Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_25963.566ON38738720860.0
AFR267W3.566ON3853809791e-130
KLTH0G00748g3.566ON3853819781e-130
SAKL0F00836g3.566ON3833809631e-128
Kwal_47.192633.566ON3833819261e-122
KAFR0J028703.566ON3843859001e-119
ZYRO0E09504g3.566ON3773798821e-116
NDAI0I032303.566ON3863848631e-113
Kpol_380.73.566ON3853848441e-110
Skud_7.243.566ON3913858301e-108
NCAS0E002703.566ON3883848241e-107
KNAG0I002403.566ON3913948151e-106
TDEL0D063403.566ON4023888051e-104
YGL243W (TAD1)3.566ON4003908001e-103
KLLA0A00759g3.566ON3803907951e-103
Smik_7.183.566ON3853857951e-103
TPHA0G036403.566ON3963877941e-102
Suva_7.183.566ON3853867811e-101
TBLA0E002303.566ON3943917681e-98
CAGL0H07733g3.566ON3853796741e-84
Kpol_1031.598.457ON53832722.5
NCAS0B026508.457ON54189679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_2596
         (387 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   808   0.0  
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   381   e-130
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   381   e-130
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   375   e-128
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   361   e-122
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   351   e-119
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   344   e-116
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   337   e-113
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   329   e-110
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   324   e-108
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   322   e-107
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   318   e-106
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   314   e-104
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   312   e-103
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   310   e-103
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   310   e-103
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   310   e-102
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   305   e-101
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   300   1e-98
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   264   1e-84
Kpol_1031.59 s1031 (149108..150724) [1617 bp, 538 aa] {ON} (1491...    32   2.5  
NCAS0B02650 Chr2 complement(444160..445785) [1626 bp, 541 aa] {O...    30   9.5  

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/387 (100%), Positives = 387/387 (100%)

Query: 1   MCNNTRLLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISV 60
           MCNNTRLLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISV
Sbjct: 1   MCNNTRLLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISV 60

Query: 61  ATGVKALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNT 120
           ATGVKALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNT
Sbjct: 61  ATGVKALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNT 120

Query: 121 THPYRMRKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRF 180
           THPYRMRKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRF
Sbjct: 121 THPYRMRKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRF 180

Query: 181 NYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQH 240
           NYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQH
Sbjct: 181 NYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQH 240

Query: 241 HREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPME 300
           HREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPME
Sbjct: 241 HREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPME 300

Query: 301 MDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQT 360
           MDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQT
Sbjct: 301 MDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQT 360

Query: 361 SRNQLKEQVRLHLSSDGWIPTSADDCF 387
           SRNQLKEQVRLHLSSDGWIPTSADDCF
Sbjct: 361 SRNQLKEQVRLHLSSDGWIPTSADDCF 387

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  381 bits (979), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 200/380 (52%), Positives = 249/380 (65%), Gaps = 6/380 (1%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67
           LAE +   VI+QY + K S+KP+ +SNG  EWTVLAG+V +D  T E RL+S ATGVKAL
Sbjct: 6   LAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTAECRLVSAATGVKAL 65

Query: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMR 127
           P++ELERSHGRM+HDSHAEILALR FN VLL+Q  L+    +  CDLVE+  T   +R+ 
Sbjct: 66  PDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVEQAKTQDRFRLA 125

Query: 128 KRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCKGV 187
            RW+ ALYIS+ PCGDCSMD+  +D    M FS DD  QY+     T LRGRFNY  KGV
Sbjct: 126 SRWQAALYISKAPCGDCSMDMADDDADE-MTFSPDDPIQYVAEHNYTMLRGRFNYSRKGV 184

Query: 188 TRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKASD 247
            RTKPGR DS+ITLSKSCSDKLASK V+S+L+S  W+L E PVFL YLVLP      A+ 
Sbjct: 185 ARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLPH---TIATA 241

Query: 248 GCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDIEEGI 307
           G  R F  RL GL   H   ++ C   F GD+    Q P   + VY+NI   +  +E+ +
Sbjct: 242 GFERCFAERLAGLEGTHMPRLLCCHTAFPGDRAAPQQPPALTASVYLNIT-AKKHVEQAL 300

Query: 308 LNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRNQLKE 367
           LNGV NG YV+  R L  + E+I+SR++ W +F QL +     SY  FK +Q +RN+LK 
Sbjct: 301 LNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQL-HQAPPLSYAAFKRQQHARNRLKR 359

Query: 368 QVRLHLSSDGWIPTSADDCF 387
            VR  LS DGW  T  DDC 
Sbjct: 360 HVRHRLSPDGWPTTRVDDCI 379

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  381 bits (978), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/381 (50%), Positives = 264/381 (69%), Gaps = 5/381 (1%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67
           +A+ ++EL  + Y  LK S KP+++SNG KEW VLA +VAI+    +LRL+S+ATGVKA 
Sbjct: 7   VADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINRANEDLRLVSLATGVKAA 66

