMSINGGEKIGICGRTGAGKSTIMSALY 1246

Query: 516  RFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI-TYG--------- 565
            R  +   G I+ID  +IS      LRR L ++ Q+P L  GTIR N+  +G         
Sbjct: 1247 RLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGERSDDELWD 1306

Query: 566  -LSYTPTMD-----EIRVV-----SKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRI 614
             LS   ++D     E++       SK    H F        D  +   G++ S G+RQ +
Sbjct: 1307 ALSRGGSIDKESLEEVKTQKSTGNSKVQELHKF------HLDQEVEEEGSNFSLGERQLL 1360

Query: 615  AIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSEN 674
            A+ARAL++  K+LILDEATS++D E++  I   +  +    E TI+ IAHRL TI   + 
Sbjct: 1361 ALARALVRNSKVLILDEATSSVDYETDNKIQNRI--IEAFSECTILCIAHRLKTILNYDR 1418

Query: 675  IIVVGNDGSVVEVGKFDKLY 694
            I+V+       E+ +FD  Y
Sbjct: 1419 ILVLEKG----EIAEFDSPY 1434

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 107/217 (49%), Gaps = 20/217 (9%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           FK ++  I  G  + I GP G GK+++ + +    +   GS+ I+   +           
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGELL----------- 652

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
              +   P + + T+RDNI +G  +  +  +  +V K C     +   P G  T IG RG
Sbjct: 653 ---MGGYPWIQNATVRDNIIFGSPFDKS--KYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI-NYTLGTLMRSKELTIISI 662
            +LSGGQ+ RI +AR + K   I + D+  SA+D      I +  L  L+  K  T +  
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGK--TRVLA 765

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEES 699
            H+LS +  +  +IV+GNDGS V++G  ++L +  ++
Sbjct: 766 THQLSLVENASRVIVLGNDGS-VDIGTVEELKKRNQT 801

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 141/549 (25%), Positives = 250/549 (45%), Gaps = 57/549 (10%)

Query: 190  FVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLIS 249
            ++G+++  +        G+  +L  +G      L  + ++R +H  + + D   +G +++
Sbjct: 934  YMGLYSFFVFAAFIFMNGQFTILCAMGIMASKCLNLRAVRRILHTPMSYIDTTPLGRILN 993

Query: 250  RFGSDAYVVSRSMTQNV---SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAF 306
            RF  D   +   +T+++   +  F  I+  GV +  + ++     ++  L    +L+   
Sbjct: 994  RFTKDTDSLDNELTESLRLMTSQFANIV--GVCVMCIVYLPWFAIAIPFLLVVFVLIADH 1051

Query: 307  IYG-----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLF 361
                    K++ A+ R    ++ N      E L G+ TIK++ ++++ + + +  I ++ 
Sbjct: 1052 YQSSGREIKRLEAVQRSFVYNNLN------EVLGGMDTIKAYRSQERFLAKSDFLINKMN 1105

Query: 362  YVGKREXXXXXXXXXXXXILGDM-----SFVIVLLYGANLVLQGALSIGDLTAFMLYTEY 416
              G               I  DM     + +I LL         A S+G L  ++L    
Sbjct: 1106 EAG----YLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPG 1161

Query: 417  TGSSVFGLSTFYSELMKGA----GAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVS 472
              +++    T     M  A      A++L    D++    +       P++GKI F +V 
Sbjct: 1162 LLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPPESW--PSKGKIVFENVD 1219

Query: 473  FSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD 531
            F+Y  RP   I  K+ +  I+ G  + I G +G GKSTI S L R  +   G I ID+ D
Sbjct: 1220 FAY--RPGLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQIFIDDVD 1277

Query: 532  ISKFTTKSLRRHLGVVQQEPTLMSGTIRDN----------------ITYGLSYTPTMDEI 575
            IS+     LR+ L ++ Q+P L  GTIR N                +  G      + E+
Sbjct: 1278 ISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLDPFDERTDDELWDALVRGGAIAKNDLPEV 1337

Query: 576  RVVS-KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATS 634
            R+    +   HG + KF    D  +   G++ S G+RQ +A+ RAL+++ KILILDEATS
Sbjct: 1338 RLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATS 1395

Query: 635  ALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY 694
            ++D E++G I   +  +    + TI+ IAHRL TI   + I+V+   G V E      L+
Sbjct: 1396 SVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEYDTPWALF 1452

Query: 695  RNEESELFK 703
              E+S +FK
Sbjct: 1453 SQEDS-IFK 1460

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 106/211 (50%), Gaps = 20/211 (9%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           FK ++F I+ G  + I GP G GKS++ + +        G I + N D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEV-NGDL----------- 651

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYT-PTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPR 602
             ++   P + + T+RDNI +G  +     DE+  V   C     +   P G  T IG R
Sbjct: 652 --LMCGYPWIQNATVRDNIIFGSPFNKEKYDEVIHV---CSLKADLDILPAGDMTEIGER 706

Query: 603 GASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISI 662
           G +LSGGQ+ RI +AR++ KK  I + D+  SA+D      I     T M S +  I++ 
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRILA- 765

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKL 693
            H+LS I R+  +IV+G DG  V++G  ++L
Sbjct: 766 THQLSLIERASRVIVLGTDGK-VDIGTVEEL 795

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 149/570 (26%), Positives = 266/570 (46%), Gaps = 65/570 (11%)

Query: 181  IVGTLSITQFVGIFAGALVVGATANF---GRVVLLKIIGERLVSRLRSQVIKRTMHHDIE 237
            I+ T S   F+  +A   ++G  ++F   G+V +  + G     ++ S+++       + 
Sbjct: 1019 ILQTHSTLYFLLFYA---IIGLISSFLTAGKVWVAMLSGTNATKKIFSKLLSSIFEAKLR 1075

Query: 238  FFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLF 297
            F D   VG +++RF  D  ++ + +  N    F +++   V + ++  I   +T   L+F
Sbjct: 1076 FHDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVV---VCLWIVILIG-YVTPRFLIF 1131

Query: 298  APPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRY 353
            A PL    +  G      SR+L++    +   + ++  E + G+ TI++   E++ I   
Sbjct: 1132 AIPLCGLYYFVGALYLRASRELKRIDNINVSPIHQLFTEAIKGVVTIRALADERRFITHT 1191

Query: 354  NDAI----RQLFYVG-KREXXXXXXXXXXXXILGDMSFVIV-----LLYG-ANLVLQGAL 402
             +AI       FY+    E            +L   S +I+     L  G A ++L  A 
Sbjct: 1192 LEAIDGSNAPFFYLSVATEWITYRVDIIGALVLFSSSLMIIARAPYLDAGLAGILLSNAF 1251

Query: 403  SIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFEL-MDHKNSVRSNISHALTP 461
            S  + TA  +   ++G  +         LM          E+ ++   S  S  S    P
Sbjct: 1252 SFTE-TAQWIIKVFSGVEL---------LMSSVERIKEYIEVPLEFSKSNDSATSPVDWP 1301

Query: 462  TQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPN 521
              G+IEF+++S  Y    S++   ++SF +  G+ V IVG +G GKS+I + + R  D  
Sbjct: 1302 QTGEIEFKNLSLRYSPH-SSKALDNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWE 1360

Query: 522  YGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT--PTMDEIRVVS 579
             G+I+IDN DI   + + LR  +  + Q PTL  GTIR N+     Y+     D +  V 
Sbjct: 1361 SGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDKQVFDALAKVG 1420

Query: 580  ----KQCFCHGFIT-----------KFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624
                 +  C   +T           KF D  ++V+   G++LS GQRQ + +AR+++   
Sbjct: 1421 LIERNEVLC--LVTDRQQSSSFSPNKFSD-LNSVVRSGGSNLSQGQRQLLCLARSMLGSR 1477

Query: 625  KILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSV 684
            KI+++DEAT+++D  S+  I  T+   M +   TI++IAHRL ++    N I+V + G V
Sbjct: 1478 KIMLIDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSV-IDYNKILVMDMGRV 1534

Query: 685  VEVGKFDKLYR--NEESELFKLLNEKDHDL 712
             E   +D  Y   ++++ +F  L E+  D 
Sbjct: 1535 KE---YDHPYNLISDKNTIFHHLCEQSGDF 1561

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 93/331 (28%), Positives = 155/331 (46%), Gaps = 25/331 (7%)

Query: 429 SELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMS 488
           S L++   +  R+ + +D   + +  I   LT ++ K+ F+D +  +    ++   K++S
Sbjct: 630 SLLVQSFISLKRIEDYLDESETSKYEI---LTQSKSKVGFKDANMEWDADETSFKLKNIS 686

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI---DNHDISKFTTKSLRRHLG 545
              +  S   I+GP+G GKS++   LL   +   G I +   D+ D  +     +   + 
Sbjct: 687 IEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQIYVPSVDSRDDLEVGIDGMTNSMA 746

Query: 546 VVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGAS 605
              Q P L+SGTI DNI +G    P       V K C     +     G  T +G  G S
Sbjct: 747 YCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIKACCLEKDVKAMSAGLKTSVGGGGFS 804

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIISIA 663
           LSGGQ+QR+A+ARA+    + L+LD+  SA+D E+   I      G +M+ +  T I  +
Sbjct: 805 LSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPETALNIYEKCLCGPIMKGR--TCIITS 862

Query: 664 HRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIP 723
           H +S I +    +V+ ++G V   GK   L    ES  F L    ++ L  +S N +   
Sbjct: 863 HNISLITKKAEWLVILDNGEVKGQGKPSDL---AESNNF-LKESMNNGLADESGNQA--- 915

Query: 724 PDSPKNDDASGLEHL----VAEDVASINDKV 750
              PK+  A+ L       V E+++ + D V
Sbjct: 916 --KPKSKTAATLHDTDNADVQEEISQVEDAV 944

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  139 bits (349), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 143/522 (27%), Positives = 240/522 (45%), Gaps = 55/522 (10%)

Query: 223  LRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAI--ICGGVGM 280
            L    + R +H  + + D   +G +++RF  D   +   +T++V      +  I   + M
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKDTDSLDNELTESVRLMLFQVGNIVAVIVM 1006

Query: 281  GMMFHISSTLTSVMLLFAPPLLVGAFIYG----KKISAISRQLQQSSGNLTRVAEEQLNG 336
             +++     +    L F   L+   +       K++ AI R    ++ N      E L G
Sbjct: 1007 CIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLN------EVLGG 1060

Query: 337  IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
            + TIKS+  +K+   + +  I ++   G               I  DM  +I  L  A L
Sbjct: 1061 MDTIKSYKGQKRFQAKSDYLINKMNEAG----YLLVSVQRWVSIFLDMVAIIFALIIALL 1116

Query: 397  VLQG-----ALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGA----GAASRL-FELMD 446
             + G     A S+G L  ++L      +SV    T     M  A      A++L  E   
Sbjct: 1117 SVTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVNYATKLPLEAAY 1176

Query: 447  HKNSVRSNISHALTPTQGKIEFRDVSFSYPT-RPSNQIFKHMSFTIEPGSNVCIVGPSGK 505
             K  +    S    P++G+I F DV F+Y +  P   + K ++  I+ G  + I G +G 
Sbjct: 1177 KKPELSPPESW---PSKGEIRFLDVDFAYRSGLPV--VLKGLNLDIKSGEKIGICGRTGA 1231

Query: 506  GKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYG 565
            GKSTI S L R  +   G ILID+ DIS      LRR L ++ Q+P L  GTIR N+   
Sbjct: 1232 GKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPF 1291

Query: 566  LSYTPTM-------------DEIRVVSKQCF----CHGFITKFPDGYDTVIGPRGASLSG 608
             +Y  ++             + +  V  +       H  + KF    D ++   G++ S 
Sbjct: 1292 SNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSL 1349

Query: 609  GQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLST 668
            G+RQ +A+ RAL+++ KILILDEATS++D E++G I   +  +      TI+ IAHRL T
Sbjct: 1350 GERQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRI--VEEFDNCTILCIAHRLKT 1407

Query: 669  IRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDH 710
            I + + I+V+   G + E  +  KL+ +++S +F+ + E+ +
Sbjct: 1408 ILQYDRILVL-EKGVIAEFDQPFKLFSDKDS-IFRSMCERSN 1447

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 123/251 (49%), Gaps = 27/251 (10%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F ++ F I  G  + I GP G GKS++ +    F +   G I + N D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQV-NGDL----------- 635

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDE-IRVVSKQCFCHGFITKFPDGYDTVIGPR 602
             +    P + + T++DNI +G   +P + E    V + C     +   P G  T IG R
Sbjct: 636 --LFCGYPWIQNATVKDNILFG---SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGER 690

Query: 603 GASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGTLMRSKELTIIS 661
           G +LSGGQ+ RI +ARA+ K   I + D+  SA+D    +  ++  L  L+  K  T I 
Sbjct: 691 GINLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRIL 748

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSK-SENTS 720
             H+LS I +++ +IV+G DGS  ++G  D+L +  ++    L N  D+    + +EN  
Sbjct: 749 ATHQLSLIEKADRVIVLGTDGS-FDIGTVDELKQRNQT----LTNLLDYSTTERENENRD 803

Query: 721 DIPPDSPKNDD 731
           + P    +ND+
Sbjct: 804 ESPVADEENDE 814

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 153/570 (26%), Positives = 246/570 (43%), Gaps = 106/570 (18%)

Query: 208  RVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVS 267
            +  +L  IG      L  Q +KR +H  + F D   +G +++RF  D   +   + +NV 
Sbjct: 953  QFTILCYIGIGASKNLNIQALKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVR 1012

Query: 268  ---DGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG-----------KKIS 313
                 F  I+  GV +  + ++           A P LV  F++            K++ 
Sbjct: 1013 LTVSQFANIV--GVCVMCIVYLP------WFAIAVPFLVFIFVFIQNHYQSAGREIKRLE 1064

Query: 314  AISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXX 373
            AI R    ++ N      E L G+ TIK + +E++ I + +  I ++   G         
Sbjct: 1065 AIQRSFVYNNFN------EILGGMDTIKFYKSEERYIAKSDYLIDKMNEAG----YLTVC 1114

Query: 374  XXXXXXILGDM-----SFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFY 428
                  IL DM     + +I LL         A S+G L  ++L           L   +
Sbjct: 1115 VQRWVAILVDMIAVAFALIITLLCVTRQFHISASSVGVLLTYVL----------QLPGLF 1164

Query: 429  SELMKGAGAASRLFELMDHKNSVRSNISHAL------------------TPTQGKIEFRD 470
            + L++         ++ +  NS    +S+A                    P +G I+F +
Sbjct: 1165 NTLLRAVS------QVENDMNSTERLVSYATDLPLEAQYHKPETAPPESWPEEGTIKFEN 1218

Query: 471  VSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDN 529
            V F+Y  RP   I  K+++  I     + I G +G GKSTI + L R  +   GSILID+
Sbjct: 1219 VDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTALYRLNELTSGSILIDD 1276

Query: 530  HDISKFTTKSLRRHLGVVQQEPTLMSGTIRDN---------------ITYGLSYTPTMDE 574
             DI+K     LR+ L ++ Q+P L  G IR N               +  G +  P  D 
Sbjct: 1277 VDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDEELWDVLVRGGAIAPE-DL 1335

Query: 575  IRVVSKQCFCHGF---ITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDE 631
                ++     G    + KF    D V+   GA+ S G+RQ +A+ RAL++  KILILDE
Sbjct: 1336 AETKAQHITEDGTSADLHKF--HLDKVVEEDGANFSLGERQILALTRALVRNTKILILDE 1393

Query: 632  ATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
            ATS++D E++  I   + T       TI+ IAHRL TI   + I+V+ + G V E     
Sbjct: 1394 ATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYDRILVLEH-GEVAEFDTPM 1450

Query: 692  KLYRNEESELFKLLNEKDHDLVSKSENTSD 721
             L++ +E+ +F       H++  KS+ T D
Sbjct: 1451 NLFK-DETTIF-------HNMCKKSDITID 1472

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 119/225 (52%), Gaps = 22/225 (9%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F +++F I+ G  V I GP G GK+++ +    F +   G+I I N D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQI-NGDL----------- 659

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
             ++   P + + T+RDNI +G  Y    D+ + V + C     +   P G  T IG RG
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEE--DKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGTLMRSKELTIISI 662
            +LSGGQ+ RI +AR + K+  I +LD+  SA+D    +  ++  L  L+ +K  T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNK--TRLLA 773

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            H+LS I ++  IIV+GNDGS VE+G  D  Y  E ++  K+L E
Sbjct: 774 THQLSLIDKASRIIVLGNDGS-VEIG--DVQYMKETNKTLKVLLE 815

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  138 bits (348), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 134/489 (27%), Positives = 233/489 (47%), Gaps = 35/489 (7%)

Query: 236  IEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVML 295
            + FF+   +G +++RF +D + V   + +  +  F   I   V   ++    ST   +++
Sbjct: 1024 MSFFETTPIGRILNRFSNDIFKVDELLGRTFAQFFVNAI--KVSFTIIVICFSTWQFILV 1081

Query: 296  LFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEI 350
            +   P+      Y +     SR+L++   ++TR       +E L GI TI+ +  +K+ +
Sbjct: 1082 IL--PMGTLYIYYQQYYLRTSRELRRLD-SVTRSPIYAHFQETLGGISTIRGYNQQKRFV 1138

Query: 351  RRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFV--IVLLYGANLVL----QGALSI 404
               N A      V                +   + F+  +++L  ++L +    QGAL+ 
Sbjct: 1139 H-INQA-----RVDNNMSAYYPSVNANRWLAFRLEFIGSVIILAASSLSVLRLKQGALTP 1192

Query: 405  GDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALT 460
            G +   + Y      S+  +     E+     +  R+ E  + ++     + SN      
Sbjct: 1193 GMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANLESEAPAVIESNRPSEDW 1252

Query: 461  PTQGKIEFRDVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYD 519
            P+QG I+F + S  Y  RP  ++  K ++  I+P   + IVG +G GKS++T  L R  +
Sbjct: 1253 PSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1310

Query: 520  PNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVS 579
               G I ID   I     + LR HL ++ Q+  L  GTIR+NI     YT   ++I    
Sbjct: 1311 AASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENIDPTNEYTD--EQIWRAL 1368

Query: 580  KQCFCHGFITKF-PDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
            +       +     +  D  +   G++LS GQRQ + +ARAL+   KIL+LDEAT+A+DV
Sbjct: 1369 ELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1428

Query: 639  ESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE 698
            E++  I  T+ T  +++  TI++IAHR++TI  S+ I+V+ + G V E    D L +N E
Sbjct: 1429 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNPE 1485

Query: 699  SELFKLLNE 707
            S  + L  E
Sbjct: 1486 SLFYSLCYE 1494

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 103/437 (23%), Positives = 203/437 (46%), Gaps = 49/437 (11%)

Query: 308 YGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAE-----KKEIRRYNDAIRQLFY 362
           Y KK+  +  Q++   G  TR+  E LN I+++K +  E     K +  R    ++ L  
Sbjct: 458 YQKKLQKV--QMKYKDGR-TRLISEILNNIKSLKLYAWEEPYRKKLDYVRNEKELKNLRR 514

Query: 363 VGKREXXXXXXXXXXXXILGDMSF-VIVLLYGANL---VLQGALSIGDLTAFMLYTEYTG 418
           +G               ++   +F V +    A L   ++  AL++ +L AF L    T 
Sbjct: 515 MGITNACASFQFNVIPFLVSCSTFGVFIWTQDAPLTTDLVFPALTLFNLLAFPLAVIPTA 574

Query: 419 SSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQ-GKIEFR---DVSFS 474
            + F         ++ + + +RL   + ++   R ++      T+ G++      D +F 
Sbjct: 575 ITAF---------VEASVSITRLQSFLTNEELQRDSVQRKSKVTKKGEVAVNVGADATFL 625

Query: 475 YPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
           +  +P  ++  K+++F  + G   C+VG  G GKS +             +IL D   + 
Sbjct: 626 WQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQ-----------AILGDLFRVK 674

Query: 534 KFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPD 593
            F   S+   +  V Q P +M+GT++DNI +G  Y  +   + +  K C     +   P 
Sbjct: 675 GFA--SVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTMTL--KACALIVDLAVLPK 730

Query: 594 GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGT-- 650
           G  T++G +G SLSGGQ+ R+++ARA+  +    +LD+  +A+D   ++  + + LG   
Sbjct: 731 GDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHVLGPNG 790

Query: 651 LMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE--K 708
           L+ SK  T +   ++++ +  +++I ++ N G +++ G +D +   + S L K+++   K
Sbjct: 791 LLASK--TKVLATNKITVLSIADHIALLEN-GEIIQQGSYDDVTSAKSSALSKIISTFGK 847

Query: 709 DHDLVSKSENTSDIPPD 725
             +     ENT    P+
Sbjct: 848 KPEKSKTGENTVATTPE 864

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 144/538 (26%), Positives = 242/538 (44%), Gaps = 38/538 (7%)

Query: 189  QFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDRNKVGDL 247
            +++GI+    +  A +   + V+L +      SR L   +    +   + FF+   +G +
Sbjct: 975  KYLGIYFALGIGSALSTLVQTVVLWVFCTIHGSRYLHDAMASSVLRAPMSFFETTPIGRI 1034

Query: 248  ISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFI 307
            ++RF +D Y V   + +  S  F  +    V +     +  T T   +L   PL V    
Sbjct: 1035 LNRFSNDIYKVDELLGRTFSQFFVNV----VKVTFTIVVICTSTWQFILVVLPLSVLYIY 1090

Query: 308  YGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEIRRYN----DAIR 358
            Y +     SR+L++   ++TR       +E L G+ TI+ +  ++K     N    D   
Sbjct: 1091 YQQYYLRTSRELRRLD-SVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAHINQARIDNNM 1148

Query: 359  QLFYVG---KREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTE 415
              FY      R             ILG  +  +  L       QG L+ G +   + Y  
Sbjct: 1149 SAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLK------QGTLTAGMIGLSLSYAL 1202

Query: 416  YTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL----TPTQGKIEFRDV 471
                S+  +     E+     +  R+ E  + K    + I  +      P+QG I F   
Sbjct: 1203 QITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGWPSQGDIRFEHY 1262

Query: 472  SFSYPTRPSNQ-IFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
            S  Y  RP  Q I + ++  I+    V IVG +G GKS++T  L R  +   G I ID  
Sbjct: 1263 STRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIFIDGL 1320

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEI-RVVSKQCFCHGFIT 589
                     LR  L ++ Q+  + +GT+R+N+     +T   +EI   +         ++
Sbjct: 1321 STDTIGLADLRHKLSIIPQDSQVFAGTLRENVDPTEEFTD--EEIWHALELSHLKEHVMS 1378

Query: 590  KFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 649
               DG  T++   G++LS GQRQ + +ARAL+   KIL+LDEAT+A+DVE++  I  T+ 
Sbjct: 1379 MGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQETIR 1438

Query: 650  TLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            T  +++  TI++IAHR++TI  S+ IIV+ N+G V E    + L +  +S  + L  E
Sbjct: 1439 TAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSLCKE 1493

 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 111/450 (24%), Positives = 209/450 (46%), Gaps = 51/450 (11%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFI-------------YGKKISAISRQLQQSSGNLTRVA 330
           F I   L S+  L  P + VG  I             Y K +  I     ++    TRV 
Sbjct: 422 FQIILCLISLYSLLGPCMWVGVIIMVVMIPINSIIMKYQKNLQKIQ---MKNKDERTRVI 478

Query: 331 EEQLNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMS 385
            E LN I+++K +  E     K +  R    ++ L  +G               ++   +
Sbjct: 479 SEILNNIKSLKLYAWEVPYKKKLDYVRNEKELKNLTKMGCTLALASFQFNIVPFLVSCST 538

Query: 386 FVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM 445
           F + ++      L   L    LT F L +         +++F    ++ + + +RL   +
Sbjct: 539 FAVFVMTQKGRALTTDLVFPALTLFNLLSFPLAVVPNAITSF----IEASVSVNRLHSFL 594

Query: 446 DHKNSVRSNISHALTPT-QGKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIV 500
            ++   + ++S   + T +G I  +   D +F +  +P  ++  K+++F  + G   CIV
Sbjct: 595 TNEELQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIV 654

Query: 501 GPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRD 560
           G  G GKS +             SIL D   +  F T  +   +  V Q P +M+GT+++
Sbjct: 655 GRVGSGKSALIQ-----------SILGDLFRVKGFAT--IHGSVAYVSQIPWIMNGTVKE 701

Query: 561 NITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARAL 620
           NI +G  Y P+  E  V  K C  +  ++  P G  T++G +G SLSGGQ+ R+++ARA+
Sbjct: 702 NILFGHKYDPSFYEKTV--KACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAV 759

Query: 621 IKKPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIV 677
             +    +LD+  +A+D   ++  ++  LG   L+ SK  T +   ++++ +  +++I +
Sbjct: 760 YSRADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSK--TKVLATNKITVLSIADSIAL 817

Query: 678 VGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
           + N G +V+ G +D++ R++ S L KL++E
Sbjct: 818 LEN-GEIVQQGSYDEVVRDDGSALSKLIHE 846

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 134/542 (24%), Positives = 241/542 (44%), Gaps = 30/542 (5%)

Query: 187  ITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRL-RSQVIKRTMHHDIEFFDRNKVG 245
            I ++V ++A   V  +     R +++ +      S+L  +Q+    +   + FF+   VG
Sbjct: 1030 IWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVG 1089

