Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_25953.565ON1701708911e-124
KAFR0J001803.565ON1821605602e-73
SAKL0F00858g3.565ON1731735565e-73
Skud_7.253.565ON1811725566e-73
AFR268C3.565ON1681665548e-73
Smik_7.193.565ON1811705341e-69
Suva_7.193.565ON1811635305e-69
YGL242C3.565ON1811645281e-68
NDAI0B062703.565ON1821725253e-68
KLLA0A00781g3.565ON1711695182e-67
CAGL0H07755g3.565ON1721645159e-67
KLTH0G00770g3.565ON1711695061e-65
Kpol_507.113.565ON1891535063e-65
Kwal_47.192623.565ON1711695036e-65
TDEL0D063303.565ON1791594914e-63
TPHA0A059903.565ON1761534889e-63
KNAG0D029503.565ON1741644802e-61
ZYRO0E09482g3.565ON1751504698e-60
TBLA0I034903.565ON1751514653e-59
NCAS0F039603.565ON1861504612e-58
TBLA0F040206.319ON2191531211e-07
NDAI0I005106.319ON2121201166e-07
KLTH0A06248g6.319ON2021021131e-06
Smik_3.1536.319ON2461461034e-05
Kpol_1028.586.319ON2081161015e-05
Ecym_20996.319ON2071181008e-05
NCAS0D044306.319ON230127982e-04
KAFR0J015402.257ON106845974e-04
Suva_3.896.319ON223152954e-04
CAGL0C03003g6.319ON206140946e-04
AAR063C6.319ON220103928e-04
KNAG0I025906.319ON214129900.002
KAFR0J025006.319ON212121890.002
Kwal_23.62186.319ON202103860.005
SAKL0A01870g6.319ON206123860.006
KLLA0C09108g6.319ON208102850.007
Suva_9.822.257ON1141110860.008
ZYRO0D08690g6.319ON208136840.011
KLTH0F01826g1.60ON66372850.013
Smik_16.745.97ON228121830.014
TDEL0A073406.319ON215121830.015
TPHA0D037906.319ON213128820.019
KAFR0B042605.97ON230120820.020
YIL112W (HOS4)2.257ON108398830.025
AER388C5.626ON72487820.028
NDAI0D025405.97ON236119810.030
Smik_9.572.257ON108598800.054
NCAS0C036803.175ON1208111780.087
NDAI0B037002.257ON114191770.12
NCAS0C051602.639ON40858760.16
Ecym_20825.97ON23376750.17
Kwal_33.132591.60ON66453760.19
NCAS0C018208.599ON113375760.20
KAFR0C009403.175ON1120111750.21
ZYRO0B15114g5.97ON226118730.27
NDAI0G030203.175ON1495109740.29
KNAG0K017003.175ON135674740.34
NDAI0D008006.20ON119356740.34
YAR042W (SWH1)3.175ON1188109740.35
CAGL0L07634g6.20ON1130116730.41
NDAI0A064303.175ON1312114730.44
Kwal_23.49142.257ON1043115730.45
Skud_9.592.257ON107798720.53
TPHA0I015808.599ON124688720.60
KAFR0A001702.662ON1054126720.60
TBLA0G025002.257ON1259108710.69
KLTH0C01650g5.97ON23291700.73
NCAS0B086601.60ON75153710.80
TPHA0K007507.409ON85771710.81
ZYRO0A05258g3.175ON1548120710.85
TBLA0A006802.662ON149441710.89
TDEL0D044803.175ON1268109700.93
KNAG0E018802.257ON99288700.94
KAFR0H013503.293ON62963700.95
Ecym_30246.20ON107997700.95
Kpol_1048.288.599ON122926701.1
CAGL0D01012g4.232ON802106701.1
Skud_1.913.175ON1165110701.2
Kpol_1045.523.175ON125591691.2
KNAG0A015605.96ON1159116691.3
TBLA0G015506.265ON20689681.3
Smik_1.1073.175ON1179109691.3
KAFR0A002802.639ON38728681.4
TBLA0B016203.175ON1260111691.5
Kpol_1018.1057.409ON104872691.6
TPHA0P005803.175ON125787691.6
Kpol_1037.53.175ON1212127681.6
TBLA0A007802.639ON72680681.7
KNAG0C006501.60ON74853681.9
CAGL0H00935g6.265ON19389661.9
AFR600C4.232ON81563681.9
SAKL0E08382g2.257ON108590682.0
Suva_1.1103.175ON1159115682.1
ZYRO0C16544g3.368ON759123672.4
Kwal_14.9822.639ON41625662.5
YLR182W (SWI6)1.60ON80335663.0
TPHA0J003306.20ON110764663.0
TBLA0G008403.175ON156165663.1
KNAG0M025102.639ON41156653.7
TDEL0C040402.257ON100798663.7
TBLA0A070301.60ON45886653.9
ADL244W2.257ON108990654.0