Query: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETC-DLVERC-NTTHPYR 125
           PNE+L+RS+GR+LHD HAEILALR FN VLLKQ+ LL  + +    DLV    + +  YR
Sbjct: 67  PNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSSSDNSGIYR 126

Query: 126 MRKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCK 185
           + + W  ALYISR PCGD SM +L   D   + F+ DD CQY++   +T +RGRFNY  K
Sbjct: 127 LNEEWSFALYISRAPCGDASMGLLY--DEGCISFTDDDRCQYVDDNNKTIIRGRFNYAKK 184

Query: 186 GVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKA 245
           G  RTKPGR DSK+TLSKSC+DKL SKQV+SILNS  W LLE PVFL Y+V+PQ  R   
Sbjct: 185 GYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEYIVIPQLPRVAE 244

Query: 246 SDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDIEE 305
           +D   R F  R+     +  ++++ CS++F+ DK  E+Q P  +S + +NI   ++  ++
Sbjct: 245 AD-FERAFDTRIKDSVPMEKVQILSCSQRFDDDKTYENQPPSLMSSILLNIIEGQVTQQQ 303

Query: 306 GILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRNQL 365
            ILNGV  G +VK   PL+KNCE+++SR+S W+LF Q+   V+S +Y +FKS+QT RN L
Sbjct: 304 SILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREFKSQQTDRNAL 363

Query: 366 KEQVRLHLSSDGWIPTSADDC 386
           KE++RL LS DGW+ T +DDC
Sbjct: 364 KERIRLALSKDGWVGTESDDC 384

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  375 bits (963), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 248/380 (65%), Gaps = 2/380 (0%)

Query: 7   LLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKA 66
            + +G S+L+ + Y  LK   KP+++SNGIKEWTVLAGI+AI+E  N +RL+S+ TGVKA
Sbjct: 6   FVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINERKNTMRLVSLGTGVKA 65

Query: 67  LPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRM 126
            PNEEL+RS G+++HD HAEILALR FN VLL Q++ L     E  DLVE+      +++
Sbjct: 66  TPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVDGLSFKV 125

Query: 127 RKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCKG 186
              W  ALYIS+ PCGD SMD L E+D N       D CQY+     T LRGRFNY  KG
Sbjct: 126 PDHWSFALYISKLPCGDSSMDTLEEEDLNSFNIENTDACQYLEQNNHTLLRGRFNYQKKG 185

Query: 187 VTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKAS 246
             RTKPGR DSKITLSKSCSDKL+ +QV S+LNS NW+L +TP++L Y+++P +  E A 
Sbjct: 186 FVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYIIIP-NLDEHAL 244

Query: 247 DGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDIEEG 306
            G  R+F  RL      +++  +  S+ F  DK  + Q P  +S + +N+     + +E 
Sbjct: 245 VGLERSFE-RLCNHPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISLNVHNNGEEFQEA 303

Query: 307 ILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRNQLK 366
           ILNGV NGFYVK  +PLRKNCESI+SR S W L+  +       +YL FKS Q  RN LK
Sbjct: 304 ILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQFKSTQVERNILK 363

Query: 367 EQVRLHLSSDGWIPTSADDC 386
            + +L LS DGWIPT  DDC
Sbjct: 364 NEAKLCLSPDGWIPTGVDDC 383

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  361 bits (926), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/381 (49%), Positives = 256/381 (67%), Gaps = 9/381 (2%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67
           LA+ +S+L    Y+ LK S KP I+SNG+KEW VLA ++AI  +   LRL+S+ATGVK+ 
Sbjct: 7   LADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGPDQG-LRLVSLATGVKST 65

Query: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETC--DLVE-RCNTTHPY 124
           PN+EL+RS+GR+LHD HAEILALR FN+VLLKQ+ +L  +P      DLV    +    +
Sbjct: 66  PNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLV-DPKAAVVPDLVSPSSDEDGKF 124

Query: 125 RMRKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDC 184
           ++   W  ALYISR PCGD SMD+L  +    M+FS D  CQY+NP  RT LRGRFNY+ 
Sbjct: 125 KLGDDWSFALYISRIPCGDASMDLLQSESD--MEFSEDTSCQYVNPCNRTILRGRFNYNK 182

Query: 185 KGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREK 244
           +G  RTKPGR DS +TLSKSCSDKL  +QV+SILN+  W L+E+P+FL Y+V+P+     
Sbjct: 183 RGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVVPKVS-NT 241