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGA 305
             +++RF SD   +       +S  F++++   + + ++     T++    L    +L+G 
Sbjct: 1090 RIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVII-----TVSMPWFLLFNTILLGI 1144

Query: 306  FIYGKKISAI-SRQLQQ----SSGNLTRVAEEQLNGIRTIKSFV-AEKKEIRRYNDAIRQ 359
            + Y + +  + SR+L++    S   +  +  E L G   I ++  A       + +    
Sbjct: 1145 YYYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAYKHANIFNYYNFENIQTN 1204

Query: 360  LFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGS 419
            + ++                I   +  +  L+  A+L     +S G +   M Y     S
Sbjct: 1205 INFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALASLGTSNPISAGLIGLLMSYALQVSS 1264

Query: 420  SVFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALTPTQGKIEFRDVSFSY 475
            S+  +      +     +  R+ E  D K      +  +      P +G+I F   +  Y
Sbjct: 1265 SLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHYTTKY 1324

Query: 476  PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKF 535
                 + + K +   I+    + +VG +G GKST+T  L R  +P  G I ID  DIS  
Sbjct: 1325 -RENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTL 1383

Query: 536  TTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPT--MDEIRVVSKQCFCHGFITKFPD 593
                LRR L ++ Q+     GT+R N+     +T       + +   +      +++ PD
Sbjct: 1384 GLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIVSELPD 1443

Query: 594  G-------YDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINY 646
                     DT I   G +LS GQRQ + ++RAL+   KILILDEAT+A+D E++  I  
Sbjct: 1444 DENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQE 1503

Query: 647  TLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLN 706
            T+ T  + +  TI++IAHR+ T+  S+ I+V+ + G V E    D L +N+ES LF  L 
Sbjct: 1504 TIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKEFDTPDNLLKNKES-LFYGLC 1559

Query: 707  EK 708
            EK
Sbjct: 1560 EK 1561

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 106/448 (23%), Positives = 196/448 (43%), Gaps = 54/448 (12%)

Query: 318 QLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXX 377
           Q+Q     +  V E  LN +++IK +  EK  + R N     L     ++          
Sbjct: 460 QMQYKDKRIKTVTE-ILNSMKSIKLYAWEKPMLDRLNHVRNDLELHNMKKIAIVSNFMFF 518

Query: 378 XX----ILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMK 433
                 +L   S  ++  Y  + VL   +    LT F +  +    ++F + T  S +++
Sbjct: 519 CWNIVPLLVTCSTFVLFSYLTDQVLSPQIIFPSLTLFSMLND----ALFTVPTMISNIIE 574

Query: 434 GAGAASRLFELMDHKNSVRSNISHA-LTPTQGKIEFRDVSFSYPT--------------- 477
              +  RL   +  +    S I HA  T +   +E  +  F + +               
Sbjct: 575 IGVSLKRLKGYLLAEELDTSFIEHARATASDPTVEISNAVFLWKSPKSAASSEDTDEEAE 634

Query: 478 --RPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI-LIDNHDISK 534
              P   +    +F+ +     CIVG  G GKST    +L       G +  + +   S 
Sbjct: 635 ISSPGVALKSIENFSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASG 687

Query: 535 FTTKSLRR--HLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFP 592
              K + R  +L    Q+P +M+ +++DNI +G  Y   M +  +  K C     +   P
Sbjct: 688 VKPKVVIRADNLAYCPQQPWIMNASLKDNILFGYKYDEAMYKKTI--KACQLLPDLEILP 745

Query: 593 DGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGT- 650
           DG  T++G +G SLSGGQ+ R+++ARA+  +  + +LD+  SA+D    +  I+  L   
Sbjct: 746 DGDQTLVGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQ 805

Query: 651 --LMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY---RN--EESELFK 703
             L+++K  T+I   + ++ +  S+ I ++ N G +VE   ++++    RN  E+S L +
Sbjct: 806 KGLLKNK--TVILTTNAVNVLVHSDMIYLLKN-GKIVESNSYEEVMSKDRNNGEKSSLRE 862

Query: 704 LLNEKDHDLVSKSENTSDIPPDSPKNDD 731
           ++ E   +   +SE T++   +S   DD
Sbjct: 863 IIEEFASN---ESEETAEKKSESSTIDD 887

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 145/548 (26%), Positives = 251/548 (45%), Gaps = 42/548 (7%)

Query: 187 ITQFVGIFAGALVVGATA--NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
           +  FVG+++  L VG+ A  N   +++L     R   +L   + K  +   + FF+   V
Sbjct: 446 VWMFVGVYS-LLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 504

Query: 245 GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
           G +I+RF SD   V  S+    S  FK+I+   V + ++ +         L+F   LLV 
Sbjct: 505 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYN----MPWFLVFNMFLLVI 560

Query: 305 AFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIR-Q 359
              Y      +SR+L++    S   +  +  E LNG   I ++   ++ I    D I+  
Sbjct: 561 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSN 620

Query: 360 LFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGS 419
           +  V                I   +     LL  A +  +  LS G +   M Y+    S
Sbjct: 621 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 680

Query: 420 SVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTP-----TQGKIEFRDVSFS 474
           S+  +      +     +  R+ E  +     +S I+    P     ++G+IEF++ S  
Sbjct: 681 SLTWIVRTTVMIETNIVSVERIVEYCELPPEAQS-INPEKRPDENWPSEGRIEFKNYSTK 739

Query: 475 YPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISK 534
           Y     + + K ++ +I+P   + IVG +G GKST++  L R  +P+ G I+ID+ +IS+
Sbjct: 740 YRENL-DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISE 798

Query: 535 FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKF--- 591
                LR +L ++ Q+     GT+R N+     Y+   DE++   +       + K    
Sbjct: 799 LGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSE--DELKRAIELAHLKSHLEKMLGN 856

Query: 592 ---------------PDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
                           D  D  I   G++LS GQRQ + +ARAL+   KIL+LDEAT+++
Sbjct: 857 EAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASV 916

Query: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
           D+E++  I  T+    + +  TI++IAHR+ T+  S+ IIV+ + G+V E     KL  +
Sbjct: 917 DMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLSD 973

Query: 697 EESELFKL 704
           + S  + L
Sbjct: 974 KGSIFYSL 981

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 139/273 (50%), Gaps = 23/273 (8%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR--HLGV 546
           F  + G  +C+VG  G GKST    +L       G +   +        K + R   L  
Sbjct: 89  FEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLAY 141

Query: 547 VQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASL 606
             QE  +M+ ++R+NI +G  +     ++ +  K C     +   PDG +T++G +G SL
Sbjct: 142 CSQESWIMNASVRENILFGHKFDKAYYDLTI--KACQLLPDLKILPDGDETLVGEKGISL 199

Query: 607 SGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GTLMRSKELTIISIAH 664
           SGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  I + L G     K  TII   +
Sbjct: 200 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTN 259

Query: 665 RLSTIRRSENIIVVGNDGSVVEVGKFDKLYR--NEESELFKLLNEKDH--DLVSKSENTS 720
            +S ++ S+ I  + N G +VE G ++ + +  N+ S+L KLL E D   D +++S+  +
Sbjct: 260 TVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEEFDTPIDNMNESDRRT 318

Query: 721 DIPPDSPKNDDASGLEHLVAEDVASINDKVVKN 753
           D    SP+ D+   L+  V E  A   D+V  N
Sbjct: 319 D---QSPERDEEETLQLKVVESEAE--DEVATN 346

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 146/548 (26%), Positives = 251/548 (45%), Gaps = 42/548 (7%)

Query: 187  ITQFVGIFAGALVVGATA--NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            +  FVG+++  L VG+ A  N   +++L     R   +L   + K  +   + FF+   V
Sbjct: 1017 VWMFVGVYS-LLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
            G +I+RF SD   V  S+    S  FK+I+   V + ++ +         L+F   LLV 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYN----MPWFLVFNMFLLVI 1131

Query: 305  AFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIR-Q 359
               Y      +SR+L++    S   +  +  E LNG   I ++   ++ I    D I+  
Sbjct: 1132 YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSN 1191

Query: 360  LFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGS 419
            +  V                I   +     LL  A +  +  LS G +   M Y+    S
Sbjct: 1192 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 1251

Query: 420  SVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTP-----TQGKIEFRDVSFS 474
            S+  +      +     +  R+ E  +     +S I+    P     ++G+IEF++ S  
Sbjct: 1252 SLTWIVRTTVMIETNIVSVERIVEYCELPPEAQS-INPEKRPDENWPSEGRIEFKNYSTK 1310

Query: 475  YPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISK 534
            Y     + + K ++ +I+P   + IVG +G GKST++  L R  +P+ G I+ID+ +IS+
Sbjct: 1311 Y-RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISE 1369

Query: 535  FTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKF--- 591
                 LR +L ++ Q+     GT+R N+     Y+   DE++   +       + K    
Sbjct: 1370 LGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSE--DELKRAIELAHLKSHLEKMLGN 1427

Query: 592  ---------------PDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
                            D  D  I   G++LS GQRQ + +ARAL+   KIL+LDEAT+++
Sbjct: 1428 EAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASV 1487

Query: 637  DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
            D+E++  I  T+      K+ TI++IAHR+ T+  S+ IIV+ + G+V E     KL  +
Sbjct: 1488 DMETDKIIQDTIRR--EFKDRTILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLSD 1544

Query: 697  EESELFKL 704
            + S  + L
Sbjct: 1545 KGSIFYSL 1552

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 139/273 (50%), Gaps = 23/273 (8%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR--HLGV 546
           F  + G  +C+VG  G GKST    +L       G +   +        K + R   L  
Sbjct: 660 FEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLAY 712

Query: 547 VQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASL 606
             QE  +M+ ++R+NI +G  +     ++ +  K C     +   PDG +T++G +G SL
Sbjct: 713 CSQESWIMNASVRENILFGHKFDKAYYDLTI--KACQLLPDLKILPDGDETLVGEKGISL 770

Query: 607 SGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GTLMRSKELTIISIAH 664
           SGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  I + L G     K  TII   +
Sbjct: 771 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTN 830

Query: 665 RLSTIRRSENIIVVGNDGSVVEVGKFDKLYR--NEESELFKLLNEKDH--DLVSKSENTS 720
            +S ++ S+ I  + N G +VE G ++ + +  N+ S+L KLL E D   D +++S+  +
Sbjct: 831 TVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEEFDTPIDNMNESDRRT 889

Query: 721 DIPPDSPKNDDASGLEHLVAEDVASINDKVVKN 753
           D    SP+ D+   L+  V E  A   D+V  N
Sbjct: 890 D---QSPERDEEETLQLKVVESEAE--DEVATN 917

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 139/497 (27%), Positives = 227/497 (45%), Gaps = 51/497 (10%)

Query: 236  IEFFDRNKVGDLISRFGSDAY----VVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLT 291
            + FF+   +G +++RF +D Y    ++ R+ +Q + +  K +         M  I  T  
Sbjct: 1043 MSFFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFT-------MIVICWTTW 1095

Query: 292  SVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAE 346
              + +  P L V    Y +     SR+L++   ++TR       +E L G+ TI+ +   
Sbjct: 1096 QFIFIIGP-LGVLYIYYQQYYLRTSRELRRLD-SITRSPIYSHFQETLGGMSTIRGY--- 1150

Query: 347  KKEIRRYN-------DAIRQLFYV---GKREXXXXXXXXXXXXILGDMSFVIVLLYGANL 396
              + RR++       D     FY      R             ILG  +  I  L     
Sbjct: 1151 -NQQRRFDHINHCRIDNNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLG---- 1205

Query: 397  VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS----VR 452
              QG L+ G +   + Y      ++  +     E+     +  R+ E  + K+     + 
Sbjct: 1206 --QGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIE 1263

Query: 453  SNISHALTPTQGKIEFRDVSFSYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTIT 511
                 A  P  G I F   S  Y  RP  + + + ++  I+P   + IVG +G GKS++T
Sbjct: 1264 EKRPAAHWPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLT 1321

Query: 512  SLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPT 571
              L R  + + G I+ID   I +     LR +L ++ Q+  +  GTIR+N+    +YT  
Sbjct: 1322 LALFRIVEASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETYTD- 1380

Query: 572  MDEI-RVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILD 630
             DEI RV+          +  P G    +   G++LS GQRQ + +ARAL+   KILILD
Sbjct: 1381 -DEIWRVLELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILD 1439

Query: 631  EATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKF 690
            EAT+A+DVE++  I  T+ +  R +  TI++IAHR++TI  S+ I+V+ + G V E    
Sbjct: 1440 EATAAVDVETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEFDTP 1496

Query: 691  DKLYRNEESELFKLLNE 707
              L RNE S+   L  E
Sbjct: 1497 TNLLRNEGSQFHSLCQE 1513

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 106/447 (23%), Positives = 204/447 (45%), Gaps = 46/447 (10%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQSSGNL----TRVAEEQ 333
           F +   L S+  L  P + +G  I          ++ I ++LQ+S        T V  E 
Sbjct: 430 FQVVICLVSLYKLLGPSMWIGVVILLVMTPLNTFLAKIQKRLQKSQMGFKDERTSVISEI 489

Query: 334 LNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN I+++K +  E     K E  R +  ++ L  +G               ++   +F  
Sbjct: 490 LNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTFA- 548

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           V +Y  +  L   L    LT F L +      +F +    +  ++ + + +RLF  + ++
Sbjct: 549 VFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNE 604

Query: 449 NSVRSNISHALTPTQ-GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPS 503
              + ++      T  G +  +   D +F +  +P  ++  K+++F  + G   C+VG  
Sbjct: 605 ELQKDSVQRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRV 664

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKS +             S+  D   +  F T  +   +  V Q   +M+GT+++NI 
Sbjct: 665 GSGKSALIQ-----------SLSGDLFRVKGFAT--VHGSVAYVSQVAWIMNGTVKENIL 711

Query: 564 YGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
           +G  Y P   +  +  K C     +    DG +T++G +G SLSGGQ+ R+++ARA+  +
Sbjct: 712 FGHRYDPEFYDKTI--KACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYAR 769

Query: 624 PKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVGN 680
               +LD+  +A+D    +  + + LG   L+R+K  T I   +++S +  ++ I ++ N
Sbjct: 770 ADTYLLDDPLAAVDEHVGKHLLEHVLGPTGLLRTK--TKILATNKISVLSIADRIALLEN 827

Query: 681 DGSVVEVGKFDKLYRNEESELFKLLNE 707
            G +VE G +D++  + +S L KL+ +
Sbjct: 828 -GEIVEQGSYDEVTADGDSALSKLIRD 853

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 134/489 (27%), Positives = 228/489 (46%), Gaps = 35/489 (7%)

Query: 236  IEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVML 295
            + FF+   +G +++RF +D Y V   + +  S  F   +   V   ++   SST   V +
Sbjct: 1018 MTFFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAV--KVSFTIIVICSSTWQFVFV 1075

Query: 296  LFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEI 350
            +   PL      Y +     SR+L++   ++TR       +E L GI TI+ +  ++   
Sbjct: 1076 II--PLGTLYIYYQQYYLRTSRELRRLD-SVTRSPIYAHFQETLGGISTIRGY-QQQGRF 1131

Query: 351  RRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFV--IVLLYGANLVL----QGALSI 404
               N A      V                +   + F+  I++L  A L +    QGAL+ 
Sbjct: 1132 LHINQA-----RVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTP 1186

Query: 405  GDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM----DHKNSVRSNISHALT 460
            G +   + Y      S+  +     E+     +  R+ E      +    + SN      
Sbjct: 1187 GMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPAEDW 1246

Query: 461  PTQGKIEFRDVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYD 519
            PT G I+F + S  Y  RP   +  ++++  I+P   + IVG +G GKS++T  L R  +
Sbjct: 1247 PTHGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1304

Query: 520  PNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVS 579
               G I+ID         + LR HL ++ Q+  +  GT+R+NI     YT   +EI    
Sbjct: 1305 AAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEYTD--EEIWHAL 1362

Query: 580  KQCFCHGFITKF-PDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
            +       I     D  ++++   G +LS GQRQ + +ARAL+   +IL+LDEAT+A+DV
Sbjct: 1363 ELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDV 1422

Query: 639  ESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE 698
            E++  I  T+ T  +++  TI++IAHR++TI  S+ I+V+ + G + E    + L +N E
Sbjct: 1423 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKNRE 1479

Query: 699  SELFKLLNE 707
            S  + L  E
Sbjct: 1480 SLFYSLCQE 1488

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 107/469 (22%), Positives = 209/469 (44%), Gaps = 64/469 (13%)

Query: 308 YGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAE-----KKEIRRYNDAIRQLFY 362
           Y KK+  I     ++    TR   E LN I+++K +  E     K +  R    ++ L  
Sbjct: 452 YQKKLQKIQ---MKNKDERTRTISEILNNIKSLKLYAWEVPFREKLDKVRNEKELQNLKR 508

Query: 363 VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVF 422
           +G               ++   +F + +    +  L   L    LT F L +        
Sbjct: 509 MGITTAIASFQFNIVPFLVSCSTFAVFVWTQKDRPLSTDLVFPALTLFNLLSFPLAIIPT 568

Query: 423 GLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQ-GKIEFR---DVSFSYPTR 478
            L++F    ++ + + +RL   + ++   R ++      T+ G++      D +F +  +
Sbjct: 569 ALTSF----IEASVSVNRLHSFLTNEELQRDSVQRKPKVTKTGEVAINVGADATFLWQRK 624

Query: 479 PSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTT 537
           P  ++  K+++F  + G   CIVG  G GKS +              IL D   +  F  
Sbjct: 625 PEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQ-----------GILGDLFRVKGFA- 672

Query: 538 KSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDT 597
            S+   +  V Q P +M+GT+++NI +G  Y    D      + C     ++  P G +T
Sbjct: 673 -SVHGSIAYVSQVPWIMNGTVKENILFGHKYDA--DFYDTTLRACALAVDLSILPKGDET 729

Query: 598 VIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGT--LMRS 654
           ++G +G SLSGGQ+ RI++ARA+  +    +LD+  +A+D   ++  I + LG+  L+ S
Sbjct: 730 LVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSS 789

Query: 655 K-------ELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
           K       +++++SIA  +S +           +G +++ G ++++  ++ S L K++  
Sbjct: 790 KVKVLATNKISVLSIADHISLLE----------NGEIIQQGSYEEVTSDKSSALSKIIAN 839

Query: 708 KDHDLVSKSENTSDIPPDSPKNDDASGLEHLVAE---DVASINDKVVKN 753
                  +++   D  P+S   D        VAE   D+  ++DK+V++
Sbjct: 840 YGK---KQTKGKGDESPESSTPDSE------VAEASIDLQKLDDKLVQD 879

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  135 bits (340), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 141/540 (26%), Positives = 245/540 (45%), Gaps = 42/540 (7%)

Query: 189  QFVGIFAGALVVGATANFGRVVLLKII----GERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            +++ I+    V  A +   + V+L I     G   +  L +  + R     + FF+   +
Sbjct: 1012 RYLAIYFALGVGSAFSTLIQTVILWIFCTIHGSTYLHNLMTNAVFRA---PMSFFETTPI 1068

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
            G +++RF +D Y V   + +  S  F   +     +G++ + +     V++    PL + 
Sbjct: 1069 GRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIGVIAYTTWQFVFVIV----PLGIF 1124

Query: 305  AFIYGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKK-----EIRRYN 354
               Y +     SR+L++   ++TR       +E L G+ TI+ +  +K+     E R  N
Sbjct: 1125 YIYYQQYYLRTSRELRRLE-SVTRSPIFSHFQETLGGLATIRGYGQQKRFEHINECRVDN 1183

Query: 355  DAIRQLFYV---GKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFM 411
            +     FY      R             ILG  +  I  L        G ++ G +   +
Sbjct: 1184 NM--SAFYPSINANRWLAYRLEFIGSVIILGAATLSIFKLRA------GTMTAGMIGLSL 1235

Query: 412  LYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALTPTQGKIE 467
             Y      ++  +     E+     +  R+ E  + K+     + SN      P  G+I+
Sbjct: 1236 SYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIESNRPPKEWPVAGEIK 1295

Query: 468  FRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI 527
            F      Y     + + K ++  I+P   + IVG +G GKS++T  L R  +   G ILI
Sbjct: 1296 FEHYYTRY-REDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGGILI 1354

Query: 528  DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGF 587
            D   I++     LR HL ++ Q+  +  GTIR+NI     +T   D  R +         
Sbjct: 1355 DGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENIDPTNQFTDA-DIWRALELSHLKEHI 1413

Query: 588  ITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYT 647
            +    DG  T++   G++LS GQRQ + +ARAL+   K+L+LDEAT+A+DVE++  I  T
Sbjct: 1414 MQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDKVIQET 1473

Query: 648  LGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            + T  + +  TI++IAHR++TI  ++ IIV+ + G VVE    + L +N  S  + L  E
Sbjct: 1474 IRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVEFDTPEALLKNTNSIFYSLSKE 1530

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 110/447 (24%), Positives = 195/447 (43%), Gaps = 46/447 (10%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIYGKKISA------ISRQLQQSSGNL----TRVAEEQ 333
             I   L S+  L    + VG  I    I        I + LQ+S        TRV  E 
Sbjct: 450 LQIVLCLISLYKLLGHSMWVGVLILTIMIPVNSFLMKIQKNLQKSQMKFKDERTRVISEI 509

Query: 334 LNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN ++++K +  E     K E  R    ++ L  +G               ++   +F  
Sbjct: 510 LNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLVSCSTFA- 568

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           V +Y  +  L   L    LT F L +      +  +    + +++ + + SRLF  + ++
Sbjct: 569 VFVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNE 624

Query: 449 NSVRSNISHALTPTQ-GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPS 503
              +  +       + G +      + +F +  +P  ++  K++++  + G   CIVG  
Sbjct: 625 ELQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIVGKV 684

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKS               S+L D   +  F T  +   +  V Q   +M+GT+RDN+ 
Sbjct: 685 GSGKSAFLQ-----------SLLGDLFRVKGFAT--IHGSVAYVSQVAWIMNGTVRDNVL 731

Query: 564 YGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
           +G  Y P   E  +  K C     +    DG  T++G +G SLSGGQ+ R+++ARA+  +
Sbjct: 732 FGHKYDPEFYEKTI--KACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYAR 789

Query: 624 PKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVGN 680
               +LD+  +A+D   S   + + LG   L+ SK  T I   +++S +  +++I ++ N
Sbjct: 790 ADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSK--TRILATNKISVLSAADSITLLEN 847

Query: 681 DGSVVEVGKFDKLYRNEESELFKLLNE 707
            G + + G +    ++EES L KLL E
Sbjct: 848 -GEITQQGTYADCRKDEESALGKLLKE 873

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 141/539 (26%), Positives = 248/539 (46%), Gaps = 73/539 (13%)

Query: 208  RVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVS 267
            +  LL  +G R    L  + ++R +H  + + D   +G +++RF  D   +   +T+++ 
Sbjct: 918  QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTESIR 977

Query: 268  DGFKAI--ICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG----KKISAISRQLQQ 321
                 +  + G + M +++     +    LL    L+   +       K++ A+ R    
Sbjct: 978  LMLSQVGNLIGVIVMCIVYLPWFAIAVPFLLIIFVLICDHYQSTGREIKRLEAVQRSFVY 1037

Query: 322  SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXIL 381
            ++ N      E L G+ TIK++ ++++ + + +  I ++   G               IL
Sbjct: 1038 NNFN------EVLGGMDTIKAYGSQERFLAKTDYLINKMNEAG----YLIVAVQRWVAIL 1087

Query: 382  GD-----MSFVIVLLYGANLVLQGALSIGDLTAFMLY--------------TEYTGSSVF 422
             D      + +I LL         A S+G L  ++L               TE   +S  
Sbjct: 1088 LDSVAVVFALIITLLCVTRAFPISAGSVGVLLTYVLQLPGLLNTILRALTQTENDMNSAE 1147

Query: 423  GLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSY-PTRPSN 481
             L T+ +EL     AA R  E+   ++           P +G I+F DV+F+Y P  P  
Sbjct: 1148 RLVTYATEL--PLEAAYRKPEVSPPES----------WPEKGDIDFIDVNFAYRPGLPV- 1194

Query: 482  QIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLR 541
             + K+M+  I  G  + I G +G GKSTI S L R  + + G I+ID  DI K     LR
Sbjct: 1195 -VLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLR 1253

Query: 542  RHLGVVQQEPTLMSGTIRDN----------------ITYGLSYTPTMDEIRVVS-KQCFC 584
            + L ++ Q+P L  GTIR N                I  G+     +++I++    +   
Sbjct: 1254 KKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENLNDIKLEKPDENNS 1313

Query: 585  HGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 644
            +  + KF    D ++   G++ S G+RQ +A+ RAL++  KILILDEATS++D E++G I
Sbjct: 1314 YSNMHKF--HLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKI 1371

Query: 645  NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFK 703
               +  +    + TI+ IAHRL TI   + I+V+   G + E  K  +L+ N+++ +F+
Sbjct: 1372 QSRI--VSEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWELF-NDKNSIFR 1426

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 103/214 (48%), Gaps = 26/214 (12%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F  ++  I  G  + + GP G GK+++ + +  F     G + ++   +           
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGELL----------- 629