Query: 245 ASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDIE 304
           A  G    F  RL     + S+E++ C K+F  DK E +Q P  +SG+ +N    + + +
Sbjct: 242 ARRGFESAFKDRLREFPGIKSVELLECPKQFPDDKFELNQVPSSVSGILLNTNDGQPE-Q 300

Query: 305 EGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRNQ 364
           + ILNGV +G YV+  +PLRKNCE+++SR + WTLF ++  Y +  SY  FK +Q +RN 
Sbjct: 301 QSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFKGEQVARNV 360

Query: 365 LKEQVRLHLSSDGWIPTSADD 385
           LK +VR  LSSDGWI T  DD
Sbjct: 361 LKNKVRSSLSSDGWISTGPDD 381

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  351 bits (900), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 191/385 (49%), Positives = 246/385 (63%), Gaps = 10/385 (2%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNE--LRLISVATGVK 65
           L + +++LV ++YD LK S+KP  +SNG KEWTVLA +VAI+EN +E  L+LI+++TGVK
Sbjct: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64

Query: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYR 125
           A+PN  L+RS GR+LHD HAEILALR FN VLLK M  L  N  ET   +++      +R
Sbjct: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNN--ETSSFLDKSAQGGKFR 122

Query: 126 MRKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCK 185
            + +WK+ALY+SR PCGD SMD L +     ++ S DD  QYI+PG    LRGR N+  K
Sbjct: 123 WKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNFKRK 182

Query: 186 GVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKA 245
           G  RTKPGR DS ITLSKSCSDKL  KQ+ S LNS  W+L+ETPV+L YLV+P+ + +  
Sbjct: 183 GAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN-DTD 241

Query: 246 SDGCLRNFHYRLL-GLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKP-MEMDI 303
               +R FH RL   L+ +   + +     F  DK  +SQ P   S  +I + P  E  I
Sbjct: 242 KKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATS--FIKVFPSQEHTI 299

Query: 304 EEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYV-NSNSYLDFKSKQTSR 362
           E+ ILNGV NGFY K  +PLR+ CESILSR S W L+  L   V N  SYL FK++Q  R
Sbjct: 300 EQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQR 359

Query: 363 NQLKEQVRLHLSSDGWIPTSADDCF 387
             L E  ++ LS   WI T  DDC 
Sbjct: 360 RDLVENAKICLSHGSWIATLKDDCI 384

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 244/379 (64%), Gaps = 8/379 (2%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67
           L   +++ V++ Y  L  S KP  +SNG+KEWTVLAGIVAID+  ++LRLIS+ATGVKAL
Sbjct: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKAL 65

Query: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMR 127
           P+  L RS G+M+HD HAEILALRAFN V+L Q+A L +N     DLVER +    +  +
Sbjct: 66  PDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFHFK 125

Query: 128 KRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCKGV 187
             W++A+YIS  PCGD SMD+L +D++  ++   DD  Q+++P + + +RGRFNY  + V
Sbjct: 126 DNWELAIYISTLPCGDASMDLLCQDES-IIEMQDDDPIQFVDPAVTSIVRGRFNYSRRQV 184

Query: 188 TRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKASD 247
            RTKPGR DS+ITL KSCSDKL  +QVISILN   WKLL  PV+L YLV P       +D
Sbjct: 185 VRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPN-----TTD 239

Query: 248 GCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDIEEGI 307
              ++F+ R+  L  V  ++++ CS +F  DK    + P  +S + +   P E  +E+ +
Sbjct: 240 LLHQSFYDRIKVLPNV-PLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTP-ESTVEQAL 297

Query: 308 LNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRNQLKE 367
           LNG+ NGFY K  +PLR+NCE  +SR + W LF  L     + +YL FK+    RN L +
Sbjct: 298 LNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQ 357

Query: 368 QVRLHLSSDGWIPTSADDC 386
             R  LS  GWI TS DDC
Sbjct: 358 DCRKLLSPKGWISTSRDDC 376

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 243/384 (63%), Gaps = 9/384 (2%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67
           LA+ +++L+ ++YD+LK S+KP  +SNGIKEWTV AGIVAI+ +TN+LR+IS+ATGVKAL
Sbjct: 7   LADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKAL 66

Query: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMR 127
           PN+ELERS G+MLHD HAEI+ALR FN V+L+Q+  L  N  ET DLV     +  Y  +
Sbjct: 67  PNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQL-KNGEET-DLVIHSKDSEYYSFK 124

Query: 128 KRWKIALYISRPPCGDCSMDILGEDDTNYMQFSF--DDCCQYINPGIRTTLRGRFNYDCK 185
              KIALYIS+ PCGD SM +L E D    + +   +D  QYIN   +T LRGR N++ K
Sbjct: 125 SNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFNKK 184