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV--VSKQCFCHGFITKFPDGYDTVIGP 601
              +   P +++ T+RDNI +G  Y    +E R   + + C     +   P G  T IG 
Sbjct: 630 ---LCGYPWILNATVRDNILFGSPY----EEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 602 RGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTI 659
           RG +LSGGQ+ RI +ARA+ K   I + D+  SA+D      I  +  LG L   K  T 
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGIL---KGKTR 739

Query: 660 ISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKL 693
           I   H+LS I R++ IIVVG +GS  + G  D+L
Sbjct: 740 ILATHQLSVIERADRIIVVGPNGS-FDFGTLDEL 772

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  133 bits (335), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 142/558 (25%), Positives = 240/558 (43%), Gaps = 56/558 (10%)

Query: 183  GTLSITQFVGIFAG-ALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDR 241
            G  ++  +VGI+   +L     +N   +VLL +   +   +L   +    +   + FF+ 
Sbjct: 1000 GNSNVLFYVGIYVFISLSAALLSNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFET 1059

Query: 242  NKVGDLISRFGSD--------AYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSV 293
              VG +I+RF SD         YV+S  +  ++ D    +I  G  + +   +++ L   
Sbjct: 1060 TPVGRIINRFSSDMNSLDDSVQYVMSFFLV-SILDYLVVVIIIGYQVPLFLIVNAVL--- 1115

Query: 294  MLLFAPPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKK- 348
                    LV  F Y      +SR+L++    S   +  +  E L G   I +F    + 
Sbjct: 1116 --------LVIYFYYQVYYVTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAFRHSDRF 1167

Query: 349  -----EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALS 403
                 E  ++N      F    R             IL      +    G +     ALS
Sbjct: 1168 DYLNVENVQFNINCLFNFRSTNRWLSIRLESIGALMILTTALLSLATKNGGH-----ALS 1222

Query: 404  IGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL---- 459
             G +   M Y     + +  +     +L     +  R+ E  D        I  +     
Sbjct: 1223 TGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKN 1282

Query: 460  TPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYD 519
             P+QG I F++ S  Y     + + +H+   I+P   + IVG +G GKST++  L R  +
Sbjct: 1283 WPSQGLIRFKNYSTRYRAN-LDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILE 1341

Query: 520  PNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVS 579
            P+ G+I ID  DISK   K LR +L ++ Q+     GT+R N+     Y+   +EI    
Sbjct: 1342 PSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQYSD--EEIWKAL 1399

Query: 580  KQCFCHGFITKFP----------DGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629
            +       I K            D   T I   G++LS GQRQ + ++RAL+ + +IL+L
Sbjct: 1400 ELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVL 1459

Query: 630  DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
            DEAT+A+D E++  I  T+      K+ TI++IAHR+ T+  S+ I+V+ + G V E   
Sbjct: 1460 DEATAAVDSETDRLIQETIRA--EFKDRTILTIAHRIDTVMDSDKIMVL-DKGEVKEFDS 1516

Query: 690  FDKLYRNEESELFKLLNE 707
               L   ++S  + L ++
Sbjct: 1517 PSNLLAQKDSIFYNLCDQ 1534

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 124/244 (50%), Gaps = 37/244 (15%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI-LIDNHDISKFTTKSLRRH-LGV 546
           F +  G  VC+VG  G GKST    LL       G +  I N       T   R + + +
Sbjct: 649 FQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRANSVAL 701

Query: 547 VQQEPTLMSGTIRDNITYG-----LSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGP 601
             Q+  +M+ +++DN+ +G      +Y  T++  ++V         +    DG +T++G 
Sbjct: 702 CSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPD-------LEILADGDETLVGE 754

Query: 602 RGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES-----EGAINYTLGTLMRSKE 656
           +G SLSGGQ+ R+++ARA+  +  + +LD+  SA+D E      E  ++   G L   K 
Sbjct: 755 KGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGLL---KN 811

Query: 657 LTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKF-DKLYRNEESELFKLLNEKDHDLVSK 715
            T+I   + +S ++ S++I  +  DG +VE G F D + R++ S+L +L+ E       +
Sbjct: 812 KTVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVE------CE 864

Query: 716 SENT 719
           SENT
Sbjct: 865 SENT 868

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  132 bits (333), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 145/560 (25%), Positives = 247/560 (44%), Gaps = 58/560 (10%)

Query: 189  QFVGIFAG-ALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDL 247
            +FV I+A   L+  A  N   V++L     R   +L   +    M   + FF+   +G +
Sbjct: 1022 KFVTIYAIIGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPIGRI 1081

Query: 248  ISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFI 307
            ++RF SD   +   +    S  F++++   V + +   +   L   + L A  +++  F 
Sbjct: 1082 VNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLIL---VGYNLPWFIALNAVLIMI-YFY 1137

Query: 308  YGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKK------EIRRYN-DA 356
            Y      +SR+L++    S   +  +  E L G   I +F    +      E  +YN D 
Sbjct: 1138 YQAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAFDHTSRFNFFNFETVQYNIDC 1197

Query: 357  IRQLFYVGKREXXXXXXXXXXXXIL--GDMSFVIVLLYGANLVLQGALSIGDLTAFMLYT 414
            + Q F    R             IL  G +SF       A L  +  LS G +   M Y+
Sbjct: 1198 VFQ-FRSTNRWLSVRLQTIGNLIILATGLLSF-------ATLGTKKQLSSGMVGLLMSYS 1249

Query: 415  EYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPT----QGKIEFRD 470
                SS+  +     ++     +  R  E  + K      I ++  P     +G IEF +
Sbjct: 1250 LQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNN 1309

Query: 471  VSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
             +  Y     + + K ++ +I+P   + IVG +G GKST+T  L R  +   GSI ID  
Sbjct: 1310 YTTKY-RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGI 1368

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDN-----------------ITYGLSYTPTMD 573
            DISK   + LR +L ++ Q+     GTIR N                 +++   +   M+
Sbjct: 1369 DISKIGLEDLRSNLAIIPQDAQAFEGTIRSNLDPFDQHSDEELWRAVELSHLKQHILRMN 1428

Query: 574  EIRVVSKQCFCHGFITKFPDGYD------TVIGPRGASLSGGQRQRIAIARALIKKPKIL 627
            E     +       IT  PD ++      T I   G+++S GQRQ + ++RAL+   K+L
Sbjct: 1429 EEANDRESDSSRTDITT-PDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVL 1487

Query: 628  ILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEV 687
            ILDEAT+A+D+E++  +  T+      KE TI++IAHR+ T+   + I+V+ + G V E 
Sbjct: 1488 ILDEATAAIDMETDKIVQDTIKN--EFKERTILTIAHRIDTVMNYDKILVL-DKGEVAEF 1544

Query: 688  GKFDKLYRNEESELFKLLNE 707
                 L  ++ +  +KL  +
Sbjct: 1545 DTVSNLLSDKNTMFYKLCEQ 1564

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 119/230 (51%), Gaps = 23/230 (10%)

Query: 488 SFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI----LIDNHDISKFTTKSLRRH 543
           +FT++ GS  CIVG  G GKSTI   +L       G +     +D     K T ++    
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRA--TS 700

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
           +    QE  +M+ ++++NI +G  +    +   +V + C     ++  PDG +T++G +G
Sbjct: 701 IAYCPQEAWIMNSSVKENIVFGHKHDE--NYYNLVIQACQLASDLSILPDGDETIVGEKG 758

Query: 604 ASLSGG-QRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGT---LMRSKELT 658
            SL GG Q+ RI++ARA+  +  + +LD+  SA+D   S+  I Y L     L+R+K  T
Sbjct: 759 ISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--T 816

Query: 659 IISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEK 708
           II   + ++ ++ S+ I  +   G +VE   ++ +  + ++   K L E+
Sbjct: 817 IILSTNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEE 865

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 146/564 (25%), Positives = 247/564 (43%), Gaps = 77/564 (13%)

Query: 192  GIFAGALVVGATANFG----RVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDL 247
            G + G  +     N+     +  +L  IG      L  + +KR +H  + F D   +G +
Sbjct: 893  GFYIGLYIFFVFVNYFFMSLQFTILCYIGLAASKWLNLKAVKRLLHTPMSFMDTTPLGRV 952

Query: 248  ISRFGSDAYVVSRSMTQNVSDGF--KAIICGGVGMGMM----FHISSTLTSVMLLFAPPL 301
            ++RF  D   +   +T++V       A I G + M ++    F I+     ++ +     
Sbjct: 953  LNRFTKDTDTLDNELTESVRLFVYQTANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVADH 1012

Query: 302  LVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLF 361
               +    K++ A+ R    ++ N      E L+G+ TIK++ +E + + + +  I ++ 
Sbjct: 1013 YQSSGREIKRLEAVQRSFVYNNFN------EVLSGMDTIKAYKSENRFLMKSDFLINRMS 1066

Query: 362  YVGKREXXXXXXXXXXXXILG-DMSFVIVLLYGANLVLQGALSIGDLTAFML-------- 412
              G               ++    + +I LL         A S+G L  ++L        
Sbjct: 1067 EAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTYVLQLPGLLNG 1126

Query: 413  ------YTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKI 466
                    E   +SV  +  + +EL +   AA R  E+   +            P+ G++
Sbjct: 1127 LLRAMTQAENDMNSVERIVNYATELPQ--EAAYRKPEMTPQEP----------WPSNGEV 1174

Query: 467  EFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
             F +VS SY P  P   + K +S  I+ G  + I G +G GKSTI S L R  + N G +
Sbjct: 1175 VFDNVSLSYRPGLP--LVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNEGRV 1232

Query: 526  LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI-TYG------------LSYTPTM 572
            LID  D SK     LRR L ++ Q+P L  G+IR N+  +G             S T   
Sbjct: 1233 LIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALVRSGTIEA 1292

Query: 573  DEIRVVSKQ--------CFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624
            +E+  V  Q           H F        D  +   G + S G+RQ +A+ RAL+++ 
Sbjct: 1293 EEVEKVKNQHRDESGSSTGLHKF------HLDQEVEDDGTNFSLGERQLLALTRALVRQS 1346

Query: 625  KILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSV 684
            KILILDEATS++D E++  I   +         TI+ IAHRL TI   + ++V+ N G+V
Sbjct: 1347 KILILDEATSSVDHETDAKIQSLIA--QEFNRCTILCIAHRLKTILNYDRLVVLDN-GTV 1403

Query: 685  VEVGKFDKLYRNEESELFKLLNEK 708
             E      L+R +++ +F+ + +K
Sbjct: 1404 KEFDTPRSLFRIKDT-IFREMCDK 1426

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 133/281 (47%), Gaps = 28/281 (9%)

Query: 472 SFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD 531
           +F+   + S   FK+++F I+ G  V I G  G GKS++ + L  F     G I      
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDI------ 612

Query: 532 ISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV--VSKQCFCHGFIT 589
              F   SL     ++   P + + T+RDNI +G S+    D++R   V + C     + 
Sbjct: 613 ---FKNGSL-----LLCGYPWIQNTTVRDNILFGSSF----DDVRYKEVIRVCALQADLD 660

Query: 590 KFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL 648
             P G  T IG RG +LSGGQ+ RI +AR++ K   I + D+  SA+D    +  ++  L
Sbjct: 661 ILPAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECL 720

Query: 649 GTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEK 708
             ++  K  T I   H+LS I R+  +I +G  GS  ++G  ++L +   S   KL+   
Sbjct: 721 MGMLDGK--TRILATHQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLM--- 773

Query: 709 DHDLVSKSENTSDIPPDSPKNDDASGLEHLVAEDVASINDK 749
           +    +KS N  +   D  + +     +  +A+    I+ K
Sbjct: 774 EFSTQTKSANQREEVDDHAEENLGQNCQQEIAKLEKQISKK 814

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 136/529 (25%), Positives = 225/529 (42%), Gaps = 48/529 (9%)

Query: 190  FVGIFAGALVVGATANFGR-VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLI 248
            FVGI+    +  A  N  R +VLL +   R   +L   +    +   + FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 249  SRFGSD--------AYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPP 300
            +RF SD         YV+S  +  ++ D    ++  G  + +   +++ L  + L +   
Sbjct: 1076 NRFSSDMNSVDDNVQYVISFFLI-SILDYVVVVVIIGYQVPLFLLVNAALLGIYLYYQ-- 1132

Query: 301  LLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYN----DA 356
                   Y      + R +  S   +  +  E L G   I +F        R++    +A
Sbjct: 1133 -----VFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAF----NHFSRFDYLNIEA 1183

Query: 357  IR-QLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTE 415
            ++  +  V                I   M     LL  A      ALS G +   M Y  
Sbjct: 1184 VQFNINCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTGDKALSTGMVGLLMSYAL 1243

Query: 416  YTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL----TPTQGKIEFRDV 471
               + +  +     +L     +  R+ E  D        I         P QG + F+D 
Sbjct: 1244 QVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKDY 1303

Query: 472  SFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD 531
            S  Y     + + K ++  I P   + IVG +G GKST++  L R  +P  G+I+ID  D
Sbjct: 1304 SARY-RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGVD 1362

Query: 532  ISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKF 591
            I+K     LR HL ++ Q+     G++R N+     Y+   DEI    +       I K 
Sbjct: 1363 ITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQYSD--DEIWRALELSHLKPHILKM 1420

Query: 592  PDG---------YDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 642
             +           +T I   G++LS GQRQ + ++RAL+ + +IL+LDEAT+A+D E++ 
Sbjct: 1421 ANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDR 1480

Query: 643  AINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
             I  T+      K+ TI++IAHR+ T+  S+ I+V+       EV +FD
Sbjct: 1481 LIQETIRA--EFKDRTILTIAHRIDTVMDSDKIMVLDQG----EVKEFD 1523

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 125/249 (50%), Gaps = 20/249 (8%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI--LIDNHDISKFTTKSLRRHLGV 546
           F    G  VC+VG  G GKST    LL       G +  +  +HD +          + +
Sbjct: 658 FQALKGQLVCVVGRVGAGKSTFLHALL-------GQLPCISSSHDQATPKMHFRCDSVAL 710

Query: 547 VQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASL 606
             Q+  +++ +++ N+ +G  Y       +   + C     +    DG +T++G +G SL
Sbjct: 711 CSQQAWILNASVKYNVLFGHKYDEA--SYKATIEACQLLPDLGILADGDETLVGEKGISL 768

Query: 607 SGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGT---LMRSKELTIISI 662
           SGGQ+ RI++ARA+  +  + +LD+  SA+D E  +  I++ L     L+++K  T+I  
Sbjct: 769 SGGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILT 826

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY-RNEESELFKLLNEKDHDLVSKSENTSD 721
            + +S ++ S++I  + N G +VE G FD++  ++ ES+L  L+ E   D  S  ++   
Sbjct: 827 TNSISVLKHSQSIYALEN-GEIVERGSFDEIMSKDAESKLKTLIAEFGSD-SSAVKDDEP 884

Query: 722 IPPDSPKND 730
           IP   P  D
Sbjct: 885 IPEQKPPVD 893

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 141/556 (25%), Positives = 245/556 (44%), Gaps = 72/556 (12%)

Query: 186  SITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            S + ++G+++  +  G     G+  L+  +G      L  + ++R +H  + + D   +G
Sbjct: 921  STSFYMGLYSFFVFGGYLFMNGQYTLICYMGVTASKVLNLKAVERVLHTPMAYMDTTPIG 980

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGA 305
             +++RF  D   +   +T+++   F       +G+ +M  I     ++    A P LV  
Sbjct: 981  RILNRFTKDTDSLDNELTESLR-LFMTQFANIIGVCVMCIIYLPWFAI----AIPFLVLI 1035

Query: 306  FIY-----------GKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYN 354
            F+             K++ AI R    ++ N      E L G+ TIK++ ++++ + + +
Sbjct: 1036 FVLIADHYQASGREVKRLDAIQRSFVYNNLN------EVLGGMDTIKAYGSQERFLVKTD 1089

Query: 355  DAIRQLFYVGKREXXXXXXXXXXXXILGDM-----SFVIVLLYGANLVLQGALSIGDLTA 409
              I ++   G               I  DM     + +I LL           S+G L  
Sbjct: 1090 FLINKMNEAG----YLLVALQRWVAIFLDMIAVAFALIISLLCVTRQFHISPASVGVLLT 1145

Query: 410  FMLYTEYTGSSVFGLSTFYSELMKGAGAASRLF----ELMDHKNSVRSNISHALT-PTQG 464
            ++L      +++    T   +      +A RL     EL    +  R  ++   + P++G
Sbjct: 1146 YVLQLPGLLNTILRALT---QTENDMNSAERLVYCANELPLEADYKRPELAPPESWPSKG 1202

Query: 465  KIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYG 523
            +I F DVSF+Y P  P   + K +S  I+    + I G +G GKSTI S L R  + + G
Sbjct: 1203 EIVFEDVSFAYRPGLPV--VLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNELSDG 1260

Query: 524  SILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTM----------- 572
             I ID+ DI +     LR+ L ++ Q+P L  GTIR N+     +   +           
Sbjct: 1261 KIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDPFQEHPDELLWKSLVSGGAI 1320

Query: 573  --DEIRVVSKQ--------CFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIK 622
              +E+ VV  Q           H F        D  +   GA+ S G+RQ +A+ RAL++
Sbjct: 1321 SAEEVEVVKGQKPDSIGSLSSMHKF------HLDQKVEEEGANFSLGERQLLALTRALVR 1374

Query: 623  KPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDG 682
            + KILILDEATS++D E++  I   +       + TI+ IAHRL TI   + I+V+   G
Sbjct: 1375 QSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTILTYDRILVL-EQG 1431

Query: 683  SVVEVGKFDKLYRNEE 698
             + E      LY  ++
Sbjct: 1432 EIEEFDTPRSLYEKKD 1447

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 118/239 (49%), Gaps = 21/239 (8%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           FK+++  I+ G  V I GP G GKS++ S +  F     G++ +D  D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPT-MDEIRVVSKQCFCHGFITKFPDGYDTVIGPR 602
             ++   P + + T+RDNI +G  Y     DE   V + C     I   P G  T IG R
Sbjct: 644 --LMCGYPWIQNATVRDNIIFGSPYDKERFDE---VVRVCSLKADIDILPGGELTEIGER 698

Query: 603 GASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISI 662
           G +LSGGQ+ RI +AR++ K   I + D+  SA+D      I      L R K  T I  
Sbjct: 699 GITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHI-MDECLLGRLKGKTRILA 757

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSD 721
            H+LS I ++  +IV+G DGS  E GK + L R+ ++ L  LL+       SK  +TS+
Sbjct: 758 THQLSLIEKASVVIVLGVDGS-FEAGKLEDLKRSNKT-LINLLHFSSQKSSSKEADTSE 814

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  130 bits (327), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 133/537 (24%), Positives = 251/537 (46%), Gaps = 32/537 (5%)

Query: 187  ITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDRNKVG 245
            +++++GI+    +  A +   + ++L +      SR L S +    +   + FF+   +G
Sbjct: 990  VSRYLGIYLALGLSSALSTLIQTIILWVFCTIRGSRYLHSIMAASVLRAPMVFFETTPIG 1049

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGA 305
             +++RF +D Y V   + +  +  F  +    V   ++    +T   + L+   P++V  
Sbjct: 1050 RILNRFSNDIYKVDELLGRTFAQFF--VNVTKVSFTIIVICVTTWQFIFLIL--PMIVLY 1105

Query: 306  FIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLF 361
              Y +     SR+L++    +   +    +E L G+ TI+ +  ++      N +     
Sbjct: 1106 VYYQQYYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGY-DQQDRFTHINQS----- 1159

Query: 362  YVGKREXXXXXXXXXXXXILGDMSFV-IVLLYGANLVLQGALSIGDLTAFML-----YTE 415
             +                +   + F+  ++++GA  +    L  G LT  M+     Y  
Sbjct: 1160 RIDNNMSAFYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAGSLTPGMIGLSLSYAL 1219

Query: 416  YTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALTPTQGKIEFRDV 471
                S+  +     E+     +  R+ E  + K+     +  +   A  P++G I+F   
Sbjct: 1220 QITQSLNWIVRMTVEVETNIVSVERIKEYSEIKSEAPLVIEDHRPPADWPSKGDIKFEHY 1279

Query: 472  SFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHD 531
            S  Y     N + K ++  ++P   + IVG +G GKS++T  L R  +   G I+ID   
Sbjct: 1280 STRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVIDGVP 1338

Query: 532  ISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEI-RVVSKQCFCHGFITK 590
            I++     LR  L ++ Q+  +  GT+R+NI     Y+   +EI RV+      +  ++ 
Sbjct: 1339 INEIGLHDLRHKLSIIPQDSQVFEGTVRENIDPTNQYSD--EEIWRVLELSHLKNHVLSM 1396

Query: 591  FPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGT 650
              DG  T +   GA+LS GQRQ + +ARAL+   +ILILDEAT+A+DVE++  I  T+ T
Sbjct: 1397 SKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQETIRT 1456

Query: 651  LMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
              + +  TI++IAHRL+TI  S+ I+V+ + G V E    + L + + S  + L ++
Sbjct: 1457 AFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVREFDTPENLLKQQGSIFYSLCSD 1510

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 133/581 (22%), Positives = 255/581 (43%), Gaps = 76/581 (13%)

Query: 161 NEDKESLIAGPIASLDA-------LPPIVG-TLSITQFVGIFAGALVVGATANFGRVVLL 212
           NE+++  +   I S+DA       LP + G  LSI  F+  F        T+   +  L 
Sbjct: 321 NEERKEKLNPIIQSIDAINKYTKELPIVRGFMLSIAMFLVSFT------QTSILHQYFLY 374

Query: 213 KI-IGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNV----S 267
               G  + S L S + K+ +    E  D +  GD+++    D   + + +TQ      S
Sbjct: 375 SFNTGMNIKSALTSTIYKKALVLSNEAADMSSTGDIVNLMSVDVQRL-QDLTQYCHLIWS 433

Query: 268 DGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLT 327
             F+ ++C  V +  +   S  +  ++L+   PL        KK+  +     ++    +
Sbjct: 434 GPFQILLCL-VSLYKLLGRSMWIGVIILVIMMPLNSMLMRIQKKLQKVQ---MKNKDERS 489

Query: 328 RVAEEQLNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILG 382
           R+  E LN I+++K +  E     K E  R +  ++ L  +G               ++ 
Sbjct: 490 RLISEILNNIKSLKLYSWEAPYKAKLEHVRNDKELKNLTKMGVYMALTSFQFNIVPFLVS 549

Query: 383 DMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLF 442
             +F  V +Y     L   L    L  F L +         L+ F    ++ + + +RL+
Sbjct: 550 CSTFA-VFVYTEKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAF----IEASVSVNRLY 604

Query: 443 ELMDHKNSVRSNISHALTPTQ--GKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSN 496
             + ++  ++ +  H L   Q  G +  +   D +F +  +P  Q+  K+++  ++ G  
Sbjct: 605 SFLTNEE-LQKDAVHHLPKAQKAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGEL 663

Query: 497 VCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSG 556
            C+VG  G GKS +             S+L D + +  +   ++      V Q P +M+G
Sbjct: 664 ACVVGKVGSGKSALVQ-----------SLLGDLYRVKGYA--AVHGSTAYVSQVPWIMNG 710

Query: 557 TIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAI 616
           T++DNI +G  Y P   ++ +  K C     +   PDG  T++G +G SLSGGQ+ R+++
Sbjct: 711 TVKDNILFGHKYDPVFYDLTI--KACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSL 768

Query: 617 ARALIKKPKILILDEATSALDVE-SEGAINYTLGT--LMRSK-------ELTIISIAHRL 666
           ARA   +    +LD+  +A+D   ++  I + LG   L++SK       ++T++SIA  +
Sbjct: 769 ARATYARADTYLLDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSI 828

Query: 667 STIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
           S +            G +++ G ++ + ++ +S L  L+ E
Sbjct: 829 SLVE----------GGEIIQHGSYEDISKDLDSPLSNLVKE 859

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 143/547 (26%), Positives = 240/547 (43%), Gaps = 75/547 (13%)

Query: 198  LVVGATA-NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAY 256
             V+G+ A  F + + + ++G      L  + ++R +H  + F D   +G +++RF  D  
Sbjct: 918  FVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMNRFTKDTD 977

Query: 257  VVSRSMTQNVSDGFKAIICGGVGMGMMFHISS--------TLTSVMLLFAPPLLVGAFIY 308
             +   +T++V               ++F I++         +       A P LV  +++
Sbjct: 978  TLDNEITESVR-------------LLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVF 1024

Query: 309  G-----------KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAI 357
                        K++ A+ R    ++ N      E L G+ TIK++ +E++ + + +  I
Sbjct: 1025 VADHYQASGREIKRMDAVQRSFVYNNFN------EVLGGMDTIKAYRSEQRFLMKSDFLI 1078

Query: 358  RQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVL--QGALSIGDLTAFMLYTE 415
             ++   G               I  DM  VI  L  A L +  Q  +S G +   + Y  
Sbjct: 1079 NKMNEAG----YLVTSIQRWVAISLDMLAVIFALIIALLCVTRQFHVSAGSVGVMVTYVL 1134

Query: 416  YTGSSVFGLSTFYSELMKGAGAASRL----FEL-MDHKNSVRSNISHALTPTQGKIEFRD 470
                 +  L    ++      +A RL    ++L ++ K  +         P++G+I+F +
Sbjct: 1135 QLPGLLNALLRSQTQTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFEN 1194

Query: 471  VSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDN 529
            VS +Y  RP   +  K++S  I     + I G +G GKSTI S L R  +   G I ID+
Sbjct: 1195 VSLAY--RPELPVALKNVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDD 1252

Query: 530  HDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT----------------PTMD 573
             DIS      LR  L ++ Q+P L  G IR N+      T                  +D
Sbjct: 1253 IDISTLGLYELRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVD 1312

Query: 574  EIRVVSKQCF-CHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEA 632
             IR   K      G + KF    D ++   G++ S G+RQ +A+ RAL++  KILILDEA
Sbjct: 1313 SIRAQHKDANGLSGDMFKF--HLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEA 1370

Query: 633  TSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDK 692
            TS++D  ++  I   +  +      TI+ IAHRL TI  + N I+V + G VVE     K
Sbjct: 1371 TSSVDYATDAKIQSRI--VEEFSNCTILCIAHRLKTI-LAYNRILVLDQGQVVEFDTPKK 1427

Query: 693  LYRNEES 699
            LY + +S
Sbjct: 1428 LYNDRDS 1434

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 118/243 (48%), Gaps = 28/243 (11%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F  ++F ++    + I GP G GKS++ + L  F   + GS+ I   D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
             ++   P + + T++DNI +G  +     + + V + C     +   P G  T IG RG
Sbjct: 640 --LLCGYPWVQNATVKDNILFGSPFDKP--KYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIIS 661
            +LSGGQ+ RIA+AR++ K   I + D+  SA+D      I     +G L   K+ T I 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYL---KQKTRIL 752

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE--SELFKLLN----EKDHDLVSK 715
             H+LS I ++  +I +G DGS  ++G   +L +     S+L +  N    E+  D  +K
Sbjct: 753 ATHQLSLIDKASRVIFLGLDGS-FDIGTVPELLKRNTGFSDLMQFQNSAPAEELEDDDTK 811

Query: 716 SEN 718
           ++N
Sbjct: 812 AQN 814

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 148/546 (27%), Positives = 248/546 (45%), Gaps = 39/546 (7%)

Query: 187  ITQFVGIFAGALVVGATANFGR-VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            +  FVG+++   V  A  N  R +++L     R   +L   + K  +   + FF+   VG
Sbjct: 1017 VWMFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVG 1076

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGA 305
             +I+RF SD   V  ++    S  FK+I+   V + ++ +         L+F   L+V  
Sbjct: 1077 RIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYN----MPWFLVFNMFLVVIY 1132

Query: 306  FIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIR-RYNDAIRQL 360
              Y      +SR+L++    S   +  +  E LNG   I ++   ++ I   Y      +
Sbjct: 1133 IYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNV 1192

Query: 361  FYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYT-EYTGS 419
             +V                I   +     +L  A +  +  LS G +   M Y+ E TGS
Sbjct: 1193 DFVFNFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEVTGS 1252

Query: 420  SVFGLSTFYSELMKGAGAASRLFELMDHKNSVRS----NISHALTPTQGKIEFRDVSFSY 475
              + + T  + +     +  R+ E  +     +S           P++G IEF++ S  Y
Sbjct: 1253 LTWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKY 1311

Query: 476  PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKF 535
                 + +  +++  IEP   V IVG +G GKST++  L R  +P  G I+ID  DIS  
Sbjct: 1312 -RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDI 1370

Query: 536  TTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKF---- 591
                LR HL ++ Q+     GT++ N+     Y+   DE++   +Q      + K     
Sbjct: 1371 GLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSE--DELKRAVEQAHLKPHLEKMLHSK 1428

Query: 592  PDG-------------YDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
            P G              D  I   G++LS GQRQ + +ARAL+ + KIL+LDEAT+++D+
Sbjct: 1429 PRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDM 1488

Query: 639  ESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE 698
            E++  I  T+      K+ TI++IAHR+ T+  S+ IIV+ + GSV E     KL  ++ 
Sbjct: 1489 ETDKIIQDTIRR--EFKDRTILTIAHRIDTVLDSDKIIVL-DQGSVREFDSPSKLLSDKT 1545

Query: 699  SELFKL 704
            S  + L
Sbjct: 1546 SIFYSL 1551

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 121/240 (50%), Gaps = 18/240 (7%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGV-- 546
           F  + G  VC+VG  G GKST    +L       G +   +        K + R   V  
Sbjct: 660 FEAKRGDLVCVVGRVGAGKSTFLKAIL-------GQLPCMSGSRDSIPPKLIIRSSSVAY 712

Query: 547 VQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASL 606
             QE  +M+ ++R+NI +G  +    D   +  K C     +   PDG +T++G +G SL
Sbjct: 713 CSQESWIMNASVRENILFGHKFD--QDYYDLTIKACQLLPDLKILPDGDETLVGEKGISL 770

Query: 607 SGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GTLMRSKELTIISIAH 664
           SGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  I Y L G     K  TII   +
Sbjct: 771 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTN 830

Query: 665 RLSTIRRSENIIVVGNDGSVVEVGKFDKLY--RNEESELFKLLNEKDHDLVSKSENTSDI 722
            +S ++ S+ I  + N G +VE G ++ +   +N  S+L KLL E D  +   + N SD+
Sbjct: 831 TVSILKHSQMIYALEN-GEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPI--DNGNESDV 887

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 145/533 (27%), Positives = 240/533 (45%), Gaps = 61/533 (11%)

Query: 204  ANFGRVVLLKI--IGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRS 261
            A+   +++LK   IG    S++ ++++ R +H  + FFD    G +++R   D  ++ + 
Sbjct: 974  ASVTTLIMLKFLCIGLEASSKVFAEILNRVLHAKMTFFDFTPAGRILNRITRDFEILEQE 1033

Query: 262  MTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAI---SRQ 318
            +   +     AI      +G +  + S + +  L+FA   L+G  IY   I++     R 
Sbjct: 1034 LMVLLLQLLFAI----TSLGAILLLISVIATKFLIFA--FLLG-IIYAVMITSYIPAFRD 1086

Query: 319  LQQSSGNLTRVA-----EEQLNGIRTIKSFVAEK----KEIRRYNDAIRQLFYVGKREXX 369
            L++  G +TR        E L+G  TI+ F  EK    +  R+ +   R  +YV      
Sbjct: 1087 LKRYEG-ITRSPIFEQFSELLSGFVTIRGFGKEKSCMGQLFRKLDLNNRPAYYVS----V 1141

Query: 370  XXXXXXXXXXILGDMSFVIVLLYGANLVLQGA--LSIGDLTAFMLYTEYTGSSVFGLSTF 427
                      +LG +    VL   A L L  A  L  G     + Y      S    +T 
Sbjct: 1142 VQLWLCLRVEVLGSL----VLGATATLSLLNAKELGAGLAGLALTYAMPFSQSALWTATV 1197

Query: 428  YSELMKGAGAASRLFEL--MDHKNSVRSNISHALTPTQGKIEFRDVSFSY-PTRPSNQIF 484
             S +     +  R+ E   +D +++    + +       +I F  V   Y P  P   + 
Sbjct: 1198 SSNVEIKMTSVERIKEYTEIDCEDTKAGALINTQWSGGAEISFDHVYVRYAPHLP--DVL 1255

Query: 485  KHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHL 544
            K++SFT+ P S V IVG +G GKST+   L R  +   G+I I   DI+    ++LRR L
Sbjct: 1256 KNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGTIRIGGIDIASLNLQTLRREL 1315

Query: 545  GVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCH-----GFITKFPD-----G 594
             V+ Q+P+L SGTI+ NI          D     S Q   H     G  +   D      
Sbjct: 1316 TVIPQDPSLFSGTIKSNI----------DPFGRYSDQELTHFARRIGLFSGTDDVRTFNS 1365

Query: 595  YDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRS 654
              +++   G ++S GQRQ + +ARAL++K KILILDEAT+++D E++  I   +     S
Sbjct: 1366 LGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHETDATIQQVVRDF--S 1423

Query: 655  KELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
                +I++AHR+STI   + +IV+  D  +V+      L   +     ++  E
Sbjct: 1424 SGGIVITVAHRMSTIIDYDQVIVL--DSGIVKENNHPYLLLKQNGAFHQMCKE 1474

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 89/359 (24%), Positives = 163/359 (45%), Gaps = 44/359 (12%)

Query: 385 SFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGL--------STFYSELMKGAG 436
           + V    +GA++ LQ            + + YT  ++F L        +T    +++   
Sbjct: 556 TLVTAATFGASIYLQKQ-------KITVASAYTALTLFALLRNPLTQLATMLGTIIQTTV 608

Query: 437 AASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSN 496
           +  R+ + ++  N+ +  I   L  +  ++ FR+ S ++    +  + K+++   E    
Sbjct: 609 SIQRIEKFLNRSNTKKHEI---LKDSFTEMGFRNASLTWNRFDTGFMLKNLTIDFELHKL 665

Query: 497 VCIVGPSGKGKSTITSLLLRFYDPNYGSILIDN---HDISKFTTKSLRRHLGVVQQEPTL 553
             I+GPSG GKS++   LL   D   GSI +     HD         R       Q P +
Sbjct: 666 NVIIGPSGSGKSSVLLALLGELDLIEGSIRVPRGYMHDD--------RCSFAFCSQTPWI 717

Query: 554 MSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQR 613
            + T+++NI +   +       + V   C     I +  +G +TV+G +G +LSGGQRQR
Sbjct: 718 TNATVKENIVFSSQFNT--KRYQEVLHACGLEEDILEMQEGDETVVGDKGMTLSGGQRQR 775

Query: 614 IAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRR 671
           +A+ARA+    + L+LD+  SA+D      I     +G LM+ K  T I   H ++ +++
Sbjct: 776 LALARAVYSGAEHLLLDDCLSAVDPGMAVWIFQKCIMGPLMKGK--TCILATHNIALVQK 833

Query: 672 SENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKND 730
             ++I++ ++G V ++GK         +  F   +E D+   SK E     P   PK +
Sbjct: 834 HADMIILLDNGRVSKIGK---------ARDFNFDSEFDYSKPSKLEKAEMKPNKKPKKE 883

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 140/543 (25%), Positives = 244/543 (44%), Gaps = 46/543 (8%)

Query: 188  TQFVGIFAGALVVGATANFGRVVLLKII-----GERLVSRLRSQVIKRTMHHDIEFFDRN 242
            T+++ I+    V  A A   + ++L +       + L   + S V+K  M     FF+  
Sbjct: 992  TRYLMIYLALGVGSALATLIQTIVLWVFCTIHGSKYLHDAMASSVLKAPM----SFFETT 1047

Query: 243  KVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLL 302
             +G +++RF +D Y V   + +  +  F  +    V +     +    T   +    PL 
Sbjct: 1048 PIGRILNRFSNDIYKVDEILGRTFAQFFANV----VKVSFTIVVICMATWQFIFIVLPLS 1103

Query: 303  VGAFIYGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEIR----RY 353
            V    Y +     SR+L++   ++TR       +E L G+ TI+ +  + + +     R 
Sbjct: 1104 VLYIYYQQYYLRTSRELRRLD-SVTRSPIYAHFQETLGGLTTIRGYSQQNRFVHINQTRV 1162

Query: 354  NDAIRQLF-YVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFML 412
            ++ +   +  V                I+   S + V+  G      G L+ G +   + 
Sbjct: 1163 DNNMSAFYPSVNANRWLAFRLEFIGSVIILAASMLAVIRLG-----NGTLTAGMIGLSLS 1217

Query: 413  YTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNS----VRSNISHALTPTQGKIEF 468
            +      S+  +     E+     +  R+ E  + K+     ++ +   A  P  G+I+F
Sbjct: 1218 FALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPYIIKDHRPPASWPESGEIKF 1277

Query: 469  RDVSFSYPTRPSNQ-IFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI 527
              V++S   RP  + I K +   I P   + IVG +G GKS++T  L R  +   G I+I
Sbjct: 1278 --VNYSTRYRPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIEAASGHIVI 1335

Query: 528  DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCH-- 585
            D   I       LR  L ++ Q+  +  GT+R+NI     YT   DE  + +     H  
Sbjct: 1336 DGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENIDPTNRYT---DE-EIWNALALSHLK 1391

Query: 586  -GFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 644
               +    +G +T++   G++LS GQRQ + +ARAL+    ILILDEAT+A+DVE++  I
Sbjct: 1392 DHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVDVETDQLI 1451

Query: 645  NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
              T+      KE TI++IAHR++TI  S+ IIV+ + G V E      L + ++S  + L
Sbjct: 1452 QKTIRNAF--KERTILTIAHRINTIMDSDRIIVL-DKGRVTEFDTPQNLLQKKDSIFYSL 1508

Query: 705  LNE 707
              E
Sbjct: 1509 CLE 1511

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 125/501 (24%), Positives = 221/501 (44%), Gaps = 61/501 (12%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIYGKK------ISAISRQLQQ----SSGNLTRVAEEQ 333
           F I   L S+  L  P + VG  I          I  I ++LQ+    +    TRV  E 
Sbjct: 429 FQIVLCLVSLYKLLGPCMWVGVIIMIVMIPINSVIVRIQKKLQKIQMKNKDERTRVTSEI 488

Query: 334 LNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN I+++K +  E     K +  R    ++ L  +G               ++   +F  
Sbjct: 489 LNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQFNIVPFLVSCSTFA- 547

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           V +Y     L   L    LT F L +         +S+F    ++ + + +RLF  +   
Sbjct: 548 VFVYTEERPLSTDLVFPALTLFNLLSFPLAVVPNAISSF----IEASVSINRLFAFL--T 601

Query: 449 NSVRSNISHALTPTQGKI-----EFRDVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGP 502
           N    N +    P    I     +  D +F +  +P  ++  K+++F  + G   CIVG 
Sbjct: 602 NEELQNDAVLREPKVKNIGDEGVKVNDATFLWQRKPEYKVALKNINFVAKKGELTCIVGK 661

Query: 503 SGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI 562
            G GKS +             S+L D   +  F T  +   +  V Q P +M+GT++DNI
Sbjct: 662 VGSGKSALIQ-----------SLLGDLIRVKGFAT--VHGDVANVSQVPWIMNGTVKDNI 708

Query: 563 TYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIK 622
            +G  Y P   ++ +  K C     ++  PDG  T++G +G SLSGGQ+ R+++ARA+  
Sbjct: 709 LFGHKYDPEFYQLTI--KACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYS 766

Query: 623 KPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVG 679
           +    +LD+  +A+D   ++  I + LG   L+ SK  T +   ++++ +  +++I ++ 
Sbjct: 767 RADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSK--TKVLATNKITVLSIADSITLME 824

Query: 680 NDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEHLV 739
           N G +++ G +D++  +  S L KL+ E       K + T   P  S      + L  L 
Sbjct: 825 N-GEIIQQGSYDQVNESTNSPLSKLIAE----FGKKGKPT---PSQS-----TTSLAKLA 871

Query: 740 AEDVASINDKVVKNVLNDITH 760
           +E + S +D  +  +  DI  
Sbjct: 872 SEGIESYSDSKISEITVDINQ 892

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 141/260 (54%), Gaps = 11/260 (4%)

Query: 461  PTQGKIEFRDVSFSYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYD 519
            PT G I+F+  S  Y  RP  + I K ++  I+P   + IVG +G GKS++T  L R  +
Sbjct: 1274 PTDGAIQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIE 1331

Query: 520  PNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEI-RVV 578
               G I+ID   I +     LR  L ++ Q+  +  G++R+NI     Y+   +EI RV+
Sbjct: 1332 AAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENIDPTEQYSD--EEIWRVL 1389

Query: 579  SKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
                  +  +    DG  T +   G +LS GQRQ + +ARAL+   KIL+LDEAT+A+DV
Sbjct: 1390 DLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDV 1449

Query: 639  ESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEE 698
            E++  +  T+ T    +  TI++IAHRL+TI  S+ I+V+ + G V E    + L +N  
Sbjct: 1450 ETDKVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKNPG 1506

Query: 699  SELFKLLNEKDHDLVSKSEN 718
            +  + L   +D   V +  N
Sbjct: 1507 TMFYGLC--QDAGFVPRPSN 1524

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 123/515 (23%), Positives = 230/515 (44%), Gaps = 57/515 (11%)

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
           G  L S L S + K+++    E  D +  GD+++    D   V R   Q+++     I  
Sbjct: 378 GMNLKSALTSVIYKKSLVLSSEAADMSSTGDIVNLMSVD---VQR--LQDLAQWCHLIWS 432

Query: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQ----SSGN 325
           G       F I   LTS+  L    + VG  I          +  + + LQ+    +   
Sbjct: 433 GP------FQIILCLTSLYKLLGKSMWVGVIILIVMMPLNSSLMRVQKNLQKGQMKNKDQ 486

Query: 326 LTRVAEEQLNGIRTIKSFVAEKK-----EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXI 380
            TR+  E LN ++++K +  EK      E  R    ++ L  +G                
Sbjct: 487 RTRLINEILNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFF 546

Query: 381 LGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASR 440
           +   +F  V +Y  +  L   L    LT F L +         L+++    ++ + +  R
Sbjct: 547 VSCSTFA-VFVYTEDRPLTTDLVFPALTLFGLLSFPLAVVPLVLNSY----IEASVSIGR 601

Query: 441 LFELMDHKNSVRSNISH-ALTPTQGKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGS 495
           L+  + ++   R ++         G +  +   + +F +  +P  ++  K+++F  + G 
Sbjct: 602 LYSFLTNEELQRDSVQRLPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGE 661

Query: 496 NVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMS 555
             C+VG  G GKS +             S+L D   +  F T  +  ++  V Q   +M+
Sbjct: 662 LNCVVGRVGSGKSALIQ-----------SLLGDLFRVKGFAT--VHGNIAYVSQVAWIMN 708

Query: 556 GTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
           GT++DNI +G  Y P   E  +  K C     +   PDG  T++G +G SLSGGQ+ R++
Sbjct: 709 GTVKDNILFGHKYDPEFYEKTI--KACALTIDLAILPDGDKTIVGEKGISLSGGQKARLS 766

Query: 616 IARALIKKPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRS 672
           +ARA+  +  I +LD+  +A+D   S   I++ LG   L+++K  T I   +++S +  +
Sbjct: 767 LARAVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTK--TKILATNKISALSIA 824

Query: 673 ENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
           +++ ++ N G +++ G F ++ +  +S L KL+ E
Sbjct: 825 DSVTLLEN-GEIIQQGTFCEITKAADSPLSKLIKE 858

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 124/500 (24%), Positives = 221/500 (44%), Gaps = 35/500 (7%)

Query: 223  LRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGM 282
            L   ++   +   + FF+   +G +++RF +D Y V   + +  S  F         +  
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFF----ANTTRVSF 1058

Query: 283  MFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIR 338
               +    T     F  PL +    Y +     SR+L++    +   +    +E LNG+ 
Sbjct: 1059 TIIVICVTTWQFTFFVIPLAMLYIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVS 1118

Query: 339  TIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFV--IVLLYGANL 396
            +I+ +  +       N A      +                +   + F+   ++ + A L
Sbjct: 1119 SIRGY-GQLDRFIHINQA-----RINNNTSAYYPSMNVNRWLAYRLEFIGSCIIFFAATL 1172

Query: 397  ----VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVR 452
                +  G+L+ G +   + Y      S+  +     E+     +  R+ E  + +    
Sbjct: 1173 SVFRLASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAP 1232

Query: 453  SNISHAL----TPTQGKIEFRDVSFSYPTRPS-NQIFKHMSFTIEPGSNVCIVGPSGKGK 507
              I++++     P  G+I+F + S  Y  RP  + I + ++  I+P   V IVG +G GK
Sbjct: 1233 QFIANSVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAGK 1290

Query: 508  STITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLS 567
            S++   L R  +   G I ID   I       LR+ L ++ Q+  +  GT+RDNI     
Sbjct: 1291 SSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNIDPTKQ 1350

Query: 568  YTPTMDE--IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPK 625
            YT   DE   + +              DG DT +   G +LS GQRQ + +ARAL+   +
Sbjct: 1351 YT---DEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFR 1407

Query: 626  ILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVV 685
            IL+LDEAT+A+DVE++  I  T+ +    +  TI++IAHR++TI  S+ I+V+ + G+V 
Sbjct: 1408 ILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTVA 1464

Query: 686  EVGKFDKLYRNEESELFKLL 705
            E    + L + +E  +F  L
Sbjct: 1465 EFDTPENLLKKKEESIFYTL 1484

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 117/513 (22%), Positives = 225/513 (43%), Gaps = 56/513 (10%)

Query: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275
           G  L S + S + K+ +H   E    +  GD+++    DA  + R +TQ           
Sbjct: 355 GTDLRSGITSLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQ----------W 403

Query: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQ----SSGN 325
           G V     F +   L S+  L  P + VG  +          IS + ++LQ+    +   
Sbjct: 404 GNVIWSGPFQLCLCLYSLHRLLGPCIWVGVVLLLFTLPLNSYISRVLKRLQKEQMKNKDE 463

Query: 326 LTRVAEEQLNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXI 380
            TR+  E LN I+++K +  E     K +  R    ++ L  +G               +
Sbjct: 464 RTRLISEILNNIKSLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFL 523

Query: 381 LGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASR 440
           +   +F + +L      L   L    LT F L +         +++F    ++ + A  R
Sbjct: 524 VSCSTFAVFVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSF----IEASVAIGR 579

Query: 441 LFELMDHKNSVRSNISH---ALTPTQGKIEFRD-VSFSYPTRPSNQI-FKHMSFTIEPGS 495
           L   +  +   R  I+       P    +   D  +F +  +P  ++  K+++F  +   
Sbjct: 580 LTNFLTAEELQRDAITREPAVKAPGGVAVALADNATFLWQRKPEYKVALKNINFRAKKSE 639

Query: 496 NVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMS 555
             CI+G  G GKS +   +L       G +   N       +  +R ++  V Q   +M+
Sbjct: 640 LTCIIGKVGSGKSALIQAML-------GDLFRVN------GSAVVRGNVAYVSQVAWIMN 686

Query: 556 GTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
           GT+RDNI +G  Y     +  +  K C     ++  PDG +T +G +G SLSGGQ+ R++
Sbjct: 687 GTVRDNILFGHKYDAKFYQQTI--KACALTVDLSILPDGDNTFVGEKGISLSGGQKARLS 744

Query: 616 IARALIKKPKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRS 672
           +ARA+  +    +LD+  +A+D   ++  +    G   L++SK   + +  ++++ +  +
Sbjct: 745 LARAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIA 802

Query: 673 ENIIVVGNDGSVVEVGKFDKLYRNEESELFKLL 705
           ++I+++ N G +V+ G F ++  +E+S + KL+
Sbjct: 803 DHIVLLEN-GEIVQQGTFSEVISDEDSAISKLV 834

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 132/539 (24%), Positives = 235/539 (43%), Gaps = 62/539 (11%)

Query: 186  SITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            S + ++G++   +     A   +  +L  +G      L  + +KR +H  + F D   +G
Sbjct: 924  STSFYMGLYTFFVFFNYFATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTTPIG 983

Query: 246  DLISRFGSDAYVVSRSMTQNVSDG-FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
             +++RF  D   +   +T++V    F+A    GV +  + ++           A P L+ 
Sbjct: 984  RVLNRFTKDTDTLDTELTESVRLFLFQASNIVGVVIMCIIYLP------WFAIAVPFLLL 1037

Query: 305  AFIYGKKISAISRQLQQSSGNLTRVA-----------EEQLNGIRTIKSFVAEKKEIRRY 353
             F      +A++   Q SS  + R+             E L+G+ TI+++  E + + + 
Sbjct: 1038 IF------AAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKS 1091

Query: 354  NDAIRQLFYVGKREXXXXXXXXXXXXILGDMSF--VIVLLYGANLVLQGALSIGDLTAFM 411
            +  I ++   G               ++  M+F  +I LL         A S+G L  ++
Sbjct: 1092 DFLINKMNEAGYVVVAIQRWVSIALDMIA-MAFALIITLLCVTRQFSISAASVGVLLTYV 1150

Query: 412  LYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISH--------ALTPTQ 463
            L  +  G     L+T    + +G    +    L+ +   +    ++           P++
Sbjct: 1151 L--QLPGL----LNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPPESWPSE 1204

Query: 464  GKIEFRDVSFSYPTRPSNQIFKH-MSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNY 522
            G I+F  VS +Y  RP   +  H +S  +  G  + I G +G GKSTI S L R  + + 
Sbjct: 1205 GAIDFDHVSLAY--RPGLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHD 1262

Query: 523  GSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT--------------YGLSY 568
            GSI ID  DI++     LR  L ++ Q+P L  G +R N+                    
Sbjct: 1263 GSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGA 1322

Query: 569  TPTMDEIRVVSKQCFCHGFITKFPDGY-DTVIGPRGASLSGGQRQRIAIARALIKKPKIL 627
              T DE    +      G +T     + +  +   G++ S G+RQ +A+ RAL++  +IL
Sbjct: 1323 IATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRIL 1382

Query: 628  ILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVE 686
            ILDEATS++D E++  I   +       E T++ IAHRL+TI   + I+V+ + G V E
Sbjct: 1383 ILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVL-DQGRVCE 1438

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/275 (27%), Positives = 122/275 (44%), Gaps = 43/275 (15%)

Query: 447 HKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKG 506
            KN V S+ S +  P   K+ F+              FK+++  I  G  V + G  G G
Sbjct: 573 QKNDVSSDTSSSNEP---KVNFKG-------------FKNLNIEIAKGELVIVTGSVGTG 616