Query: 186 GVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKA 245
           G  RTKPGR DS++T SKSCSDKL  KQ  SILN   ++LLE PV+L Y+++P    E  
Sbjct: 185 GYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEMK 244

Query: 246 SDG--CLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDI 303
            D   C      R +G    H +  +  SK+F   +    Q P  I  + + I      I
Sbjct: 245 EDIDLCFNKQFERCVGTR--HEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGN-SI 301

Query: 304 EEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRN 363
           E+ ILNGV NG Y K  +PLRKNCE+++SR S W +F ++    +  SYLDFK  Q  R 
Sbjct: 302 EQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQHERR 361

Query: 364 QLKEQVRLHLSSDGWIPTSADDCF 387
           +L +  R  +S DGWI T  DDC 
Sbjct: 362 KLIDYTRSKMSPDGWISTQEDDCL 385

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  329 bits (844), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 175/384 (45%), Positives = 240/384 (62%), Gaps = 8/384 (2%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67
           L + +S ++ ++Y  LK S+KP+ +SN +KEWTVLA IVAI  + NE+  I+++TGVKA 
Sbjct: 6   LGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISNDENEIIPITISTGVKAT 65

Query: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMR 127
           PN+ELERS G++LHD H+EIL+LRAFN  LL+ +  ++    +    +        Y   
Sbjct: 66  PNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEG--DKSKFILPAKADGKYNWN 123

Query: 128 KRWKIALYISRPPCGDCSMDILGED-DTNYMQFSFD--DCCQYINPGIRTTLRGRFNYDC 184
           + +KIALYIS+ PCGD SMD L ED + N   F+ +  D  Q+I+P I+T +RGR NY  
Sbjct: 124 ENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRGRLNYSK 183

Query: 185 KGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREK 244
           K V RTKPGR DS +TLSKSCSDKL  KQ  SILNS NW L E P+FL+Y+++P    E 
Sbjct: 184 KNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPTLKDEL 243

Query: 245 ASDGCLRNFHYRLLGLN-EVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDI 303
                 + F  RL G+   +  +  + C +KF  DK E    P  +S + I + P E  I
Sbjct: 244 LL-KLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKI-LLPREHQI 301

Query: 304 EEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRN 363
           E+ I+NGV NG Y K  +PL+KNC+S +S+ S W LF  L     + SY+++K  QT R 
Sbjct: 302 EQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKKSQTLRE 361

Query: 364 QLKEQVRLHLSSDGWIPTSADDCF 387
            LK+ ++  LS DGWI T  DDCF
Sbjct: 362 DLKDIIKSKLSPDGWISTFQDDCF 385

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  324 bits (830), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 177/385 (45%), Positives = 244/385 (63%), Gaps = 15/385 (3%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDEN--TNELRLISVATGVK 65
           LAE +S  VI +Y  LK   KP+ +  GIKEWT+LAG+V I+ +   N + ++SVATGVK
Sbjct: 13  LAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATGVK 72

Query: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYR 125
           ALP+ EL+RS G++LHD HAEILALR  N VLLK +     +P    D +E  N   P R
Sbjct: 73  ALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIK--DYDPANGSDFIESNNEI-PIR 129

Query: 126 --MRKRWKIALYISRPPCGDCSMDILGE---DDTNYMQFSFDDCCQYINPGIRTTLRGRF 180
             ++  W++ALYISR PCGD SMD L +   ++ ++++   +D  QY++P ++T LRGR 
Sbjct: 130 FNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGRL 189

Query: 181 NYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQH 240
           N+  K V RTKPGR DS ITLSKSCSDKL+ KQ+ SILNS N++L E PV+L Y+V+P  
Sbjct: 190 NFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPD- 248

Query: 241 HREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPME 300
             +K      R+FH RL    + H +E + C   F  D+ +E+  P  +  + + +   +
Sbjct: 249 IEDKTKHILERSFHNRLPC--DGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVN--D 304

Query: 301 MDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQT 360
              EE I NG+ NGFY K+++PLRK+C+S +SR + W LF Q+     S SYL FKS+Q 
Sbjct: 305 SSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQK 364

Query: 361 SRNQLKEQVRLHLSSDGWIPTSADD 385
            RN+L    +  LS DGWI T  DD
Sbjct: 365 ERNRLITTAKNALSPDGWISTRIDD 389

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/384 (47%), Positives = 252/384 (65%), Gaps = 9/384 (2%)

Query: 7   LLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKA 66
           LL + V+++V ++Y+ LK S+KP ++SNG+KEWTVLA  + +D NT  L++IS++TGVKA
Sbjct: 6   LLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKA 65

Query: 67  LPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRM 126
           LP++EL RS G+M+HD HAEILALR FN VLLK +  +  N  ++ DL+E  +    Y +
Sbjct: 66  LPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQS-DLLEISDANGKYHL 124