Query: 507 KSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGL 566
           KS++ + +  F     G I         +   SL     ++   P + + T++DNI +G 
Sbjct: 617 KSSLLAAMSGFMKKKSGDI---------YKNGSL-----LLCGYPWIQNTTVKDNILFGS 662

Query: 567 SYTPTMDEIRVVS--KQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624
            +    DE R     + C     +   P G  T IG RG +LSGGQ+ RI +AR++ KK 
Sbjct: 663 PF----DEARYKETIRVCSLQADLDLLPAGDKTEIGERGITLSGGQKARINLARSVYKKK 718

Query: 625 KILILDEATSALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDG 682
            I + D+  SA+D      I     +G L      T +   H+LS I R+  +I +  DG
Sbjct: 719 DIYLFDDVLSAVDARVGKHIMDECMMGAL---DGKTRVLATHQLSLIARASKVIFIDLDG 775

Query: 683 SVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSE 717
           + V+ G  D+L ++  +   KL+   +H    + E
Sbjct: 776 T-VDSGTLDEL-KSRHAGFVKLMEYSNHTSTDEEE 808

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  118 bits (295), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 128/236 (54%), Gaps = 22/236 (9%)

Query: 461 PTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDP 520
           P  G +E +++S  Y    S++   ++SF ++ G+ V IVG +G GKS+I + + R  D 
Sbjct: 28  PQTGDVELKNLSLRYSPH-SSKALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDW 86

Query: 521 NYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT----------YG----L 566
             G+I IDN DI     + LR  +  + Q+PTL  GT+R N+           YG    +
Sbjct: 87  ENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKV 146

Query: 567 SYTPTMDEIRVVSKQ----CFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIK 622
                 DE+ ++ +Q       H    +F D  +TV+   G++LS GQRQ + +AR+++ 
Sbjct: 147 GLIEECDELCLIFEQEQPNFSSHKLRNRFID-LNTVVKSGGSNLSQGQRQLLCLARSMLG 205

Query: 623 KPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVV 678
              I+++DEAT+++D  S+  I  T+   M  K  TI++IAHRL ++   + I+V+
Sbjct: 206 ARNIMLIDEATASIDYISDAKIQKTIRETM--KNTTILTIAHRLRSVIDYDKILVM 259

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 136/539 (25%), Positives = 239/539 (44%), Gaps = 53/539 (9%)

Query: 187  ITQFVGIFAGALVVGATANFGRVVLLKIIGE-RLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            I  +V ++A   +  A     R V++ I    +   +L   + +  +   + FF+   VG
Sbjct: 1012 IWMYVAVYALIGLGSAAFTILRSVIMMIYCSIKGSKKLHDTMARAVLRSPMSFFETTPVG 1071

Query: 246  DLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHI--SSTLTSVMLLFAPPLLV 303
             +I+RF SD  VV + +  + +  F  I      +  +F +   S    + LLF   LLV
Sbjct: 1072 RIINRFSSDVNVVDQGLQFSFTYFFIYI------LNYLFTVILISFNMPLFLLFNGILLV 1125

Query: 304  GAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRY----ND 355
              F Y      +SR+L++    S   +  +  E L G   I ++    K ++R+    N+
Sbjct: 1126 LYFYYQIYYITLSRELKRLTSISYSPIMSLLSETLGGHLVINAY----KHLQRFTYLNNE 1181

Query: 356  AIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLV-LQGALSIGDLTAFMLYT 414
            +I+                      +G +  ++  L   + +    ALS G +   M Y 
Sbjct: 1182 SIQFNINCMFNFRSTNRWLSMRLQTIGAVLVLLTALLSLSTINTDKALSSGMVGLLMSYA 1241

Query: 415  EYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL----TPTQGKIEFRD 470
                +S+  +     ++     +  R+ E  +      + I  +      P++G I F++
Sbjct: 1242 LQVTTSLTWIVRMSVQVETDIVSVERILEYCNLPPEADAIIEESRPPKEWPSRGAITFQN 1301

Query: 471  VSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
             S  Y     + + K ++  I+P   + IVG +G GKST++  L R  +P+ GSI+ID  
Sbjct: 1302 YSTKY-RENLDPVLKDITVEIKPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGI 1360

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITK 590
            DI+K     LR +L ++ Q+     GTI+ N+     Y+   +EI    +       I K
Sbjct: 1361 DIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFGQYSD--EEIWRALELSHLKPHILK 1418

Query: 591  FPDGYDTV------------------IGPRGASLSGGQRQRIAIARALIKKPKILILDEA 632
                 +T                   I   G +LS GQRQ + ++RAL+   KIL+LDEA
Sbjct: 1419 MASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEA 1478

Query: 633  TSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
            T+A+D+E++  I  T+ T  + +  TI++IAHR+ T+  S+ I+V+       EV +FD
Sbjct: 1479 TAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTVMDSDKIMVLDKG----EVKEFD 1531

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 144/295 (48%), Gaps = 26/295 (8%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQ 548
           F    G   CIVG  G GKST    +L       G   +D H   K   ++  + +    
Sbjct: 651 FEARKGDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYCP 705

Query: 549 QEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSG 608
           Q+P +M+ +++DN+ +G  +    D  +   ++C     +   PDG  T++G +G SLSG
Sbjct: 706 QQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGISLSG 763

Query: 609 GQRQRIAIARALIKKPKILILDEATSALDVE-----SEGAINYTLGTLMRSKELTIISIA 663
           GQ+ R+++ARA+  +  + +LD+  SA+D E      E  +N   G L   K  T+I   
Sbjct: 764 GQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGIL---KNKTVILTT 820

Query: 664 HRLSTIRRSENIIVVGNDGSVVEVGKF-DKLYRNEESELFKLLNEKDHDLVSKSENTSDI 722
           + +S ++ S+NI  +  DG +VE   + D +  ++ S L  L+ E D +  S+ E+T D 
Sbjct: 821 NAVSVLKHSQNIYALL-DGEIVENKSYADAMSCDDSSILKTLIQEFDSNENSR-EDTKDG 878

Query: 723 PPDSPKNDDASGLEHL--VAEDVASINDKVV-----KNVLNDITHDKNS-STLRP 769
            P S   DD      +    ED AS    V      +N+LN++   + S +TL+P
Sbjct: 879 QPSSTAKDDQKSFHSIKDEQEDRASTTKLVYSLDTEENMLNEVDSRRASLATLKP 933

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 135/515 (26%), Positives = 232/515 (45%), Gaps = 71/515 (13%)

Query: 215  IGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAII 274
            IG     RL     KR ++  + F D   +G +++RF  D  V+   +T + +  F   +
Sbjct: 891  IGLSASRRLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTDS-TRMFVFQM 949

Query: 275  CGGVGMGMM-------FHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLT 327
               VG+ ++         I+  ++ ++LLF       A    K++ AI R    +  NL 
Sbjct: 950  ANVVGVFILSIAYLPYVAIAVPISVLLLLFIGDHYQSAGREVKRLEAIQRSFVYN--NLG 1007

Query: 328  RVAEEQLNGIRTIKSFVAEKKEIR-------RYNDAIRQLFYVGKREXXXXXXXXXXXXI 380
             V    L+G+ TI+++ A+ + +R       R N+A      +G R             +
Sbjct: 1008 EV----LDGLDTIRAYNAQSRFLRKSDYFLNRTNEA--GYLVIGAR---------CWVAL 1052

Query: 381  LGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASR 440
              D+  + + L    L +   + I   +A +L T      V  +  +++ +++G      
Sbjct: 1053 TTDLVAIAIALIVTLLCVTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRG------ 1101

Query: 441  LFELMDHKNSVRSNISHALTPTQ------------------GKIEFRDVSFSYPTRPSNQ 482
              EL ++ NS +    +A    Q                  G+I F++VSF+Y  RP   
Sbjct: 1102 FTELENNMNSTQRVHYYATALPQEAPQYLPGAAPPAGWPAAGEIVFQEVSFAY--RPGLP 1159

Query: 483  I-FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLR 541
            +    +SF +  G  + I G +G GK+++T+ L R  +   GSI ID  DI+      LR
Sbjct: 1160 LALCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLR 1219

Query: 542  RHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFI-TKFPDGYDTVIG 600
              L ++ Q+P L  GT+R N+     +T       +V       G + T      D  + 
Sbjct: 1220 SALSIIPQDPLLFRGTVRKNLDPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVD 1279

Query: 601  PRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTII 660
              GA+ S G+RQ +A+ARAL++  +ILILDEATS++D  ++  +   +    R  + T++
Sbjct: 1280 EGGANFSLGERQLLALARALVRSTRILILDEATSSVDYATDARVQARIAAEFR--QATVL 1337

Query: 661  SIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR 695
             +AHRL TI   + I+V+ + G V E   FD  YR
Sbjct: 1338 CVAHRLRTIISYDRILVL-DQGRVAE---FDTPYR 1368

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 147/326 (45%), Gaps = 47/326 (14%)

Query: 449 NSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKS 508
           +SV+S+    L+  + + + R+  F  P    N +     F+I+ G  + ++G  G GK+
Sbjct: 520 DSVQSDTVTVLSKKREEKQSREEVFKVPFTGLNDLL----FSIKKGEFIIVIGAIGTGKT 575

Query: 509 TITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSY 568
           ++ + +  +     GS+ ++   +            GV    P + + TIRDNI +G S+
Sbjct: 576 SLLNAVAGYMKKTTGSVHVNGSLL----------FCGV----PWIQNATIRDNIIFGSSF 621

Query: 569 TPT-MDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKIL 627
             T  DE   V   C        FP G  T +G RG +LSGGQ+ RI++ARA+ K   I 
Sbjct: 622 DQTRYDE---VVNACALEADFKIFPAGDKTEVGERGITLSGGQKARISLARAIYKDRDIY 678

Query: 628 ILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSV--- 684
           + D+  SA+D      I      L R +  T I   H+L+ ++ +  +I +G DGS    
Sbjct: 679 LFDDIISAVDANVAAHITQKC-LLDRLQNRTRILATHQLALVQEASRVIFLGQDGSFDMG 737

Query: 685 --VEVGKFDKLYRN----------EESELFKLLNEKDHDLVSKSENTSDIP---PDSPKN 729
              E+ + +  +RN          EESE+  + ++      SKS+  S  P   PD  + 
Sbjct: 738 TPAELHEKNPQFRNLMSLSSQTNAEESEMESIRSQ------SKSKKASTAPVSMPDFNEE 791

Query: 730 DDASGLEHLVAEDVASINDKVVKNVL 755
            D   +       V ++  KV K+ L
Sbjct: 792 IDDGRITSKEERAVNALKFKVYKDYL 817

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 132/542 (24%), Positives = 235/542 (43%), Gaps = 60/542 (11%)

Query: 190  FVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLIS 249
            ++G++   +         +  L+  IG     RL  + ++R +H  + F D   +G +++
Sbjct: 943  YMGMYTFFVFFNYFVTTSQFSLICYIGLSAAKRLNLKAVQRLLHTPMSFLDTTPIGRVLN 1002

Query: 250  RFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG 309
            RF  D   V   +T++V   F   +   VG+ +M  I     ++    A P L+  F+  
Sbjct: 1003 RFTKDTDTVDTELTESVR-LFVFQLSNIVGVIVMCIIYLPWFAI----AVPFLMLVFV-- 1055

Query: 310  KKISAISRQLQQSSGNLTRVA-----------EEQLNGIRTIKSFVAEKKEIRRYNDAIR 358
                 ++   Q SS  + R+             E L G+ TI+++  E++ + + +    
Sbjct: 1056 ----GVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERRFLTKSDFLTN 1111

Query: 359  QLFYVGKREXXXXXXXXXXXXILGDMSF--VIVLLYGANLVLQGALSIGDLTAFMLYTEY 416
            ++   G               ++  M+F  ++ LL         A S+G L  ++L  + 
Sbjct: 1112 KMNEAGYLVVAIQRWVAIALDMIA-MAFALIVTLLCVTRQFHISAASVGVLLTYVL--QL 1168

Query: 417  TGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISH--------ALTPTQGKIEF 468
             G     L+     + +G    +    L+ +   +    ++        A  PT G+IEF
Sbjct: 1169 PGL----LNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPAEWPTDGRIEF 1224

Query: 469  RDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILI 527
              VS +Y P  P   + K ++  +  G  + I G +G GKSTI S L R  + + GSI I
Sbjct: 1225 DHVSLAYRPGLP--LVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYRMCELHDGSITI 1282

Query: 528  DNHDISKFTTKSLRRHLGVVQQEPTLMSGTIR-----------DNITYGLSYTPTMDEIR 576
            D  DIS      LR  L ++ Q+P +  G +R           D + + L     +    
Sbjct: 1283 DGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTDDELWHALVRGGAIPAES 1342

Query: 577  VVSKQCFCH---GFITKFPDGY-DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEA 632
            + + +   H   G ++     +    +   G + S G+RQ +A+ RAL+++ KILILDEA
Sbjct: 1343 LATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRALVRQSKILILDEA 1402

Query: 633  TSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDK 692
            TS++D E++  I   +     +   TI+ IAHRL+TI   + I+V+ + G V E      
Sbjct: 1403 TSSVDYETDAKIQTRIVEAFSN--CTILCIAHRLNTILDYDRILVL-DQGRVCEFDTPAA 1459

Query: 693  LY 694
            LY
Sbjct: 1460 LY 1461

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 101/214 (47%), Gaps = 26/214 (12%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F +++  I  G  V + G  G GKS++   L  F     G       DI K  T  L  +
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGG-------DIYKDGTMLLCGY 655

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRV--VSKQCFCHGFITKFPDGYDTVIGP 601
                  P + + T+RDNI +G  Y    +E R   + + C     +   P G  T IG 
Sbjct: 656 -------PWIQNATVRDNILFGSPY----NEARYNEIIRVCSLQADLELLPAGDRTEIGE 704

Query: 602 RGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTI 659
           RG +LSGGQ+ RI +ARA+ KK  I + D+  SA+D      I     +G L  S   T 
Sbjct: 705 RGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TR 761

Query: 660 ISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKL 693
           +   H+LS I R+  +I +  DGS V+VG  ++L
Sbjct: 762 VLATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 135/533 (25%), Positives = 231/533 (43%), Gaps = 81/533 (15%)

Query: 223 LRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGM 282
           L  + +K  +H  + F D   +G +++RF  D   +   +T+++               M
Sbjct: 482 LNLKAVKGILHTPLSFMDTTPLGRILNRFTKDTDSMDNELTEDIR-------------LM 528

Query: 283 MFHISSTLTSVMLLF--------APPLLVGAFIY-----------GKKISAISRQLQQSS 323
           MF + + +  +++          A P L+  F+             K++ A+ R    ++
Sbjct: 529 MFQLGNIIGVIVMCIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNN 588

Query: 324 GNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGD 383
            N      E L G+ TI+++ ++ + + + +  I ++   G               I  D
Sbjct: 589 LN------EVLGGLDTIRAYRSQDRFLVKSDFLINKMNEAG----YMVAALQRWVAIFLD 638

Query: 384 MSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMK---GAGAASR 440
           M  VI  L    L +     I   +  +L T Y       L+T    L +   G  +A R
Sbjct: 639 MLAVIFALIITLLCVTRQFKISPSSTGVLLT-YVLQLPGLLNTVLRALTQAENGMNSAER 697

Query: 441 L----FELMDHKNSVRSNISHALT-PTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPG 494
           L     +L       R  +S     P +G+I+F  VSF+Y P+ P   + K+ S  I  G
Sbjct: 698 LVTYALDLPQEAEYRRPEMSPPENWPDRGEIKFEGVSFAYRPSLPP--VLKNFSLNIGSG 755

Query: 495 SNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLM 554
             + I G +G GKSTI S L R  +   G I IDN +I+      LR  L ++ Q+P L 
Sbjct: 756 EKIGICGRTGAGKSTIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLF 815

Query: 555 SGTIRDNI---------------TYGLSYTPT-MDEIRVVSKQCF-CHGFITKFPDGYDT 597
            GTI+ N+                 G +  P  ++E +         H  + KF    + 
Sbjct: 816 RGTIKKNLDPFGEKTDQELWESLVRGGAIAPEDIEETKAQQPDASGSHSKMHKF--HLEQ 873

Query: 598 VIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKEL 657
            +   G + S G++Q +A+ RAL++  +ILILDEATS++D E++  I   +  +    + 
Sbjct: 874 KVEEEGGNFSLGEKQLLALTRALVRNSRILILDEATSSVDYETDDKIQSRI--VEAFGDC 931

Query: 658 TIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR--NEESELFKLLNEK 708
           TI+ IAHRL+TI   + I+V+       EV +FD  +    +E  +FK + E+
Sbjct: 932 TILCIAHRLNTILNYDRILVLEQG----EVAEFDTPWNLFTKEDGIFKSMCER 980

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 128/246 (52%), Gaps = 27/246 (10%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F++++F I+ G  + + GP G GK+++ S +  F   + GS+ ++   +S          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
            G     P + + T+RDNI +G  Y     + R V K C     +   P G  T IG RG
Sbjct: 156 CGY----PWIQNATVRDNIIFGSPYEKA--KYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGTLMRSKELTIISI 662
            +LSGGQ+ RI +AR + K   I + D+  SA+D    +  ++  L  L+  K  T I  
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK--TRILA 267

Query: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLL------NEKDHDLVSKS 716
            H+L+ I ++  +IV+GNDGS   +G +++L ++  S+L KLL      +E+D +   ++
Sbjct: 268 THQLALIEKATRLIVLGNDGSFT-IGTYEELQKS-NSQLKKLLQFTSDKSEEDDNDQKQN 325

Query: 717 ENTSDI 722
           EN  ++
Sbjct: 326 ENDKEV 331

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 141/262 (53%), Gaps = 29/262 (11%)

Query: 459  LTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFY 518
            + P  GKI+F+D +F Y       I K+ +  ++ G  + I G +G GKSTI + L R  
Sbjct: 795  IWPENGKIQFKDANFRYKEGLP-LILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLD 853

Query: 519  DPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSY--TPTMDEIR 576
            +   G+I ID+ DIS      LR++L ++ Q+P L  GTIR N+    SY    T+ E  
Sbjct: 854  ELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLD-PFSYFDDATLWEAM 912

Query: 577  VVS----KQCFCH--------GFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624
            ++S    +  F H          +TKF       +   G + S G++Q +A  RA+I   
Sbjct: 913  ILSGFIDRDTFGHFSEKPVNNKELTKFH--LTAHVEEDGTNYSLGEKQLLAFTRAIIHHS 970

Query: 625  KILILDEATSALDVESEGAINYTLGTLMRSKEL---TIISIAHRLSTIRRSENIIVVGND 681
            K+++LDEA+S++D E++  I     TL+ SK+    TI+ IAHRL+TI + + I+V+ + 
Sbjct: 971  KVVVLDEASSSVDYETDAKIQ----TLI-SKQFSHNTILCIAHRLNTILKYDRILVL-DH 1024

Query: 682  GSVVEVGKFDKLYRNEESELFK 703
            G+++       L+ N  +ELF+
Sbjct: 1025 GNIIGFENPRVLFEN--NELFR 1044

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 126/278 (45%), Gaps = 45/278 (16%)

Query: 446 DHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPS---------NQI------------F 484
           +H + +   +      T+  I+F + SF + T            NQI            F
Sbjct: 146 NHNDFLLETMPSNTFDTRLSIKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNGF 205

Query: 485 KHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILID-NHDISKFTTKSLRRH 543
            +++F+I  G  + I GP G GK+++   +        G+I ID N  +  +        
Sbjct: 206 NNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEIDGNLQLCGY-------- 256

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
                  P + + T+RDNI +G  Y    ++   V + C     +  F     T IG  G
Sbjct: 257 -------PWVQNTTVRDNIIFGSKYEK--EKFDHVIRICALTEDLENFSGKDLTEIGELG 307

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIIS 661
            +LSGGQ+ RI +ARA+ K   I + D+  SA+D      I  N  LG L  S +   I 
Sbjct: 308 ITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL--SGKTXXIL 365

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEES 699
             H+LS I++++ I+V+GND S  E+G + +L ++ ++
Sbjct: 366 ATHQLSLIKKADRIVVLGNDNS-FEIGPYKELIQSNKT 402

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 140/587 (23%), Positives = 242/587 (41%), Gaps = 72/587 (12%)

Query: 186  SITQFVGIFAGALVVGATANFGR-VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            ++  FVG++A   ++ A  N  R +V+L     R   +L   +    ++  + FF+   +
Sbjct: 1012 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1071

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKA-------IICGGVGMGMMFHISSTLTSVMLLF 297
            G +I+RF  D   V   +    S  F++       +I  G  M   F           +F
Sbjct: 1072 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFF-----------VF 1120

Query: 298  APPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKK----- 348
               L+V  F Y       SR+L++    +   +  +  E L G   I ++   K+     
Sbjct: 1121 NIFLIVIYFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKRFSYFN 1180

Query: 349  -EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDL 407
             E  ++N      F    R             +L        LL  + +     L+ G +
Sbjct: 1181 FESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATG-----LLSLSTIGTSKQLTAGMV 1235

Query: 408  TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS----HALTPTQ 463
               M Y+    +S+  +     ++     +  R+ E  +        I         P  
Sbjct: 1236 GLLMSYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAH 1295

Query: 464  GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYG 523
            G I+F D S  Y  +  + +   ++  IEP   + IVG +G GKST+T  L R  +   G
Sbjct: 1296 GSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDG 1354

Query: 524  SILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE-----IRVV 578
             I+ID  DIS      LR +L ++ Q+     GTIR N+     +    DE     I   
Sbjct: 1355 KIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLD---PFDQHSDEELWKAIEAS 1411

Query: 579  SKQCFCHGFITKFPDGYDTV---------------IGPRGASLSGGQRQRIAIARALIKK 623
              +      I+   D  ++                I   G++LS GQRQ + ++RAL+  
Sbjct: 1412 HLKPHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNH 1471

Query: 624  PKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGS 683
             KIL+LDEAT+++D+E++  I  T+      +  TI++IAHR+ T+   + I+V+ + G 
Sbjct: 1472 SKILVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGE 1528

Query: 684  VVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKND 730
            V E    D L  N+ S  + L  +  +  ++K+     +P ++ KND
Sbjct: 1529 VREFDSPDTLLENKNSIFYNLCEKGGY--LNKA-----LPTNNTKND 1568

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 130/545 (23%), Positives = 245/545 (44%), Gaps = 86/545 (15%)

Query: 271 KAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA 330
           +A+I G V M +M  I++ L+                  KK+ +++++  +      R  
Sbjct: 430 EAVIGGIVTMAIMIPINAYLS------------------KKVKSLNKEQMKYKDIRIRTL 471

Query: 331 EEQLNGIRTIKSFVAEKKEIRRY----NDAIRQLFY-VGKREXXXXXXXXXXXXILGDMS 385
            E LN I++IK +  EK  ++R     ND   + F  +G               ++   S
Sbjct: 472 TEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKIGIVSNCIFFAWNCVPIMVTCSS 531

Query: 386 FVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM 445
           F+I  L  + + L   +    L  F +  +    +++ + +  + +++ + +  RL   +
Sbjct: 532 FIIFAL-TSGMALTPDIVFPALALFNILND----AIYSVPSTITNIIEVSVSLGRLKNFL 586

Query: 446 DHKNSVRSNISHALTPTQGK---IEFRDVSFSY---------------PTRPSNQI-FKH 486
             +   RS I  +     G    +E  + +F +                T  + Q+ FK+
Sbjct: 587 ATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKNLVSSENGDEESTIDNTQVAFKN 646

Query: 487 MS-FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR--H 543
           ++ F ++ GS  CIVG  G GK+T+   +L       G +   +        K + R   
Sbjct: 647 VNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLIIRGNS 699

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
           +    Q+  +M+ ++++NI +G  Y      + +  + C     +   PDG +T++G +G
Sbjct: 700 IAYCPQQAWIMNSSVKENILFGHKYDEHYYNLTI--EACQLTEDLKMLPDGDETIVGEKG 757

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGT---LMRSKELTI 659
            SLSGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  I   L     L++SK  TI
Sbjct: 758 ISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--TI 815

Query: 660 ISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR-NEESELFKLLNEKDHDL------ 712
           I   + +S ++ S+ I  + N   ++E G +D +   +E+S+L  L+NE D+D       
Sbjct: 816 ILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNNSKE 874

Query: 713 -VSK----SENTSDIPP---DSPKNDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNS 764
            VS+    SE TSD+ P   +  +NDD +     +AE   +   K  +  L   +   + 
Sbjct: 875 EVSEERKTSEETSDVVPIDDNLIENDDDN-----LAESTVAYTGKEQRKALEISSRKASM 929

Query: 765 STLRP 769
           +TL+P
Sbjct: 930 ATLKP 934

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 140/587 (23%), Positives = 242/587 (41%), Gaps = 72/587 (12%)

Query: 186  SITQFVGIFAGALVVGATANFGR-VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244
            ++  FVG++A   ++ A  N  R +V+L     R   +L   +    ++  + FF+   +
Sbjct: 1040 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1099

Query: 245  GDLISRFGSDAYVVSRSMTQNVSDGFKA-------IICGGVGMGMMFHISSTLTSVMLLF 297
            G +I+RF  D   V   +    S  F++       +I  G  M   F           +F
Sbjct: 1100 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFF-----------VF 1148

Query: 298  APPLLVGAFIYGKKISAISRQLQQ----SSGNLTRVAEEQLNGIRTIKSFVAEKK----- 348
               L+V  F Y       SR+L++    +   +  +  E L G   I ++   K+     
Sbjct: 1149 NIFLIVIYFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKRFSYFN 1208

Query: 349  -EIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDL 407
             E  ++N      F    R             +L        LL  + +     L+ G +
Sbjct: 1209 FESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATG-----LLSLSTIGTSKQLTAGMV 1263

Query: 408  TAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS----HALTPTQ 463
               M Y+    +S+  +     ++     +  R+ E  +        I         P  
Sbjct: 1264 GLLMSYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAH 1323

Query: 464  GKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYG 523
            G I+F D S  Y  +  + +   ++  IEP   + IVG +G GKST+T  L R  +   G
Sbjct: 1324 GSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDG 1382

Query: 524  SILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDE-----IRVV 578
             I+ID  DIS      LR +L ++ Q+     GTIR N+     +    DE     I   
Sbjct: 1383 KIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLD---PFDQHSDEELWKAIEAS 1439

Query: 579  SKQCFCHGFITKFPDGYDTV---------------IGPRGASLSGGQRQRIAIARALIKK 623
              +      I+   D  ++                I   G++LS GQRQ + ++RAL+  
Sbjct: 1440 HLKPHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNH 1499

Query: 624  PKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGS 683
             KIL+LDEAT+++D+E++  I  T+      +  TI++IAHR+ T+   + I+V+ + G 
Sbjct: 1500 SKILVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGE 1556

Query: 684  VVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKND 730
            V E    D L  N+ S  + L  +  +  ++K+     +P ++ KND
Sbjct: 1557 VREFDSPDTLLENKNSIFYNLCEKGGY--LNKA-----LPTNNTKND 1596

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 130/545 (23%), Positives = 245/545 (44%), Gaps = 86/545 (15%)

Query: 271 KAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVA 330
           +A+I G V M +M  I++ L+                  KK+ +++++  +      R  
Sbjct: 458 EAVIGGIVTMAIMIPINAYLS------------------KKVKSLNKEQMKYKDIRIRTL 499

Query: 331 EEQLNGIRTIKSFVAEKKEIRRY----NDAIRQLFY-VGKREXXXXXXXXXXXXILGDMS 385
            E LN I++IK +  EK  ++R     ND   + F  +G               ++   S
Sbjct: 500 TEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKIGIVSNCIFFAWNCVPIMVTCSS 559

Query: 386 FVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELM 445
           F+I  L  + + L   +    L  F +  +    +++ + +  + +++ + +  RL   +
Sbjct: 560 FIIFAL-TSGMALTPDIVFPALALFNILND----AIYSVPSTITNIIEVSVSLGRLKNFL 614

Query: 446 DHKNSVRSNISHALTPTQGK---IEFRDVSFSY---------------PTRPSNQI-FKH 486
             +   RS I  +     G    +E  + +F +                T  + Q+ FK+
Sbjct: 615 ATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKNLVSSENGDEESTIDNTQVAFKN 674

Query: 487 MS-FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR--H 543
           ++ F ++ GS  CIVG  G GK+T+   +L       G +   +        K + R   
Sbjct: 675 VNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLIIRGNS 727

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
           +    Q+  +M+ ++++NI +G  Y      + +  + C     +   PDG +T++G +G
Sbjct: 728 IAYCPQQAWIMNSSVKENILFGHKYDEHYYNLTI--EACQLTEDLKMLPDGDETIVGEKG 785

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGT---LMRSKELTI 659
            SLSGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  I   L     L++SK  TI
Sbjct: 786 ISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--TI 843

Query: 660 ISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR-NEESELFKLLNEKDHDL------ 712
           I   + +S ++ S+ I  + N   ++E G +D +   +E+S+L  L+NE D+D       
Sbjct: 844 ILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNNSKE 902

Query: 713 -VSK----SENTSDIPP---DSPKNDDASGLEHLVAEDVASINDKVVKNVLNDITHDKNS 764
            VS+    SE TSD+ P   +  +NDD +     +AE   +   K  +  L   +   + 
Sbjct: 903 EVSEERKTSEETSDVVPIDDNLIENDDDN-----LAESTVAYTGKEQRKALEISSRKASM 957

Query: 765 STLRP 769
           +TL+P
Sbjct: 958 ATLKP 962

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 127/517 (24%), Positives = 227/517 (43%), Gaps = 73/517 (14%)

Query: 207  GRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNV 266
            G+  LL  IG R    L  Q + R +H  + F +   +G +++RF  D    + S+   +
Sbjct: 857  GQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMESTPMGRIMNRFTKD----TESLDNQI 912

Query: 267  SDGFKAII---CGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSS 323
             D  + ++   C  VG+ ++  I     ++ +   P L +  F+      + +R++++  
Sbjct: 913  LDNLRFVVYQACTIVGISVLCIIYLPWFAIAI---PGLGLILFVACSHYQSSAREIKRLE 969

Query: 324  GNLTRVAEEQLN----GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXX 379
                      LN    G+ TI+++ AE++   + +  I +                    
Sbjct: 970  AVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYLIDKTNEASYLYTAVQRWINIVIN 1029

Query: 380  ILGDMSFVIVL----------LYGAN--LVLQGALSIGDLT----AFMLYTEYTGSSVFG 423
            ++G +SF +++          L GA+  +VL   L I DL       +  TE   +SV  
Sbjct: 1030 LVG-ISFTLIVSLLCVTKVFNLSGASTGVVLSYVLLIPDLLNNTLTMVTQTENDMNSVER 1088

Query: 424  LSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSY-PTRPSNQ 482
            L T+ +EL + A           H   V S       P  G+I+F +V +++    P+  
Sbjct: 1089 LVTYATELPQEAS----------HGEEVPSKT----WPENGEIKFENVRYTHRDGLPA-- 1132

Query: 483  IFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR 542
            +    +  I  G  V I G +G GKST+   L R  +   G ++ID+ D+SK    +LR 
Sbjct: 1133 VLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVESGRVMIDDVDVSKLNLTALRS 1192

Query: 543  HLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFC------------------ 584
             L ++ Q+P L  G++R N+     Y    D ++    +C                    
Sbjct: 1193 RLAIIPQDPVLFQGSVRHNLDPFGEYDD--DVLKNALMRCTVGKFNKTGNESTEGIDTDA 1250

Query: 585  -HGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 643
             +G + KF    D  +   G + S G+RQ +A+ARALI+   IL+LDEAT+A+D  ++  
Sbjct: 1251 DNGLVGKFR--LDQDVEENGCNFSVGERQVLALARALIRNSSILVLDEATAAVDAATDAH 1308

Query: 644  INYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGN 680
            +   +    + +  T++ +AHRL TI   + I+V+ N
Sbjct: 1309 VQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVLEN 1343

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 111/479 (23%), Positives = 208/479 (43%), Gaps = 69/479 (14%)

Query: 277 GVGMGMMF-HISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335
           G+ +G++  ++     S + LF   ++V  F++G  +  +   + Q +     +  E LN
Sbjct: 313 GICLGLLIKNLGGIAMSGVGLFFVTIIVVIFLFGI-VMKMRLNINQVTDQRVSILREVLN 371

Query: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI-----VL 390
            I+ +K +  E+     Y  +I++   +   E            ++  ++F +     ++
Sbjct: 372 NIKMVKLYCWEQA----YEKSIKK---IRSLETSKLTRMEILKNVIFSVTFSLPNICSLM 424

Query: 391 LYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAG-----AASRLFELM 445
            + A   + G L      A  +++  +   +  L +FY  L  G       +  R  E +
Sbjct: 425 TFLALFKIHGGLK----NAATIFSSLSLFKILSLLSFYIPLSLGTAIDIVTSLDRFQEFL 480

Query: 446 DHKNS-----VRSNISHALTPTQGKIEFRDVSFSYPTRPSNQI-------FKHMSFTIEP 493
           + + S     +R   S         I+    SF + T   +         F  ++F I  
Sbjct: 481 EAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNFEIMK 540

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGS---ILIDNHDISKFTTKSLRRHLGVVQQE 550
           G  + IVGP G GK+++ + +     P YG+   + +D   +S                 
Sbjct: 541 GELIIIVGPIGSGKTSLLNAICGLM-PQYGNEGELEVDGSLVS--------------CGY 585

Query: 551 PTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYD-TVIGPRGASLSGG 609
           P + + T+RDNI +G  Y  +  + + V + C     + K    YD T IG RG +LSGG
Sbjct: 586 PWIQNTTVRDNILFGSKYDES--KFKRVIRMCSLEEDLEKLS-AYDMTEIGERGVTLSGG 642

Query: 610 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRS-KELTIISIAHRLST 668
           Q+ RI +AR+L K+  I + D+  SA+D     +I      LM   K  T +   H+LS 
Sbjct: 643 QKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSI--MKECLMEGLKNKTRVLATHQLSL 700

Query: 669 IRRSENIIVVGNDGSVVEVGKFDKLYRNEES--------ELFKLLNEKDHDLVSKSENT 719
           I +++ +IV+GNDG   ++G+++ L +  E+        +L + + EK+  +  K+E T
Sbjct: 701 IGKADQLIVLGNDGK-FDMGRYEDLIKTNETLINLMQYAKLQEEIQEKEEVIKDKNEKT 758

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 134/524 (25%), Positives = 219/524 (41%), Gaps = 54/524 (10%)

Query: 207  GRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNV 266
            G+  LL  +G      L  Q + + +H  + F D N +G +++RF  D   +   +T+N+
Sbjct: 960  GQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDTNPLGRILNRFTKDTDALDNELTENL 1019

Query: 267  SDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYG----------KKISAIS 316
                  I    +G+G M  I     ++ +   P LL+   +            K++ AI 
Sbjct: 1020 RLAMSQI-ANIIGVGAMCIIYLPWFAIAI---PFLLLIFLLIADHYQSTGREVKRLEAIQ 1075

Query: 317  RQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREXXXXXXXXX 376
            R    ++ N      E L G+ TIK++ A+ +       A +  F + K           
Sbjct: 1076 RSFVYNNLN------EMLTGMDTIKAYNAQDRF------ATKSEFLIDKMNEAAYISIAV 1123

Query: 377  XXX--ILGDM-----SFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVF-GLSTFY 428
                 I  D+     + +I LL             G L  ++L      ++V   L+   
Sbjct: 1124 QRWAGIFLDLVAVAFALIITLLCVTRQFHISGADTGVLLTYVLQLPGLLNTVLRALTQTE 1183

Query: 429  SELMKGAGAASRLFELMDHKNSVRSNISHAL-TPTQGKIEFRDVSFSY-PTRPSNQIFKH 486
            +++       S   +L       +   S  +  P  G I F +++F+Y P  P   I K+
Sbjct: 1184 NDMNSTERLVSYATQLPQEAQYRKPECSPPIDWPQNGHIVFENINFAYRPGLPI--ILKN 1241

Query: 487  MSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGV 546
             +  I+P   + I G +G GKSTI + L R  +   G I+ID+ DIS      LR  L +
Sbjct: 1242 FNLIIKPNEKIGICGRTGAGKSTIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAI 1301

Query: 547  VQQEPTLMSGTIRDNITYGLSYTPTM-------------DEIRVVSKQCFCHGFITKFPD 593
            + Q+P L  G IR N+     Y   +              E+  V  Q            
Sbjct: 1302 IPQDPVLFRGNIRRNLDPFDEYQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKNLHKF 1361

Query: 594  GYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMR 653
              +  +   G + S G+RQ +A+ RAL+++ KILILDEATS++D E++  I   + T   
Sbjct: 1362 HLNQSVDEDGNNFSLGERQVLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF- 1420

Query: 654  SKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNE 697
                TI+ IAHRL TI   + I+V+   G V E      L+ N+
Sbjct: 1421 -NHCTILCIAHRLKTILNYDRILVL-EKGEVAEFDTPWNLFNND 1462

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 103/220 (46%), Gaps = 21/220 (9%)

Query: 483 IFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR 542
           +  +++FTI  G  V + GP G GK+++   L    +   G +   NH            
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEM---NHSGDLLLC----- 675

Query: 543 HLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPR 602
             G+    P + + TIRDNI +G  Y PT    + V   C     +   P    T +G R
Sbjct: 676 --GI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 603 GASLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGTLMRSKELTIIS 661
           G +LSGGQ+ RI++ARA+ K   I + D+  SA+D       ++Y +   +  K  T I 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 662 IAHRLSTIRRSENIIVVGN--DGSVVEVGKFDKLYRNEES 699
             H+LS + +++ IIV+    D    E+G F +L +   +
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKELIKTNST 825

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
           Anc_8.303 YDR135C
          Length = 1546

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 118/491 (24%), Positives = 222/491 (45%), Gaps = 54/491 (10%)

Query: 284 FHISSTLTSVMLLFAPPLLVGAFIY------GKKISAISRQLQQ----SSGNLTRVAEEQ 333
           F I+  L S+  L    + +G FI          +  I ++LQ+    +    TR+  E 
Sbjct: 415 FQITLCLVSLYKLLGNSMWIGVFILIFMMPINSYLMRIQKKLQKIQMKNKDERTRLISEI 474

Query: 334 LNGIRTIKSFVAE-----KKEIRRYNDAIRQLFYVGKREXXXXXXXXXXXXILGDMSFVI 388
           LN I+++K +  E     K E  R    ++ L  +G               ++   +F  
Sbjct: 475 LNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQFNIVPFLVSCSTFA- 533

Query: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448
           V ++  +  L   L    LT F L +    +    +++F    ++ + + +RLF  + ++
Sbjct: 534 VFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRLFSFLTNE 589

Query: 449 NSVRSNISHAL-TPTQGKIEFR---DVSFSYPTRPSNQI-FKHMSFTIEPGSNVCIVGPS 503
              +  +         G +  +   D +F +  +P  ++  K+++F    G   CIVG  
Sbjct: 590 ELQKDAVQRLPNVKNTGDVSIKLGDDATFLWKRKPEYKVALKNINFQARKGELTCIVGKV 649

Query: 504 GKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNIT 563
           G GKS +             SIL D   +  F T  +   +  V Q P +M+GT+++NI 
Sbjct: 650 GSGKSALIQ-----------SILGDLFRVKGFAT--VHGDVAYVSQVPWIMNGTVKENIL 696

Query: 564 YGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
           +G  +     E  +  K C     ++  PDG  T++G +G SLSGGQ+ R+++ARA+  +
Sbjct: 697 FGHKFDKKFYEKTI--KACALTIDLSILPDGDSTLVGEKGISLSGGQKARLSLARAVYAR 754

Query: 624 PKILILDEATSALDVE-SEGAINYTLGT--LMRSKELTIISIAHRLSTIRRSENIIVVGN 680
               + D+  +A+D    +  I + LG   L+ SK  T +   ++++ +  ++ I ++ N
Sbjct: 755 ADTYLFDDPLAAVDEHVGKHLIEHVLGPNGLLHSK--TKVLATNKITVLNIADYITLLDN 812

Query: 681 DGSVVEVGKFDKLYRNEESELFKLLNE--KDHD-----LVSKSENTSDIPPDSPKNDDAS 733
            G +++ GK++++  +  S L KL+NE  K H+     +VS S  + +  P+ P  D+  
Sbjct: 813 -GEIIQRGKYEEVTSDPGSPLCKLINEYGKKHESTPGTMVSSSM-SKEPSPNVPLEDELR 870

Query: 734 GLEHLVAEDVA 744
            L  L   D+A
Sbjct: 871 ELHKLDDLDLA 881

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 73/115 (63%), Gaps = 3/115 (2%)

Query: 593  DGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLM 652
            +  +T +   G++LS GQRQ + +ARAL+    IL+LDEAT+A+DVE++  I  T+ +  
Sbjct: 1424 NALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETIRSAF 1483

Query: 653  RSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            +++  TI++IAHRL+TI  S+ I+V+ + G + E      L  +++S  + L  +
Sbjct: 1484 KNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGDKDSLFYSLCEQ 1535

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 87/399 (21%), Positives = 160/399 (40%), Gaps = 32/399 (8%)

Query: 189  QFVGIFAGALVVGATANFGRVVLLKIIGERLVSR-LRSQVIKRTMHHDIEFFDRNKVGDL 247
            +++GI+       A +   + V+L +      S+ L SQ++   +   + FF+   +G +
Sbjct: 974  RYLGIYFALGFSSALSQLLQTVILWVFCTIHGSKILHSQMLASVLRAPMSFFETTPIGRI 1033

Query: 248  ISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFI 307
            ++RF +D Y V   + +  S  F       V +     +    T   + F  P+      
Sbjct: 1034 LNRFSNDMYKVDELLGRTFSQFFS----NAVKVTFTLVVICVSTWQFIFFIVPMSFLYIY 1089

Query: 308  YGKKISAISRQLQQSSGNLTRVA-----EEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFY 362
            Y +     SR+L++   ++TR       +E L GI TI+ +  E + I      +     
Sbjct: 1090 YQQYYMRTSRELRRLD-SVTRSPTISHFQETLGGISTIRGYSQENRFIHINQQRVDNNMS 1148

Query: 363  VGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFML-----YTEYT 417
                              LG      V++ GA+ +    LS G++T  M+     Y    
Sbjct: 1149 AYYPSINCNRWLAFRLEFLGS-----VIILGASTLGIYRLSQGNMTPGMIGLSLSYALQI 1203

Query: 418  GSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHAL----TPTQGKIEFRDVSF 473
              S+  +     E+     +  R+ E  +  +   S +         P  G ++F     
Sbjct: 1204 TQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPSIVEDKRPDVNWPQDGAVKFNH--- 1260

Query: 474  SYPTRPS---NQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH 530
             Y TR     + + K ++  I+P   + IVG +G GKS++T  L R  + + G+I +D  
Sbjct: 1261 -YYTRYRADLDYVLKDITLDIKPREKIGIVGRTGAGKSSLTLALFRIIEASEGNINVDGI 1319

Query: 531  DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569
            +  +     LR  L ++ Q+  +  GT+RDNI     YT
Sbjct: 1320 NTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNIDPTGQYT 1358

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 118/241 (48%), Gaps = 26/241 (10%)

Query: 484 FKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRH 543
           F  +SF ++ G  + I G  G GK+++ + L  F     G I        ++  + L   
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDI--------QYNGRML--- 638

Query: 544 LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRG 603
                  P + + TIRDNIT+G  Y   +   R V + C     ++  P G  T +G RG
Sbjct: 639 ---FCGAPWIQNATIRDNITFGSPYDENL--YREVMRVCSLDRDMSVLPAGDKTEVGERG 693

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIIS 661
            +LSGGQ+ RI +AR + K   I + D+  SA+D     +I  +  LG L    + T I 
Sbjct: 694 ITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKTRIL 750

Query: 662 IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKL-YRNEE-SELFKLLNEKDHDLVSKSENT 719
             H++S   ++  +I +G DGS  ++G  D+L  RN + + L KL ++ + +  SK +N 
Sbjct: 751 ATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFANLMKLASQTESE--SKDDNI 807

Query: 720 S 720
           S
Sbjct: 808 S 808

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 95/408 (23%), Positives = 180/408 (44%), Gaps = 60/408 (14%)

Query: 186  SITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVG 245
            S T ++G++   ++    +   +  L+  +G R    +  Q + R +H  + F D   +G
Sbjct: 917  SDTFYMGMYFFFVMANYLSTNIQFSLVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPLG 976

Query: 246  DLISRFGSDAYVVSRSMTQNVSD-GFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304
             +++RF  D  ++   +T+++    ++  +  GV +  + ++     +V LL    +LV 
Sbjct: 977  RILNRFTKDTDILDNELTESLRMFSYQFTVIWGVIIMSIIYLPWFAVAVPLLVVVFILVS 1036

Query: 305  AFIYG-----KKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQ 359
                      K++ A+ R    ++ N      E ++G+ TIK++ AE + +++ +  I +
Sbjct: 1037 DHYQCSAREIKRLEAVQRSFVLNNFN------EVISGVDTIKAYHAEARFLKKSDILIDR 1090

Query: 360  L------FYVGKREXXXXXXXXXXXXILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLY 413
            +       Y  +R             IL  M  V+  L  + L + G  +I   +  +L 
Sbjct: 1091 MNEMTFPLYASQR----------WVSILIGMIAVLFALIISILCVTGWFNISPASTGVLL 1140

Query: 414  TEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHA--------------- 458
            T      V  L   ++ L++       + +L +  NS    +S+A               
Sbjct: 1141 T-----YVLQLPNLFNTLLRA------MTQLENDMNSAERVLSYANSLPKEAPYRIPEMA 1189

Query: 459  ---LTPTQGKIEFRDVSFSY-PTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLL 514
                 P +G I F +V+ +Y P  P   + + +SF I  G  + I G +G GKSTIT+ L
Sbjct: 1190 PPKAWPERGAITFDNVALAYRPGLP--LVLQDVSFHISSGEKIGICGRTGAGKSTITNAL 1247

Query: 515  LRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNI 562
             R  + + GS+ ID  DI+     +LR  L ++ Q+P L  GTIR N+
Sbjct: 1248 YRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 67/108 (62%), Gaps = 4/108 (3%)

Query: 596  DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSK 655
            D  +   G++ S G+RQ +A+ARAL+++ KILILDEATS++D E++  I   +  +   +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARI--VQEFQ 1475

Query: 656  ELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFK 703
              TI+ +AHRL TI   + I+V+   G V E     +LY NE+  +F+
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLY-NEQGSIFR 1521

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 123/265 (46%), Gaps = 19/265 (7%)

Query: 444 LMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPS 503
           + D+ N   +     L  +  K  F D S  +    ++   K++S   +  S   I+GP+
Sbjct: 629 IQDYLNESETRKYEILEQSNTKFGFEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPT 688

Query: 504 GKGKSTITSLLL--------RFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMS 555
           G GKS++   LL        + Y P      +++ D  +     +   +    Q P L+S
Sbjct: 689 GSGKSSLLLGLLGELNLLSGKIYVPT-----VESRDDLEIGKDGMTNSMAYCSQTPWLIS 743

Query: 556 GTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIA 615
           GTI+DN+ +G  +     +   V K C     I     G  T +G  G SLSGGQ+QRIA
Sbjct: 744 GTIKDNVVFGEIFNK--QKFDDVMKSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIA 801

Query: 616 IARALIKKPKILILDEATSALDVESEGAI--NYTLGTLMRSKELTIISIAHRLSTIRRSE 673
           +ARA+    + LILD+  SA+D E+   I      G +M+ +  T I  +H +S + +  
Sbjct: 802 LARAIYSSSRYLILDDCLSAVDPETALYIYEECLCGPMMKGR--TCIITSHNISLVTKRA 859

Query: 674 NIIVVGNDGSVVEVGKFDKLYRNEE 698
           + +V+ + G V   GK   L ++ E
Sbjct: 860 DWLVILDRGEVKSQGKPSDLIKSNE 884

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 96/200 (48%), Gaps = 23/200 (11%)

Query: 493 PGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPT 552
           PGS++ I+GP+G GK++I  ++   + P Y          +   +    R L  + Q+P 
Sbjct: 600 PGSSMLILGPNGSGKTSIQRIIAEIW-PIYNK--------NGLLSVPAERELICIPQKPY 650

Query: 553 LMSG-TIRDNITYGLSYTPTMD------EIRVVSKQCFCHGFITKFPDG--YDTVIGPRG 603
            + G T R+ I Y +S     D      E+  V K+     ++ K   G  Y   +    
Sbjct: 651 FIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-YLLKRDKGWRYLDAVAEWK 709

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIA 663
             LSGG+RQR+  AR +  KPK ++LDEAT+A+  + E   +Y    L R +    I+I+
Sbjct: 710 DVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFNMLKRYR-FNFITIS 765

Query: 664 HRLSTIRRSENIIVVGNDGS 683
            R S I+  +  + +G D S
Sbjct: 766 QRPSLIKYHDLALEIGADES 785

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 103/205 (50%), Gaps = 25/205 (12%)

Query: 489 FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQ 548
           F    GS++ I+GP+G GKS+I  ++   + P Y      N  +SK T  +L   L V Q
Sbjct: 639 FLNSAGSSLLILGPNGCGKSSIQRIIAEIW-PIYNK----NGLLSKPTEANL---LCVPQ 690

Query: 549 QEPTLMSGTIRDNITYGLSYTPTMDE-------IRVVSKQCFCHGFITKFPDGY---DTV 598
           +      GT+RD I Y +S     D        ++V+ +      ++ K   G+   DTV
Sbjct: 691 KPYFTRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKL--DYLLKRDKGWSYLDTV 748

Query: 599 IGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELT 658
              +   LSGG++QR+  AR +  KP+ ++LDEAT+A+  + E   +Y    L R +   
Sbjct: 749 SDWKDV-LSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFNVLKRYR-FN 803

Query: 659 IISIAHRLSTIRRSENIIVVGNDGS 683
            I+I+ R S I+  + ++ + +D S
Sbjct: 804 FITISQRPSLIKYHDLLLEISDDNS 828

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 97/190 (51%), Gaps = 14/190 (7%)

Query: 499 IVGPSGKGKSTITSLLLRFYDPNYGSI----LIDNHDISKFTTKSLRRHLGVVQQEPTLM 554
           + GP+G GKS +   LL       G I    L   H++       L   +    Q P ++
Sbjct: 724 VAGPTGAGKSLLLMSLLGETHLFKGEIHVPSLASKHEL-MIHGDGLTNSISYCSQIPWII 782