Query: 127 RKRWKIALYISRPPCGDCSM-DILGEDDTNYMQFSFDDC--CQYINPGIRTTLRGRFNYD 183
           R +WK+ LYISR PCGD SM  +     T+    S DD    QYI+P I T LRGR N+ 
Sbjct: 125 RAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGRLNFS 184

Query: 184 CKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHRE 243
             GV RTKPGR DS  TLSKSCSDKL  +QV SILN   W LL+TPVF+ YL++PQ + +
Sbjct: 185 RNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYD 244

Query: 244 KASDGCLRNFHYRLLGLNEVHSIEMIFCSK--KFNGDKEEESQTPCPISGVYINIKPMEM 301
             +D  L +F  R L  ++V+   M + +   KF+ DK   ++ P  +S + + +   E 
Sbjct: 245 NKND-LLLSFQNR-LKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGET 302

Query: 302 DIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTS 361
            IEE +LNGV NG Y K  +PLRKNCESI+SR + W ++ ++    ++ SYL+FK  QT+
Sbjct: 303 -IEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTA 361

Query: 362 RNQLKEQVRLHLSSDGWIPTSADD 385
           R +L +     LSS+GW+PT  DD
Sbjct: 362 RLELIKYTNEILSSEGWLPTQPDD 385

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  318 bits (815), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/394 (46%), Positives = 248/394 (62%), Gaps = 21/394 (5%)

Query: 5   TRLLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTN-ELRLISVATG 63
           T LL   +++LV  +YD L  S+KP+++SNG KEWT+L+G+VA+  +   +LRLIS+ TG
Sbjct: 2   TDLLGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQLRLISLTTG 61

Query: 64  VKALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLV-ERCNTTH 122
           VKA PN++LERS GR+LHD HAEILALR FN VLL+QM   AA   + CDL+      T+
Sbjct: 62  VKATPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQ--AARNNDRCDLILPGIQDTN 119

Query: 123 PYRMRKRWKIALYISRPPCGDCSMDILGED-----DTNYMQFSFDDCCQYINPGIRTTLR 177
            +R+   +++AL+ISR PCGD SM+ L E      DTN +    DD  QYI+P  R+ LR
Sbjct: 120 KFRLNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDD--DDPVQYIDPNNRSLLR 177

Query: 178 GRFNYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVL 237
           GRFNY  KG  RTKPGR DSKIT SKSCSDKL   Q  SILN+  W L+E  V++ YL++
Sbjct: 178 GRFNYAKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIV 237

Query: 238 PQHHREKASD--GCLRNFHYRLLGLN-EVHSIEMIFCSKKFNGDKEEESQTPCPISGVYI 294
           P      ASD     R F  RL      VH ++++ C + F  D+++E + P  IS V +
Sbjct: 238 PNI---SASDRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKL 294

Query: 295 NIKPMEMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNS--NSY 352
            I   E  +E+ +L+G+ NGF+ K ++PLR NCE+ +SR S W LF  L    ++   SY
Sbjct: 295 YITEGET-LEQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSY 353

Query: 353 LDFKSKQTSRNQLKEQVR-LHLSSDGWIPTSADD 385
            DFKSK   R +L  + R L  +   WIPT +DD
Sbjct: 354 RDFKSKLVPRAELITRTRSLLTNGQPWIPTCSDD 387

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  314 bits (805), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 243/388 (62%), Gaps = 12/388 (3%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENT--NELRLISVATGVK 65
           L + +++L   +Y  L  + KP I+SNG KEWTVL+GIVAID  +   +LRL+S+ TGVK
Sbjct: 10  LGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTGVK 69

Query: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYR 125
           ALP+  LERSHGRM+HD HAEILALR FN VLL+ M  +        DL+ER  T     
Sbjct: 70  ALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIER-TTAGVCI 128

Query: 126 MRKRWKIALYISRPPCGDCSMDIL---GEDDTNYMQ---FSFDDCCQYINPGIRTTLRGR 179
           ++ +WK+ALYIS  PCGD SM  L      DTN  Q   F  +   Q+I+  IR+ LRGR
Sbjct: 129 LKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSILRGR 188

Query: 180 FNYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQ 239
           FNYD  GV RTKPGR DS+IT SKSCSDKL  KQV SILNS  W L+  PVFL YLV+P 
Sbjct: 189 FNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLVIPN 248

Query: 240 HHREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIK-P 298
              ++   G   +F  RL  L +  S+E++ C+  F  +K  +S+ P  +S V + +  P
Sbjct: 249 LAVDRCQ-GVHHSFQDRLGRLPQ-KSLELLECNVPFFDNKSSKSEEPSSMSSVKLFLDLP 306