Query: 555 SGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRI 614
           + +I++NI +G  +   +     V + C     +    DG ++++G RG +LSGGQRQR+
Sbjct: 783 NDSIKNNILFGSEFN--LKRYNDVIRACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQRV 840

Query: 615 AIARALIKKPKILILDEATSALDVESEGAINYTL---GTLMRSKELTIISIAHRLS-TIR 670
           ++ARA+  K   +ILD+  SA+D +    I Y L   G LM+ +  T I ++H +   I+
Sbjct: 841 SLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPLMKGR--TCILVSHNVELVIK 897

Query: 671 RSENIIVVGN 680
           ++  ++++ N
Sbjct: 898 KAAYLLILDN 907

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 95/201 (47%), Gaps = 25/201 (12%)

Query: 488 SFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVV 547
           S  + PGS++ I+GP+  GKS+I  +L   + P Y          +   +      L  +
Sbjct: 592 SMLLGPGSSLLILGPNSCGKSSIQRILAEIW-PIYNK--------TGLVSIPAESDLMCI 642

Query: 548 QQEPTLMSG-TIRDNITYGLSYTPTMDE-------IRVVSKQCFCHGFITKFPDG--YDT 597
            Q P  + G T RD I Y +S     ++       +R++ +      ++ K  +G  Y  
Sbjct: 643 AQRPYFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKL--DYLLKRSEGLSYLD 700

Query: 598 VIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKEL 657
            +      LSGG++QR+  AR +  +PK L+LDEAT+A+ V+ E      L  ++R    
Sbjct: 701 FVADWKDILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDMED----YLFNMLRKCRF 756

Query: 658 TIISIAHRLSTIRRSENIIVV 678
             ISI+ R S I+  + ++ +
Sbjct: 757 NFISISQRPSLIKYHDYLLEI 777

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 93/199 (46%), Gaps = 21/199 (10%)

Query: 493 PGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPT 552
           PGS++ I+GP+G GK++I  ++   + P Y          +   +      L  V Q+P 
Sbjct: 599 PGSSMLILGPNGSGKTSIQRIIAEIW-PIYNK--------NGLLSIPPASDLFCVPQKPY 649

Query: 553 LMSG-TIRDNITYGLSYTPTMDEIRVVSKQCFCHG-----FITKFPDG--YDTVIGPRGA 604
            + G T R+ I Y +S     D      +     G     ++ K   G  Y   +     
Sbjct: 650 FIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDKGWRYLDAVAEWKD 709

Query: 605 SLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAH 664
            LSGG+RQRI  AR +  KP+ ++LDEAT+A+  + E   +Y  G L R +    I+I+ 
Sbjct: 710 VLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFGLLKRYR-FNFITISQ 765

Query: 665 RLSTIRRSENIIVVGNDGS 683
           R S I+  +  + +  DG+
Sbjct: 766 RPSLIKYHDLALDISTDGT 784

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 113/244 (46%), Gaps = 42/244 (17%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SF Y + PS  +++H++F ++  S + +VGP+G GKST+  ++     P  G +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQC-FC 584
               H             LGV  Q         +  + +        D+   +S+   F 
Sbjct: 453 SRHTH-----------VKLGVYSQHSQDQLDLTKSALEF------VRDKYSNISQDFQFW 495

Query: 585 HGFITKFP-DGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES--- 640
            G + ++   G    +  + A+LS GQR R+  A   +++P +L+LDE T+ LD+ +   
Sbjct: 496 RGQLGRYGLTGEGQTV--QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDS 553

Query: 641 -EGAINYTLGTLMRSKELTIISIAHRLSTIRR-SENIIVVGN------DGSVVEVGKFDK 692
              AIN   G         ++ ++H    + + +++I VV N      DGS+++    +K
Sbjct: 554 LADAINEFNG--------GVVVVSHDFRLLDKIAQDIFVVENKTATRWDGSILQYK--NK 603

Query: 693 LYRN 696
           L +N
Sbjct: 604 LAKN 607

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 28/35 (80%)

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 120/239 (50%), Gaps = 21/239 (8%)

Query: 462  TQGKIEFRDVSFSYPTRPSNQ-IFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYD- 519
            ++G   ++DV +  P + S + +   +S  ++PG    ++G SG GK+T+ ++L +  D 
Sbjct: 798  SKGVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGL-TALMGASGAGKTTLLNVLAQRMDF 856

Query: 520  --PNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSG-TIRDNITYGLSY-----TPT 571
               + G IL+D    +K   +  +R +G VQQ+       T+R+++ +          P 
Sbjct: 857  GIVSSGEILVD----AKPVDRKFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPD 912

Query: 572  MDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI-LD 630
             +++  V K     G      D  D V+G  G  L+  QR++++I   L+ KP +L+ LD
Sbjct: 913  AEKMEYVEKIIVVLGM----QDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLD 968

Query: 631  EATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRS-ENIIVVGNDGSVVEVG 688
            E TS LD +S  AI   L  L  + +  + +I    +T+  S + ++++ + GSVV  G
Sbjct: 969  EPTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWG 1027

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 16/113 (14%)

Query: 585 HGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 644
           H F TK   G D V G     +SGG+R+R++IA A+  +  +   D ++  LD  S  A 
Sbjct: 238 HTFNTKV--GNDFVRG-----VSGGERKRVSIAEAMAARGSVYCWDNSSRGLD--SSSAY 288

Query: 645 NY-----TLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDK 692
           +Y     T+  L++S  +  ++I      I R  + + V  DG  +  G  +K
Sbjct: 289 DYIKAIRTVSDLIKS--VAFVAIYQAGENIYRKFDKVTVLYDGRQIYYGTINK 339

>KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON} 
          Length = 1517

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 137/308 (44%), Gaps = 24/308 (7%)

Query: 462  TQGKIEFRDVSFSYPTRPSNQ-IFKHMSFTIEPGSNVCIVGPSGKGKST-ITSLLLRFYD 519
            ++G   ++DV ++ P     + +  H+S   +PG+   ++G SG GK+T + +L  R   
Sbjct: 860  SKGVFIWKDVCYTIPYDGGQRMLLDHVSGFCKPGTLTALMGESGAGKTTLLNTLAQRNVG 919

Query: 520  PNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSG-TIRDNITYGLSY---TPTMDEI 575
               G +L++ H I      S  R  G VQQ+   +S  T+R+++ +           D+ 
Sbjct: 920  IITGDMLVNGHPID----TSFERRTGYVQQQDIHISELTVRESLQFSARMRRPQSVTDKE 975

Query: 576  RVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI-LDEATS 634
            ++   +   H  +    D  + ++G  G+ L+  QR++++I   L+ KP +L+ LDE TS
Sbjct: 976  KMTYVEKIIH--VLDMEDYAEALVGTVGSGLNVEQRKKLSIGVELVAKPDLLLFLDEPTS 1033

Query: 635  ALDVESEGAINYTLGTLMRSKELTIISIAHRLSTI-RRSENIIVVGNDGSVVEVGKFDKL 693
             LD +S  AI   L  L  S +  + +I    +T+  + + ++++   G  V  G   + 
Sbjct: 1034 GLDSQSSWAIVQLLKKLAHSGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGNIGE- 1092

Query: 694  YRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEHLVAEDVASI--NDKVV 751
                 S L            S SEN    P +       +G    V ED   I  N    
Sbjct: 1093 ---NSSLLLDYFERNGARQCSSSEN----PAEYILEAIGAGATATVKEDWNEIWRNSPES 1145

Query: 752  KNVLNDIT 759
            +N  N+IT
Sbjct: 1146 RNSQNEIT 1153

 Score = 35.8 bits (81), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 595 YDTVIGP---RGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTL 651
           Y T +G    RG  +SGG+R+R++IA AL     + + D AT  LD  +  A+ Y     
Sbjct: 306 YHTKVGNDFVRG--VSGGERKRVSIAEALAANGSVYLWDNATRGLDAST--ALEYAKAIR 361

Query: 652 MRSKEL---TIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFD 691
           + +  L     ++I      I  + + + V + G  +  GK +
Sbjct: 362 IMTNLLGSTAFVTIYQASENIYETFDKVTVLHSGRQIYFGKIE 404

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 111/235 (47%), Gaps = 42/235 (17%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SFSY  +P N +++H++F ++  S + +VGP+G GKST+  ++        G +
Sbjct: 393 LAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMT-------GEL 445

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGT---IRDNITYGLSYTPTMDEIRVVSKQC 582
           +  +  +S+ T   L  +    Q +  L       +RD       Y+    + +    Q 
Sbjct: 446 MSQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK------YSNISQDFQYWRGQL 499

Query: 583 FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES-- 640
             +G      +    ++G    +LS GQR R+  A   +++P +L+LDE T+ LD+ +  
Sbjct: 500 GRYGLTG---EAQTVLMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTID 552

Query: 641 --EGAINYTLGTLMRSKELTIISIAHRLSTIRR-SENIIVVGN------DGSVVE 686
               AIN   G         ++ ++H    + + +++I VV +      DGS++E
Sbjct: 553 SLADAINEFNG--------GVVVVSHDFRLLDKIAKDIFVVEHKTATRWDGSILE 599

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 31/44 (70%)

Query: 597 TVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           T I  +   +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 218 TTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 114/241 (47%), Gaps = 36/241 (14%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SF+Y  +P N +++H++F ++  S V +VGP+G GKST+  ++        G +
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMT-------GEL 442

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGT---IRDNITYGLSYTPTMDEIRVVSKQC 582
              +  +S+ T   L  +    Q +  L       +RD       Y+    + +    Q 
Sbjct: 443 ATQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLEFVRDK------YSHISHDFQYWRGQL 496

Query: 583 FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 642
             +G      +G  + +    A+LS GQR R+  A   ++ P +L+LDE T+ LD+    
Sbjct: 497 GRYGLTG---EGQTSQM----ATLSEGQRSRVVFALLALQAPNVLLLDEPTNGLDI---- 545

Query: 643 AINYTLGTLMRSKELTIISIAHRLSTIRR-SENIIVVGN------DGSVVEVGKFDKLYR 695
           A   +L   +      ++ ++H    + + +++I VV N      DGS+++    +KL +
Sbjct: 546 ATIDSLADAINEFNGGVVVVSHDFRLLDKIAKDIFVVENKTATRWDGSILDYK--NKLAK 603

Query: 696 N 696
           N
Sbjct: 604 N 604

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 30/42 (71%)

Query: 599 IGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           I  +   +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 217 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 258

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 59/94 (62%), Gaps = 3/94 (3%)

Query: 614 IAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSE 673
           I +ARAL++  KIL++DEAT+++D E++  +  T+ T    +++TI++IAHRL TI   +
Sbjct: 2   ICLARALLRSTKILLIDEATASIDYEADAKLQETIQT--EFQDVTIVAIAHRLQTIIDYD 59

Query: 674 NIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707
            I+V+ + G V+E      L +NE    + +  E
Sbjct: 60  KILVL-DAGQVIEYDHPYTLLKNESGHFYDICKE 92

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 109/239 (45%), Gaps = 32/239 (13%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F ++SF+Y   P + ++++++F ++  S + +VGP+G GKST+  ++     P  G +
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITY-GLSYTPTMDEIRVVSKQCFC 584
               H             LGV  Q         +  + +    Y+    + +    Q   
Sbjct: 453 SRHTH-----------VKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLGR 501

Query: 585 HGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 644
           +G      DG    +G    +LS GQR R+  A   ++ P IL+LDE T+ LD+ +  ++
Sbjct: 502 YGLTG---DGQKAQMG----TLSEGQRSRVVFALLALQAPNILLLDEPTNGLDIPTIDSL 554

Query: 645 NYTLGTLMRSKELTIISIAHRLSTIRR-SENIIVVGN------DGSVVEVGKFDKLYRN 696
              + T        ++ ++H    + + +++I VV N      DGS++E    +KL +N
Sbjct: 555 AEAINTFNGG----VVVVSHDFRLLDKIAQDIFVVENKTAYRWDGSILEYK--NKLAKN 607

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 30/42 (71%)

Query: 599 IGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           I  +   +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 220 IQKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 131/293 (44%), Gaps = 36/293 (12%)

Query: 446  DHKNSVRSNISHALTPTQGKIEFRDVSFSYPTR-PSNQIFKHMSFTIEPGSNVCIVGPSG 504
            D  ++V + ++  +T ++    +R++ +    +  + +I  ++   ++PG+   ++G SG
Sbjct: 875  DDNDAVSNEVN--ITGSEAIFHWRNLCYDVQIKTETRRILNNVDGWVKPGTLTALMGASG 932

Query: 505  KGKSTITSLLLRFYDPNY--GSILIDNHDISKFTTKSLRRHLGVVQQEP-TLMSGTIRDN 561
             GK+T+   L          G + ID     K   +S  R +G  QQ+   L + T+R++
Sbjct: 933  AGKTTLLDCLAERVTMGVITGDVFIDG----KPRDESFPRSIGYCQQQDLHLKTATVRES 988

Query: 562  ITYGLSYTPTMDEIRVVSKQCFCHGFIT--KFPDGYDTVIGPRGASLSGGQRQRIAIARA 619
            + +  +Y     E+ +  K  +    I   +     D ++G  G  L+  QR+R+ I   
Sbjct: 989  LRFS-AYLRQPAEVSIAEKNAYVEDIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVE 1047

Query: 620  LIKKPKILI-LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVV 678
            L  KPK+L+ LDE TS LD ++  AI   +  L    +  + +I H+ S I   E     
Sbjct: 1048 LAAKPKLLVFLDEPTSGLDSQTAWAICQLMRKLCNQGQAILCTI-HQPSAILMQE----- 1101

Query: 679  GNDGSVVEVGKFDKLY---RNEESELFKLLNEKDHDLVS--KSENTSDIPPDS 726
                       FD+L    R  ++  F  L E  H ++   +S  +   PPD+
Sbjct: 1102 -----------FDRLLFMQRGGQTCYFGELGEGCHKMIDYFESHGSHKCPPDA 1143

 Score = 35.0 bits (79), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 81/181 (44%), Gaps = 25/181 (13%)

Query: 476 PTRPSN--QIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
           PT+  +  QI K M   ++PG  + ++G  G G    T+LL       +G  +  +  IS
Sbjct: 190 PTKEEDLFQILKPMDGCLKPGELLVVLGRPGSG---CTTLLKSITSNTHGFHVGKDSQIS 246

Query: 534 K--FTTKSLRRHL-GVV----QQEPTLMSGTIRDN-ITYGLSYTPTMDEIRVVSKQCFCH 585
              F+ K +++H  G V    + +  L   T+    IT     TP  + I+ VS++ F +
Sbjct: 247 YSGFSPKEIKKHYRGEVVYNAEADIHLPHLTVYQTLITVARLKTP-QNRIQGVSREEFAN 305

Query: 586 GFITKFPDGY------DTVIGP---RGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
                    Y      +T +G    RG  +SGG+R+R++IA   I   K    D AT  L
Sbjct: 306 HLAEVVMATYGLSHTRNTKVGNDLVRG--VSGGERKRVSIAEVAICGSKFQCWDNATRGL 363

Query: 637 D 637
           D
Sbjct: 364 D 364

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 113/244 (46%), Gaps = 42/244 (17%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SF Y + PS  +++H++F ++  S + +VGP+G GKST+  ++     P  G +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQC-FC 584
               H             LGV  Q         +  + +        D+   +S+   F 
Sbjct: 453 SRHTH-----------VKLGVYSQHSQDQLDLTKSALEF------VRDKYSNISQDFQFW 495

Query: 585 HGFITKFP-DGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES--- 640
            G + ++   G    +  + A+LS GQR R+  A   +++P +L+LDE T+ LD+ +   
Sbjct: 496 RGQLGRYGLTGEGQTV--QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDS 553

Query: 641 -EGAINYTLGTLMRSKELTIISIAHRLSTIRR-SENIIVVGN------DGSVVEVGKFDK 692
              AIN   G         ++ ++H    + + +++I VV +      DGS+++    +K
Sbjct: 554 LADAINEFNG--------GVVVVSHDFRLLDKIAQDIFVVEDKTATRWDGSILQYK--NK 603

Query: 693 LYRN 696
           L +N
Sbjct: 604 LAKN 607

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 28/35 (80%)

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 113/244 (46%), Gaps = 42/244 (17%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SF Y + PS  +++H++F ++  S + +VGP+G GKST+  ++     P  G +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQC-FC 584
               H             LGV  Q         +  + +        D+   +S+   F 
Sbjct: 453 SRHTH-----------VKLGVYSQHSQDQLDLTKSALEF------VRDKYSNISQDFQFW 495

Query: 585 HGFITKFP-DGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES--- 640
            G + ++   G    +  + A+LS GQR R+  A   +++P +L+LDE T+ LD+ +   
Sbjct: 496 RGQLGRYGLTGEGQTV--QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDS 553

Query: 641 -EGAINYTLGTLMRSKELTIISIAHRLSTIRR-SENIIVVGN------DGSVVEVGKFDK 692
              AIN   G         ++ ++H    + + +++I VV +      DGS+++    +K
Sbjct: 554 LADAINEFNG--------GVVVVSHDFRLLDKIAQDIFVVEDKTATRWDGSILQYK--NK 603

Query: 693 LYRN 696
           L +N
Sbjct: 604 LAKN 607

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 28/35 (80%)

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 101/212 (47%), Gaps = 35/212 (16%)

Query: 475 YPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTI---------TSLLLRFYDPNYGSI 525
           +  + + QI + ++   +PG    I+GPSG GKS++         +SLL++F+    GSI
Sbjct: 679 WLQKKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFHST--GSI 736

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSG-TIRDNITYG----LSYTPT------MDE 574
           L++ + ISK   KS+  +  V Q +  L++  T+R+   +     L Y  +      +DE
Sbjct: 737 LLNTNSISKEMFKSVCSY--VSQDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDE 794

Query: 575 IRVVSKQCFCHGFITKFPDGYDTVIGPRGAS-LSGGQRQRIAIARALIKKPKILILDEAT 633
           I +      C           +TVIG      +SGG+++R+ I   L+    IL+LDE T
Sbjct: 795 ILLALGLTHCE----------NTVIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPT 844

Query: 634 SALDVESEGAINYTLGTLMRSKELTIISIAHR 665
           S LD  +  AI   L  L      T+I   H+
Sbjct: 845 SGLDSFTSAAILEILENLCTEDGKTVIITIHQ 876

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 2/99 (2%)

Query: 593 DGYDTVIG-PRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTL 651
           D  +T++G  R   LSGG+++R+++A  L+  P  + LDE T+ LD  S   +  +L  L
Sbjct: 150 DCANTLVGDARNRGLSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVKSLKKL 209

Query: 652 MRSKELTIISIAHR-LSTIRRSENIIVVGNDGSVVEVGK 689
            R  + + I   H+  S I    + + + + G+VV  GK
Sbjct: 210 ARDGQKSFIMSVHQPRSDIMFLLDSVCILSKGNVVYCGK 248

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 108/233 (46%), Gaps = 41/233 (17%)

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
           GS++ I+GP+  GKS+I  +L   + P Y          +   +      L  V Q P  
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIW-PIYNK--------NGLLSTPPSHDLFCVPQRPYF 665

Query: 554 MSG-TIRDNITYGLSY-------------TPTMDEIRVVSKQCFCHGFITKFPDG--YDT 597
           + G T RD I Y ++Y                + E+R+         ++ K   G  Y  
Sbjct: 666 IQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRL--------DYLLKRDRGLNYFD 717

Query: 598 VIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKEL 657
            I      LSGG++QR+   R +  +P+ ++LDEAT+A+ V+ E      L T+++    
Sbjct: 718 AIADWKDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDH----LFTMLKRYRF 773

Query: 658 TIISIAHRLSTIRRSENIIVV--GNDGSVVEVGKFDKLYRNEESELFKLLNEK 708
             ISI+ R S I+  + ++ +  G D S+  +G  D+   + E+E+ + LN+K
Sbjct: 774 NFISISQRPSLIKYHDYLLELTNGTDWSLQALGS-DEAILSIENEI-ETLNQK 824

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 33/209 (15%)

Query: 487 MSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNY---GSILIDNHDISKFTTKSLRRH 543
           + F+  PGS++ I+GP+  GKS+I  ++   + P Y   G + I   D            
Sbjct: 676 LPFSYGPGSSLLILGPNSCGKSSIQRIIAEIW-PIYNKNGLMSIPAED-----------E 723

Query: 544 LGVVQQEPTLMSG-TIRDNITYGLSYTPTMDEIRVVSKQCFCH-------GFITKFPDGY 595
           L  + Q P    G T RD I Y +      D  R +  +            ++ K   G+
Sbjct: 724 LMCIPQRPYFSKGGTFRDQIIYPMGSDEFFD--RGLKDKLLVQILADVKLEYLLKRDKGW 781

Query: 596 ---DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLM 652
              D V   +   LSGG++QR+  AR L  KP+ +ILDEAT+A+ V+ E      L  ++
Sbjct: 782 SYFDAVFDWKDV-LSGGEKQRMNFARILFHKPRFVILDEATNAISVDMEDY----LFKML 836

Query: 653 RSKELTIISIAHRLSTIRRSENIIVVGND 681
           +      ISI+ R S ++  + ++ +  D
Sbjct: 837 KKYRFNFISISQRPSLVKYHDLLLEISED 865

>Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR326WABR125C/AGL142C/ABR126W
          Length = 1517

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 132/298 (44%), Gaps = 28/298 (9%)

Query: 452  RSNISH--ALTPTQGKIEFRDVSFSYPTRPSNQ-IFKHMSFTIEPGSNVCIVGPSGKGKS 508
            RSN+     L+ +Q    +R+V +S   +  N+ I  H+   ++PG+   ++G SG GK+
Sbjct: 852  RSNLETTVGLSKSQAIFHWRNVCYSVKIKDENRLILDHVDGWVKPGTLTALMGASGAGKT 911

Query: 509  TITSLLLRFYDPNY--GSILIDNHDISKFTTKSLRRHLGVVQQEPT-LMSGTIRDNITYG 565
            T+   L          GS+ ++ +       KS  R +G  QQ+   L + T+++++ + 
Sbjct: 912  TLLDCLASRVTTGVLTGSMFVNGN----LRDKSFPRSIGYCQQQDLHLSTATVKESLRFS 967

Query: 566  LSYTPTMDEIRVVSKQCFCHGFIT--KFPDGYDTVIGPRGASLSGGQRQRIAIARALIKK 623
             +Y     +I    K  +    I         D V+G  G  L+  QR+R+ I   L+ K
Sbjct: 968  -AYLRQSADIPKEEKDRYVDEVIKILDMEQYVDAVVGVAGEGLNVEQRKRLTIGVELVAK 1026

Query: 624  PKILI-LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSE--NIIVVGN 680
            PK+L+ LDE TS LD ++  +I   + +L    +  + +I H+ S +   E   ++++  
Sbjct: 1027 PKLLLFLDEPTSGLDSQTAWSICQLMRSLADHGQAVLCTI-HQPSALLMQEFDRLLLLQK 1085

Query: 681  DGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDI-------PPDSPKNDD 731
             G  V  G       +  S + K   +   +   K+ N +D         P S  N D
Sbjct: 1086 HGQTVYFGDLG----DGCSTMIKYFEDHGAEPCDKNSNPADWMLRVIDAAPGSTANQD 1139

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 116/260 (44%), Gaps = 33/260 (12%)

Query: 478  RPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNY--GSILIDNHDISKF 535
            + + +I  ++   ++PG+   ++G SG GK+T+   L          G + ID     K 
Sbjct: 964  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFID----GKP 1019

Query: 536  TTKSLRRHLGVVQQEPT-LMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFIT--KFP 592
              +S  R +G  QQ+   L + T+R+++ +  +Y     E+ +  K  +    I   +  
Sbjct: 1020 RDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDIIKILEME 1078

Query: 593  DGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTLGTL 651
               D ++G  G  L+  QR+R+ I   L  KPK+L+ LDE TS LD ++  AI      L
Sbjct: 1079 KYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQL 1134

Query: 652  MRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY---RNEESELFKLLNEK 708
            MR                 + + I+   +  S + + +FD+L    R  ++  F  L E 
Sbjct: 1135 MR-------------KLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGEG 1181

Query: 709  DHDLVS--KSENTSDIPPDS 726
             H ++   +S  +   PPD+
Sbjct: 1182 CHKMIDYFESHGSHKCPPDA 1201

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 73/186 (39%), Gaps = 29/186 (15%)

Query: 476 PTRPSN--QIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
           PT+  +  QI K M   ++PG  + ++G  G G    T+LL       +G  +  +  IS
Sbjct: 244 PTKEEDLFQILKPMDGCLKPGELLVVLGRPGSG---CTTLLKSITSNTHGFHVGKDSQIS 300

Query: 534 K--FTTKSLRRH-----------------LGVVQQEPTLMSGTIRDNITYGLSYTPTMDE 574
              F+ K ++RH                 L V Q   T+       N   G+S     + 
Sbjct: 301 YSGFSPKEIKRHYRGEVVYNAESDIHLPHLTVYQTLITVARLKTPQNRIQGVSREDYANH 360

Query: 575 IRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATS 634
           I  V+   +          G D V G     +SGG+R+R++IA   I   K    D AT 
Sbjct: 361 IAEVAMATYGLSHTRNTKVGNDLVRG-----VSGGERKRVSIAEVAICGSKFQCWDNATR 415