Query: 299 MEMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSK 358
                E+ ILNG+ NGFY K  +PLRKNCES +SR + W ++  +       +YL+FK+ 
Sbjct: 307 ERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQTYLEFKAG 366

Query: 359 QTSRNQLKEQVRLHLSSDGWIPTSADDC 386
            + RN++ ++V+  LS DGWI T  DDC
Sbjct: 367 LSERNRIIQEVKKVLSPDGWISTRNDDC 394

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  312 bits (800), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/390 (44%), Positives = 247/390 (63%), Gaps = 26/390 (6%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAI--DENTNELRLISVATGVK 65
           L E +S  VI +Y  LK + +P I+ +GI+EWT+LAG+ AI  D   N++ ++S+ATGVK
Sbjct: 23  LGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATGVK 82

Query: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYR 125
           ALP+ EL+RS G++LHD HAEILALR  N VLL ++     NP+     ++  N   P R
Sbjct: 83  ALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQ--NYNPSSGDKFIQH-NDEIPAR 139

Query: 126 --MRKRWKIALYISRPPCGDCSMDILGED--DTNYMQFSFDDCCQYINPGIRTTLRGRFN 181
             +++ W++ALYISR PCGD SM  L ++  + ++++    D  QY++  ++T LRGR N
Sbjct: 140 FNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLN 199

Query: 182 YDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLP--- 238
           ++ + V RTKPGR DS ITLSKSCSDKL  KQ  S+LN  N++L E PVFL Y+V+P   
Sbjct: 200 FNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLE 259

Query: 239 ---QHHREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYIN 295
              +HH E++       FH RL  L+  + I+ + C K F  DK +E   P  +  V + 
Sbjct: 260 DETKHHLEQS-------FHTRLPNLD--NEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLF 310

Query: 296 IKPMEMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDF 355
           +   +   EE ILNGV NGFY K+++PLRK+C+S +SR + W LF ++       SYL+F
Sbjct: 311 MD--DFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEF 368

Query: 356 KSKQTSRNQLKEQVRLHLSSDGWIPTSADD 385
           KS+Q  R+QL   ++  LS DGWIPT  DD
Sbjct: 369 KSRQKKRSQLIIAIKNILSPDGWIPTRTDD 398

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  310 bits (795), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 166/390 (42%), Positives = 240/390 (61%), Gaps = 21/390 (5%)

Query: 7   LLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKA 66
           ++A+ ++  VI  YD L  S KP I+SNG+ EWTVL+GIVA DE  +    IS+ TGVKA
Sbjct: 3   VIADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELNDRYEPISLGTGVKA 62

Query: 67  LPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRM 126
            PNEEL+RS+G+++HD HAE++ LRAFN +LLK++  L     +   L+E+  +   Y++
Sbjct: 63  TPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNG--QKSFLIEK--SADGYKV 118

Query: 127 RKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDC---------CQYINPGIRTTLR 177
           +  WK A+YISR PCGD SM++L  +D +      ++C          QY++P I T +R
Sbjct: 119 KDVWKFAMYISRIPCGDASMNLLEAEDKS----ECENCQQVGNIFINGQYVHPEIDTIIR 174

Query: 178 GRFNYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVL 237
           GR NY  + V RTKPGR DSKITLSKSCSDKL  KQ+ISI N+  W LL++PV+L ++VL
Sbjct: 175 GRANYKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVL 234

Query: 238 PQHHREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIK 297
           P+ ++ +     L +  +  L   +    + +FC++ F+ D+   SQ P   S V  ++ 
Sbjct: 235 PKQYQYEQVQ--LEDTFWLRLKNQQFLPFKFLFCNETFSADRTNLSQQPSLSSCV--SLY 290

Query: 298 PMEMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKS 357
                + E ILNGV NGFYVK  +PLRK C+SI+SR + W+ F ++    +   Y  FKS
Sbjct: 291 GSNEAVSEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKS 350

Query: 358 KQTSRNQLKEQVRLHLSSDGWIPTSADDCF 387
               RN +  + +  LS+ GWI T  D+C 
Sbjct: 351 SVVDRNHIISKAKATLSASGWISTCRDNCI 380

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  310 bits (795), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 237/385 (61%), Gaps = 13/385 (3%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDE--NTNELRLISVATGVK 65
           L + +S  VI +Y  LK   +P  +  G+KEWTVLAGIVAI+   +TN + ++S+ATGVK
Sbjct: 7   LGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATGVK 66

Query: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHP-Y 124
           A+P+ EL RS G++LHD HAEILALR  N VLL  +     NP    D ++  + T P +
Sbjct: 67  AMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIK--EYNPANGSDFIQSNDETPPRF 124

Query: 125 RMRKRWKIALYISRPPCGDCSMDILGED---DTNYMQFSFDDCCQYINPGIRTTLRGRFN 181
           +++  W++ALYIS+ PCGD S+D L ++   D ++ +   DD  QY+N  ++T LRG  N
Sbjct: 125 KLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGNLN 184

Query: 182 YDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHH 241
           ++ K V RTKPGR DS ITLSKSCSDKL  K++ SILN+ N++L   PVFL Y+V+P   
Sbjct: 185 FNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPGLE 244

Query: 242 REKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEM 301
            E       ++FH RL   N  H    + C+  F  DK  E   P  +  + + +   + 
Sbjct: 245 NE-VKHVLKQSFHDRLPNAN--HETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMN--DH 299

Query: 302 DIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTS 361
             EE ILNGV NGFY K+++PLRK+C+S++SR + W LF Q+       SYL FKS Q  
Sbjct: 300 TNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKR 359

Query: 362 RNQLKEQVRLHLSSDGWIPTSADDC 386
           R +L   ++  LS DGWIPT  DD 
Sbjct: 360 RTRLIIAIKDILSPDGWIPTKIDDV 384

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  310 bits (794), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 243/387 (62%), Gaps = 14/387 (3%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67
           +AE VS  V  +Y  L+ S+KP IKSN + EWTVLAGI+AI+  T E   I++ TGVKA 
Sbjct: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGVKAT 75

Query: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMR 127
           P+ +L+RS G+++HD HAEILALR FN+ LL  +  + +N   T   V+    T+ Y   
Sbjct: 76  PDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRI-SNHDGTSKFVQ-VTKTNSYEWN 133

Query: 128 KRWKIALYISRPPCGDCSM-DILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCKG 186
           K+W +ALYIS+ PCGD SM D++   DT   + + D+  QYI+P  +TT+RGR NY  + 
Sbjct: 134 KKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYKKRD 193

Query: 187 VTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKAS 246
           V RTKPGR DSKITLSKSC+DKL  KQV+ IL+ST   L++ P+FL Y+++P   R    
Sbjct: 194 VIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIP---RISGK 250

Query: 247 DGCLRN-FHYRLLGLN-EVHSIEMIFCSKKFNGDKEEES--QTPCPISGVYINIKPMEMD 302
           +  L++ F  RL G N  V   + I C   F  D  + +  + P  ++ + I +    + 
Sbjct: 251 ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRV- 309

Query: 303 IEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGY---YVNSNSYLDFKSKQ 359
           +E+ I+NGV NGFY K  +PLRKNCE I+SR S W L  Q+ +    + + SYL+FKS  
Sbjct: 310 MEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTL 369

Query: 360 TSRNQLKEQVRLHLSSDGWIPTSADDC 386
           T R  L+++VR  LS DGWI T  DDC
Sbjct: 370 TKRMTLQQEVRSLLSPDGWITTKKDDC 396

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  305 bits (781), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/386 (46%), Positives = 247/386 (63%), Gaps = 17/386 (4%)

Query: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENT--NELRLISVATGVK 65
           LAE +S  VI +Y  LK   +P  + +GI+EWT+LAG+ AI+ N   + ++++S+ATGVK
Sbjct: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66

Query: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHP-Y 124
           +LP+ EL+RS G++LHD HAEILALR  N V L  +     + T   DL+E  N   P +
Sbjct: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIK--DWDLTNGDDLIESNNEIPPKF 124

Query: 125 RMRKRWKIALYISRPPCGDCSMDILGED---DTNYMQFSFDDCCQYINPGIRTTLRGRFN 181
           R++ +W++ALYIS+ PCGD SMD L ++   D ++++   DD  QY++P ++T LRGR N
Sbjct: 125 RLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILRGRLN 184

Query: 182 YDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHH 241
           +  K V RTKPGR DS ITLSKSCSDKL  +Q  SILNS N  L   PVFL Y+V+P + 
Sbjct: 185 FGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVIP-NL 243

Query: 242 REKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPI--SGVYINIKPM 299
            EK      ++FH RL   +  H  E + C   F  DK++E+  P  +  + +++N    
Sbjct: 244 DEKTRHTLEQSFHNRLPFCS--HRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMN---- 297

Query: 300 EMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQ 359
           +  +EE ILNG+ NGFY K  +PLRK+CES LSR + W LFTQ+       SYL FK++Q
Sbjct: 298 DSTVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQ 357

Query: 360 TSRNQLKEQVRLHLSSDGWIPTSADD 385
           T RNQL   ++  LS DGWIPT  DD
Sbjct: 358 TERNQLITLIKGALSPDGWIPTKTDD 383

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  300 bits (768), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 165/391 (42%), Positives = 238/391 (60%), Gaps = 9/391 (2%)

Query: 4   NTRLLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAI-DENTNELRLISVAT 62
           + R L + ++ L+ ++Y+ LK SNKP  KSNGIKEWT+++GIVA+ +++TN +++IS+AT
Sbjct: 2   DKRELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNKDTNIIKVISLAT 61

Query: 63  GVKALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTH 122
           GVKA P+ EL+RS G ++HD HAEILA+R FN  LL+++     + T +CDL+ +   + 
Sbjct: 62  GVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSK 121

Query: 123 --PYRMRKRWKIALYISRPPCGDCSMDILGEDDTN-YMQFSFDDCCQYINPGIRTTLRGR 179
              Y     + + LYIS+ PCGD SM+     ++N  +QF  +D  QY++P IRT LRGR
Sbjct: 122 CKKYSWNDEYDLGLYISKLPCGDSSMEEENSLESNSLIQFQENDLTQYVDPTIRTILRGR 181

Query: 180 FNYDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQ 239
            NY+  G  RTKPGR DS+IT SKSCSDK+  KQV+S+LNS N +LLE+P+++ YLV P 
Sbjct: 182 INYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCPD 241

Query: 240 HHRE-----KASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYI 294
              +     K S   + N    +      H +  I  S +F   K  + Q P   S V I
Sbjct: 242 IKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKI 301

Query: 295 NIKPMEMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLD 354
                +  +E+ I+NGV  G Y K ++PL KN  +I+SR+  W +F  +       SYL 
Sbjct: 302 FNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYLT 361

Query: 355 FKSKQTSRNQLKEQVRLHLSSDGWIPTSADD 385
           FK  QT R + + ++R  LS DGWI T  DD
Sbjct: 362 FKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  264 bits (674), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 151/379 (39%), Positives = 225/379 (59%), Gaps = 11/379 (2%)

Query: 12  VSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKALPNEE 71
           ++ELV+ +Y+ L    +P  +SNG KE T++A ++A D  T++  ++++ TGVK+ PN+E
Sbjct: 11  ITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTPNDE 70

Query: 72  LERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMRKRWK 131
           L RS G++LHD HAEILALR FN +LL+ +   +    E+ +L+   NT + +      +
Sbjct: 71  LARSKGKILHDCHAEILALRGFNRLLLEHIK-RSMEGIES-NLIH--NTPNGFEWNNELE 126

Query: 132 IALYISRPPCGDCSMDILGE---DDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCKGVT 188
           + L+IS+ PCG+ SM +L E   +D N + F  DD  QYI P I+T LRGR N++ +   
Sbjct: 127 LTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKRNYV 186

Query: 189 RTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKASDG 248
           RTKPGR DSK T SKSCSDKL  +   S+LNS    ++ TP+++S  V+P  +  +  + 
Sbjct: 187 RTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQIEEM 246

Query: 249 CLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDIEEGIL 308
            L  +  R + L+       I  S    GD       P  +S + I     ++  EE IL
Sbjct: 247 NL--YFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDNDIQ-EEQIL 303

Query: 309 NGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQ-TSRNQLKE 367
           NGV NG+Y KA++PLRKNCES +SR S W+LF  +       +YL+FK +    R +L  
Sbjct: 304 NGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAELIR 363

Query: 368 QVRLHLSSDGWIPTSADDC 386
            ++  LSSDGW+ T+ DDC
Sbjct: 364 SIKSSLSSDGWLSTAEDDC 382

>Kpol_1031.59 s1031 (149108..150724) [1617 bp, 538 aa] {ON}
           (149108..150724) [1617 nt, 539 aa]
          Length = 538

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 23/32 (71%)

Query: 323 LRKNCESILSRSSFWTLFTQLGYYVNSNSYLD 354
           ++ N E  ++  +FWTL++QL Y+  S+SYL+
Sbjct: 464 IKDNLEYYINDGTFWTLYSQLIYFDPSSSYLE 495

>NCAS0B02650 Chr2 complement(444160..445785) [1626 bp, 541 aa] {ON}
           Anc_8.457 YDR235W
          Length = 541

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 18/89 (20%)

Query: 303 IEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKS----- 357
           IEE I   ++N            N E     + FW+L+  L ++  S SYL+ ++     
Sbjct: 456 IEEQIFQYLINT-----------NIEYYTKNAKFWSLYCHLIFFDPSKSYLERRAHIVNN 504

Query: 358 --KQTSRNQLKEQVRLHLSSDGWIPTSAD 384
             K+ S+  L++   LH   + ++P   D
Sbjct: 505 IWKKASKYSLEDNSSLHKFCESYLPDDLD 533

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,810,550
Number of extensions: 1867650
Number of successful extensions: 4441
Number of sequences better than 10.0: 24
Number of HSP's gapped: 4474
Number of HSP's successfully gapped: 24
Length of query: 387
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 276
Effective length of database: 40,753,473
Effective search space: 11247958548
Effective search space used: 11247958548
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)