Query: 635 ALDVES 640
            LD  +
Sbjct: 416 GLDAAT 421

>SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 836

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 91/185 (49%), Gaps = 19/185 (10%)

Query: 493 PGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPT 552
           PGS++ I+GP+  GKS+I  ++   + P Y      N  +S  T+ +L     + Q+   
Sbjct: 605 PGSSLLILGPNSCGKSSIQRIIAEIW-PIYNK----NGLLSIPTSVNL---FCIPQKPYF 656

Query: 553 LMSGTIRDNITYGLSYTPTMDEIR-----VVSKQCFCHGFITKFPDGYDTV--IGPRGAS 605
           L  GT+RD I Y +S     D        V + Q     ++ K   G+  +  +      
Sbjct: 657 LQGGTLRDQIIYPMSTDEFFDRGHKDKDLVQALQEVKLEYLLKRDRGWKYLDAVADWKDV 716

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHR 665
           LSGG+RQR+  AR +  +P+ ++LDEAT+A+  + E   +Y    L R +    I+I+ R
Sbjct: 717 LSGGERQRMNFARIMFHRPRFVVLDEATNAISADME---DYLFNMLKRYR-FNFITISQR 772

Query: 666 LSTIR 670
            S I+
Sbjct: 773 PSLIK 777

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 80/174 (45%), Gaps = 19/174 (10%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F +++FSY   P N +++H++F ++  S + +VGP+G GKST+  ++     P  G +
Sbjct: 393 LAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGRV 452

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTM-DEIRVVSKQCFC 584
               H             LGV  Q         +  + +     P +  + +    Q   
Sbjct: 453 SRHTH-----------VKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQDFQYWRGQLGR 501

Query: 585 HGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
           +G      +G    +G    +LS GQR R+  A   +++P +L+LDE T+ LD+
Sbjct: 502 YGLTG---EGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 28/35 (80%)

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 99/200 (49%), Gaps = 26/200 (13%)

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
            S++ I+GP+G GKS+I  ++   + P Y      N  +SK  + SL   L + Q+    
Sbjct: 640 ASSLLILGPNGCGKSSIQRIIAEIW-PIYNK----NGLLSKPDSSSL---LCIPQKPYFT 691

Query: 554 MSGTIRDNITYGLSYTPTMDE-------IRVVSKQCFCH-GFITKFPDGYDTV--IGPRG 603
             GT RD I Y +S     D        + ++S+    H  ++ K   G+  +  +    
Sbjct: 692 RGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSE---VHLDYLLKRAPGWSYLDEVTEWK 748

Query: 604 ASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIA 663
             LSGG++QR+  AR L  KPK ++LDEAT+A+  + E      L  +++    + I+I+
Sbjct: 749 DVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADMEDY----LFNMLKKFRFSFITIS 804

Query: 664 HRLSTIRRSENIIVVGN-DG 682
            R S I+  + ++ + + DG
Sbjct: 805 QRPSLIKYHDMLLEIADRDG 824

>NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {ON}
           Anc_8.661
          Length = 868

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 97/201 (48%), Gaps = 27/201 (13%)

Query: 493 PGSNVCIVGPSGKGKSTITSLLLRFYDPNY---GSILIDNHDISKFTTKSLRRHLGVVQQ 549
           PGS++ I+GP+  GK++I  ++   + P Y   G + I   D           +L  V Q
Sbjct: 636 PGSSLLILGPNSCGKTSIQRIIAEIW-PIYNKNGLLSIPAED-----------NLFCVPQ 683

Query: 550 EPTLM-SGTIRDNITYGLS----YTPTMDEIRVVSKQCFCH-GFITKFPDGYDTV--IGP 601
           +P     GT+RD I Y +S    Y   + + ++V      H  ++ K   G+  +  +  
Sbjct: 684 KPYFTRGGTLRDQIIYPMSSDEFYDRGIKDAQLVQIMAEVHLDYLLKRGTGFSYLDNVAD 743

Query: 602 RGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIIS 661
               LSGG++QR+  AR L  KP+ ++LDEAT+A+  + E      L  +++      I+
Sbjct: 744 WKDVLSGGEKQRMNFARILFHKPRFVVLDEATNAISADMEDH----LFNILKKYRFNFIT 799

Query: 662 IAHRLSTIRRSENIIVVGNDG 682
           I+ R + I   + ++ +  +G
Sbjct: 800 ISQRPALIEYHDLLLEILEEG 820

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 129/287 (44%), Gaps = 43/287 (14%)

Query: 428 YSELMKGAGAASRLFELMDHKNSVRSNI-----SHALTPTQ----GKIEFRDVSFSYPTR 478
           Y+ L+K A +  ++ + M+    ++  +     S    P +      + F D+SF+Y   
Sbjct: 456 YANLVKQAKSRQKILDKMEADGLIQPVVPDRVFSFRFPPVERLPPPVLAFDDISFAYDGN 515

Query: 479 PSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTK 538
           P N +++H++F ++  S   +VGP+G GKST+  ++        G ++  +  +S+ T  
Sbjct: 516 PENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMT-------GELMPQSGRVSRHTHV 568

Query: 539 SLRRHLGVVQQEPTLMSGT---IRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGY 595
            L  +    Q +  L       +RD       Y+    + +    Q   +G      D  
Sbjct: 569 KLGVYSQHSQDQLDLTKSALEFVRDK------YSNISQDFQYWRGQLGRYGLTG---DAQ 619

Query: 596 DTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES----EGAIN-YTLGT 650
              +G    +LS GQR R+  A   ++ P +L+LDE T+ LD+ +      AIN +  G 
Sbjct: 620 KVQMG----TLSEGQRSRVVFALLALENPNVLLLDEPTNGLDIPTIDSLADAINEFNGGV 675

Query: 651 LMRSKELTIIS-IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
           ++ S +  ++  IA  +  +   E+      DGS+++  K  KL +N
Sbjct: 676 VVVSHDFRLLDKIAKDIFVV---EDKTATRWDGSILDYKK--KLAKN 717

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 28/35 (80%)

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 337 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 371

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 111/243 (45%), Gaps = 40/243 (16%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SF Y + PS  ++++++F ++  S + +VGP+G GKST+  ++     P  G +
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTM-DEIRVVSKQCFC 584
               H             LGV  Q         +  + +     P++  + +    Q   
Sbjct: 453 SRHTH-----------VKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLGR 501

Query: 585 HGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES---- 640
           +G       G    +  + A+LS GQR R+  A   +++P +L+LDE T+ LD+ +    
Sbjct: 502 YGLT-----GEGQTV--QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL 554

Query: 641 EGAINYTLGTLMRSKELTIISIAHRLSTIRR-SENIIVVGN------DGSVVEVGKFDKL 693
             AIN   G         ++ ++H    + + +++I VV +      DGS+++    +KL
Sbjct: 555 ADAINEFNG--------GVVVVSHDFRLLDKIAQDIFVVEDKTATRWDGSILQYK--NKL 604

Query: 694 YRN 696
            +N
Sbjct: 605 AKN 607

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 31/44 (70%)

Query: 597 TVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           T I  +   +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 218 TTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR070W
            (REAL)
          Length = 1424

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 78/325 (24%), Positives = 150/325 (46%), Gaps = 37/325 (11%)

Query: 462  TQGKIEFRDVSFSYPTRPSN---QIFKHMSFTIEPGSNVCIVGPSGKGKST-ITSLLLRF 517
            + G   +R+VSF+   R SN   ++  ++S    PG+   ++G SG GK+T + +L  R 
Sbjct: 771  STGVFIWRNVSFT--IRHSNGQRKLLDNVSGYCVPGTLTALIGESGAGKTTLLNTLAQRN 828

Query: 518  YDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSG-TIRDNITYGL-----SYTPT 571
                 G IL+D   +      S  R  G VQQ+    +  T+R+++ +          P 
Sbjct: 829  VGTVTGDILVDGLPMD----ASFERRTGYVQQQDLHTAELTVRESLQFSARMRRPQSIPD 884

Query: 572  MDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI-LD 630
            ++++  V K       I +  +  + ++G  G  L+  QR++++I   L+ KP +L+ LD
Sbjct: 885  VEKMEYVEKII----DILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLD 940

Query: 631  EATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTI-RRSENIIVVGNDGSVVEVGK 689
            E TS LD +S  +I   L  L ++ +  + +I    +T+  + E ++++G  G  V  G+
Sbjct: 941  EPTSGLDSQSAWSIVKMLKRLTQAGQSILCTIHQPSATLFEQFERLLLLGKGGQTVYFGE 1000

Query: 690  FDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEH------LVAEDV 743
              K      S + K           +SEN ++   ++      + +E         + ++
Sbjct: 1001 IGK----NSSSVVKYFESNGARKCEQSENPAEYILEAIGAGATASVEQNWYDIWKASPEI 1056

Query: 744  ASINDKVVKNVLNDITHDKNSSTLR 768
            A +N+KV     + +  D  SS++R
Sbjct: 1057 AKVNEKV-----DTMIKDLPSSSVR 1076

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 14/100 (14%)

Query: 595 YDTVIGPRGAS-LSGGQRQRIAIARALIKKPKILILDEATSALD----VESEGAINYTLG 649
           YDT +G    S +SGG+R+R++IA AL  +  I   D AT  LD    +E   AI  T+ 
Sbjct: 214 YDTRVGNDFVSGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIR-TMT 272

Query: 650 TLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
            L+ S  L  I  A        SENI    +  +V+  G+
Sbjct: 273 ELLGSTALITIYQA--------SENIYETFDKVTVLYAGR 304

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 90/198 (45%), Gaps = 21/198 (10%)

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
           G+++ I+GP+  GKS+I  ++   + P Y          +   +     +L  V Q P  
Sbjct: 631 GASLLILGPNSCGKSSIQRIITEVW-PVYNK--------NGLLSIPAPSNLFCVPQRPYF 681

Query: 554 M-SGTIRDNITYGLSYTPTMDE-------IRVVSKQCFCHGFITKFPDGYDTVIGPRGAS 605
              GT RD I Y +S     D         R++ +    +    +    Y   +      
Sbjct: 682 TRGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGCSYMDAVADWKDV 741

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHR 665
           LSGG++QR+  AR L  +P+ ++LDEAT+A+ V+ E      L  L++      I+I+ R
Sbjct: 742 LSGGEKQRMNFARILFHRPRFVVLDEATNAISVDMED----YLFNLLKRYRFNFITISQR 797

Query: 666 LSTIRRSENIIVVGNDGS 683
            S I+  + ++ V + GS
Sbjct: 798 PSLIKYHDMLLEVDSSGS 815

>KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3.220
            YDR011W
          Length = 1484

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/317 (23%), Positives = 141/317 (44%), Gaps = 31/317 (9%)

Query: 418  GSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPT 477
            GS  F ++T   ++  G  + S L E     +S   +I      ++G   ++DV ++ P 
Sbjct: 794  GSKRFEVTT---DIESGETSPSDLKERYSTSSSKGEDIQFEDLKSKGVFIWKDVCYTIPY 850

Query: 478  RPSNQ-IFKHMSFTIEPGSNVCIVGPSGKGKST-ITSLLLRFYDPNYGSILIDNHDISKF 535
                + +  H+S   +PG+   ++G SG GK+T + +L  R      G +L++ H I   
Sbjct: 851  DGGQRMLLDHVSGFCKPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGHHID-- 908

Query: 536  TTKSLRRHLGVVQQEPTLMSG-TIRDNITY--------GLSYTPTMDEIRVVSKQCFCHG 586
               S  R  G VQQ+   ++  T+R+++ +         +S    MD +  +        
Sbjct: 909  --ASFERRTGYVQQQDIHIAELTVRESLQFSARLRRPQNISDKEKMDYVEKIID------ 960

Query: 587  FITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI-LDEATSALDVESEGAIN 645
             +    D  + ++G  G  L+  QR++++I   L+ KP +L+ LDE TS LD +S  AI 
Sbjct: 961  -VLDMEDYAEALVGAVGNGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAII 1019

Query: 646  YTLGTLMRSKELTIISIAHRLSTI-RRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKL 704
              L  L  + +  + +I    +T+  + + ++++   G  V  G   +      S L   
Sbjct: 1020 QLLRKLAAAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE----NSSTLLGY 1075

Query: 705  LNEKDHDLVSKSENTSD 721
                     SK+EN ++
Sbjct: 1076 FERNGARKCSKAENPAE 1092

 Score = 35.0 bits (79), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 20/103 (19%)

Query: 595 YDTVIGP---RGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYT---- 647
           Y T +G    RG  +SGG+R+R++IA AL  +  +   D AT  LD  +  A+ Y     
Sbjct: 285 YQTKVGNDFVRG--VSGGERKRVSIAEALAARGTVYCWDNATRGLDAST--ALEYAAAIR 340

Query: 648 -LGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689
            +  L++S     I  A        SENI    +  +V+  G+
Sbjct: 341 IMTNLLKSTAFVTIYQA--------SENIYEKFDKVTVLYAGR 375

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 101/236 (42%), Gaps = 58/236 (24%)

Query: 428 YSELMKGAGAASRLFELMDHKNSVRSNIS-----------HALTPTQGKIEFRDVSFSYP 476
           Y+ L+K A +  ++ + M+    V+  +S             L P    + F ++SFSY 
Sbjct: 345 YANLVKQAKSRQKILDKMEADGLVQPVVSDRVFSFRFPEVERLPPPV--LAFDEISFSYD 402

Query: 477 TRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNH------ 530
            +P N ++++++F ++  S V +VGP+G GKST+  ++     P  G +    H      
Sbjct: 403 EKPENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRVSRHTHVKLGVY 462

Query: 531 --------DISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQC 582
                   D++K   + +R   G + ++     G +     YGL+               
Sbjct: 463 SQHSQDQLDLTKSALEFVRDKYGHISEDFQYWRGQLG---RYGLT--------------- 504

Query: 583 FCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
                     +G    +G    +LS GQR R+  A   + +P +L+LDE T+ LD+
Sbjct: 505 ---------GEGQTVQMG----TLSEGQRSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 30/43 (69%)

Query: 598 VIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
            I  +   +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 218 TINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 260

>Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 129/286 (45%), Gaps = 34/286 (11%)

Query: 453  SNISHALTPTQGKIEFRDVSFSYPTRPSNQ-IFKHMSFTIEPGSNVCIVGPSGKGKSTIT 511
            +N   AL+ ++    +RD+ +  P +   + I  +++  ++PG+   ++G SG GK+T+ 
Sbjct: 787  ANAGLALSKSEAIFHWRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLL 846

Query: 512  SLLLRFYDPNY--GSILIDNHDISKFTTKSLRRHLGVVQQEPT-LMSGTIRDNITYGLSY 568
              L          G I +D     +   +S  R +G  QQ+   L + T+R+++ +  +Y
Sbjct: 847  DCLAERVTMGVITGGIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AY 901

Query: 569  TPTMDEIRVVSKQCFCHGFIT--KFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKI 626
                  + V  K  +    I   +     D V+G  G  L+  QR+R+ I   L  +PK+
Sbjct: 902  LRQPSSVSVEEKNKYVEEVIKILEMEKYSDAVVGIAGEGLNVEQRKRLTIGVELAARPKL 961

Query: 627  LI-LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVV 685
            L+ LDE TS LD ++     +    LMR           +L+T    + I+   +  S +
Sbjct: 962  LVFLDEPTSGLDSQTA----WDTCQLMR-----------KLAT--HGQAILCTIHQPSAI 1004

Query: 686  EVGKFDKLY---RNEESELFKLLNEKDHDLVS--KSENTSDIPPDS 726
             + +FD+L    R  ++  F  L E    ++   +S+     PPD+
Sbjct: 1005 LMQQFDRLLFLQRGGQTVYFGDLGEGCKTMIDYFESKGAHKCPPDA 1050

>Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 129/286 (45%), Gaps = 34/286 (11%)

Query: 453  SNISHALTPTQGKIEFRDVSFSYPTRPSNQ-IFKHMSFTIEPGSNVCIVGPSGKGKSTIT 511
            +N   AL+ ++    +RD+ +  P +   + I  +++  ++PG+   ++G SG GK+T+ 
Sbjct: 787  ANAGLALSKSEAIFHWRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLL 846

Query: 512  SLLLRFYDPNY--GSILIDNHDISKFTTKSLRRHLGVVQQEPT-LMSGTIRDNITYGLSY 568
              L          G I +D     +   +S  R +G  QQ+   L + T+R+++ +  +Y
Sbjct: 847  DCLAERVTMGVITGGIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AY 901

Query: 569  TPTMDEIRVVSKQCFCHGFIT--KFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKI 626
                  + V  K  +    I   +     D V+G  G  L+  QR+R+ I   L  +PK+
Sbjct: 902  LRQPSSVSVEEKNKYVEEVIKILEMEKYSDAVVGIAGEGLNVEQRKRLTIGVELAARPKL 961

Query: 627  LI-LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVV 685
            L+ LDE TS LD ++     +    LMR           +L+T    + I+   +  S +
Sbjct: 962  LVFLDEPTSGLDSQTA----WDTCQLMR-----------KLAT--HGQAILCTIHQPSAI 1004

Query: 686  EVGKFDKLY---RNEESELFKLLNEKDHDLVS--KSENTSDIPPDS 726
             + +FD+L    R  ++  F  L E    ++   +S+     PPD+
Sbjct: 1005 LMQQFDRLLFLQRGGQTVYFGDLGEGCKTMIDYFESKGAHKCPPDA 1050

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 102/231 (44%), Gaps = 38/231 (16%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SF+Y  +P N ++ H++F ++  S + +VGP+G GKST+  ++        G +
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTM-DEIRVVSKQCFC 584
              +H             LGV  Q         +  + +     P +  + +    Q   
Sbjct: 453 SRHSH-----------VKLGVYSQHSQDQLDLTKSALEFVRDKYPEISQDFQYWRGQLGR 501

Query: 585 HGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES---- 640
           +G   +      TV   +  +LS GQR R+  A   ++ P +L+LDE T+ LD+ +    
Sbjct: 502 YGLTGE----AQTV---QMGTLSEGQRSRVVFALLALEAPNVLLLDEPTNGLDIPTIDSL 554

Query: 641 EGAINYTLGTLMRSKELTIISIAHRLSTIRR-SENIIVVGN------DGSV 684
             AIN   G         ++ ++H    + R +++I VV N      DGS+
Sbjct: 555 ADAINEFNG--------GVVVVSHDFRLLDRIAKDIFVVENQTATRWDGSI 597

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 28/35 (80%)

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 91/196 (46%), Gaps = 21/196 (10%)

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
           GS++ I+GP+G GKS+I  ++   + P Y          +   +     ++  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIW-PVYNK--------NGLLSIPSENNIFFIPQKPYF 688

Query: 554 -MSGTIRDNITYGLSYTPTMDE-------IRVVSKQCFCHGFITKFPDGYDTVIGPRGAS 605
              GT+RD I Y +S     D        ++++ +    +         Y   I      
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADWKDL 748

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHR 665
           LSGG++QR+  AR +  KP  ++LDEAT+A+ V+ E      L  L++      ISI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDY----LFNLLKRYRFNFISISQR 804

Query: 666 LSTIRRSENIIVVGND 681
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 101/220 (45%), Gaps = 26/220 (11%)

Query: 428 YSELMKGAGAASRLFELMDHKNSVRSNI-----SHALTPTQ----GKIEFRDVSFSYPTR 478
           Y+ L+K A +  ++ + M+    V++ +     S    P +      + F D+SFSY   
Sbjct: 344 YANLVKQAKSRQKILDKMEADGLVQAVVADKVFSFRFPPVERLPPPVLAFDDISFSYDDN 403

Query: 479 PSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTK 538
           P N +++ ++F ++  S + +VGP+G GKST+  ++        G ++  +  +S+ T  
Sbjct: 404 PENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMT-------GQLMPQSGRVSRHT-- 454

Query: 539 SLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTV 598
                LGV  Q         +  + +     P + +        +  G + ++    +  
Sbjct: 455 --HVKLGVYSQHSQDQLDLTKSPLEFVRDKYPNISQ-----DFQYWRGQLGRYGLTGEAQ 507

Query: 599 IGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDV 638
               G +LS GQR R+  A   +++P +L+LDE T+ LD+
Sbjct: 508 TSQMG-TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 30/42 (71%)

Query: 599 IGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           I  +   +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 218 ITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 259

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 111/240 (46%), Gaps = 15/240 (6%)

Query: 459  LTPTQGKIEFRDVSFSYPTR-PSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRF 517
            L+ ++    +RD+ +    +  + +I  ++   ++PG+   ++G SG GK+T+   L   
Sbjct: 862  LSRSEAIFHWRDLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAER 921

Query: 518  YDPNY--GSILIDNHDISKFTTKSLRRHLGVVQQEPT-LMSGTIRDNITYGLSYTPTMDE 574
                   G I +D         +S  R +G  QQ+   L + T+R+++ +  +Y     E
Sbjct: 922  VTMGVITGDIFVDGLP----RNESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPKE 976

Query: 575  IRVVSKQCFCHGFIT--KFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI-LDE 631
            + V  K  +    I   +     D ++G  G  L+  QR+R+ I   L  KPK+L+ LDE
Sbjct: 977  VSVEEKNAYVEEIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDE 1036

Query: 632  ATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSE--NIIVVGNDGSVVEVGK 689
             TS LD ++  AI   +  L +  +  + +I H+ S I   E   ++ +   G  V  G+
Sbjct: 1037 PTSGLDSQTAWAICQLMKKLCKHGQAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGE 1095

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 103/222 (46%), Gaps = 33/222 (14%)

Query: 480 SNQIFKHMS------FTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDIS 533
           S Q FK ++      F    GS++ I+GP+  GK++I  ++   + P Y          +
Sbjct: 645 STQDFKQINDMSSIPFIHGSGSSLLILGPNSSGKTSIQRIIAEIW-PIYNK--------N 695

Query: 534 KFTTKSLRRHLGVVQQEPTLMS-GTIRDNITYGLSYTPTMDE-------IRVVSKQCFCH 585
              +   + ++  + Q P   S GT+RD I Y +S     D        I+++ +     
Sbjct: 696 GLLSVPSQENIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVNL-- 753

Query: 586 GFITKFPDG--YDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 643
            ++ K   G  Y   +      LSGG++QRI  AR L  KP+ ++LDEAT+A+  + E  
Sbjct: 754 KYLMKRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDMEDY 813

Query: 644 INYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVG--NDGS 683
               L  +++      I+I+ R S I+  + ++ +   NDG+
Sbjct: 814 ----LFNILKKYRFNFITISQRPSLIKYHDLLLEISDHNDGT 851

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 91/196 (46%), Gaps = 21/196 (10%)

Query: 494 GSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTL 553
           GS++ I+GP+G GKS+I  ++   + P Y          +   +     ++  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIW-PVYNK--------NGLLSIPPENNIFFIPQKPYF 688

Query: 554 -MSGTIRDNITYGLSYTPTMDE-------IRVVSKQCFCHGFITKFPDGYDTVIGPRGAS 605
              GT+RD I Y +S     D        ++++ +    +         Y   +      
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTYLDAVADWKDL 748

Query: 606 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHR 665
           LSGG++QR+  AR +  KP  ++LDEAT+A+ V+ E      L  L++      ISI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDY----LFNLLKRYRFNFISISQR 804

Query: 666 LSTIRRSENIIVVGND 681
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 111/238 (46%), Gaps = 30/238 (12%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SF+Y  +  N +++H++F ++  S V +VGP+G GKST+  ++        G +
Sbjct: 390 LAFDDISFAYDGKAENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMT-------GEL 442

Query: 526 LIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTM-DEIRVVSKQCFC 584
              +  +S+ T       LGV  Q         +  + +     P +  + +    Q   
Sbjct: 443 SAQSGRVSRHT----HVKLGVYSQHSQEQLDLNKSPLEFVRDKFPHISQDFQYWRGQLGR 498

Query: 585 HGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES---- 640
           +G      +G  + +G    +LS GQR R+  A   ++ P +L+LDE T+ LD+ +    
Sbjct: 499 YGLTG---EGQTSQMG----TLSEGQRSRVVFALLALQAPNVLLLDEPTNGLDIATIDSL 551

Query: 641 -EGAINYTLGTLMRSKELTIIS-IAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696
            E   ++  G ++ S +  ++  IA  +  +   EN      DGS+++    +KL +N
Sbjct: 552 AEAINDFNGGVVVVSHDFRLLDKIAKDIFVV---ENKTATRWDGSILDYK--NKLAKN 604

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 30/42 (71%)

Query: 599 IGPRGASLSGGQRQRIAIARALIKKPKILILDEATSALDVES 640
           I  +   +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 217 IKKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 258

>KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 82/182 (45%), Gaps = 35/182 (19%)

Query: 466 IEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSI 525
           + F D+SFSY     N +++H+ F ++  S + +VGP+G GKST+  ++           
Sbjct: 390 LAFDDISFSYDGNSENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIM----------- 438

Query: 526 LIDNHDISKFTTKSLR--RH----LGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVS 579
                   + TT+S R  RH    LGV  Q         +  + +     P      V  
Sbjct: 439 ------TGQLTTQSGRVSRHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYP-----HVSQ 487

Query: 580 KQCFCHGFITKF---PDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636
              +  G + ++    +G    +G    +LS GQR R+  A   +++P +L+LDE T+ L
Sbjct: 488 DFQYWRGQLGRYGLTGEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGL 543