NDAI0A006001.60ON79857654.1
Suva_13.2432.639ON41685654.1
NCAS0F005905.97ON23593644.3
TDEL0C064201.60ON75794654.4
SAKL0G15554g5.96ON109098654.4
NDAI0A007101.138ON33542644.4
NCAS0F005805.96ON1148119654.4
SAKL0B08008g3.368ON774120654.7
CAGL0F06831g2.662ON1092160654.7
SAKL0G19646g2.662ON111889654.9
NCAS0B064102.257ON105494645.2
TPHA0E036301.60ON57158645.3
NDAI0D044304.232ON803118645.3
CAGL0C01309g2.257ON1110101645.3
TDEL0B073302.639ON37546636.0
CAGL0H03289g6.195ON38547636.1
Kwal_14.8892.662ON109471646.3
Kwal_27.127505.97ON23380627.0
TPHA0H007703.175ON124553637.2
Skud_12.2481.60ON80094637.4
KNAG0K012303.175ON1228110638.0
Suva_10.2791.60ON80394638.6
KLTH0C00638g2.662ON108545629.6
KLTH0G09724g2.257ON107393629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_2595
         (170 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar ...   347   e-124
KAFR0J00180 Chr10 complement(29811..30359) [549 bp, 182 aa] {ON}...   220   2e-73
SAKL0F00858g Chr6 complement(76158..76679) [522 bp, 173 aa] {ON}...   218   5e-73
Skud_7.25 Chr7 complement(48834..49379) [546 bp, 181 aa] {ON} YG...   218   6e-73
AFR268C Chr6 complement(915788..916294) [507 bp, 168 aa] {ON} Sy...   218   8e-73
Smik_7.19 Chr7 complement(39474..40019) [546 bp, 181 aa] {ON} YG...   210   1e-69
Suva_7.19 Chr7 complement(39229..39774) [546 bp, 181 aa] {ON} YG...   208   5e-69
YGL242C Chr7 complement(44652..45197) [546 bp, 181 aa] {ON} Puta...   207   1e-68
NDAI0B06270 Chr2 (1518518..1519066) [549 bp, 182 aa] {ON} Anc_3....   206   3e-68
KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}...   204   2e-67
CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {O...   202   9e-67
KLTH0G00770g Chr7 complement(52958..53473) [516 bp, 171 aa] {ON}...   199   1e-65
Kpol_507.11 s507 complement(58716..59285) [570 bp, 189 aa] {ON} ...   199   3e-65
Kwal_47.19262 s47 (1160155..1160670) [516 bp, 171 aa] {ON} YGL24...   198   6e-65
TDEL0D06330 Chr4 (1138062..1138601) [540 bp, 179 aa] {ON} Anc_3....   193   4e-63
TPHA0A05990 Chr1 (1356065..1356595) [531 bp, 176 aa] {ON} Anc_3....   192   9e-63
KNAG0D02950 Chr4 (532378..532902) [525 bp, 174 aa] {ON} Anc_3.56...   189   2e-61
ZYRO0E09482g Chr5 (756328..756855) [528 bp, 175 aa] {ON} highly ...   185   8e-60
TBLA0I03490 Chr9 (839793..840320) [528 bp, 175 aa] {ON} Anc_3.56...   183   3e-59
NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.56...   182   2e-58
TBLA0F04020 Chr6 (993029..993688) [660 bp, 219 aa] {ON} Anc_6.31...    51   1e-07
NDAI0I00510 Chr9 complement(104836..105474) [639 bp, 212 aa] {ON...    49   6e-07
KLTH0A06248g Chr1 (524183..524791) [609 bp, 202 aa] {ON} similar...    48   1e-06
Smik_3.153 Chr3 (212077..212817) [741 bp, 246 aa] {ON} YCR051W (...    44   4e-05
Kpol_1028.58 s1028 complement(133357..133983) [627 bp, 208 aa] {...    44   5e-05
Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON} ...    43   8e-05
NCAS0D04430 Chr4 (843610..844302) [693 bp, 230 aa] {ON} Anc_6.319      42   2e-04
KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa] ...    42   4e-04
Suva_3.89 Chr3 (127217..127888) [672 bp, 223 aa] {ON} YCR051W (R...    41   4e-04
CAGL0C03003g Chr3 (297244..297864) [621 bp, 206 aa] {ON} similar...    41   6e-04
AAR063C Chr1 complement(453099..453761) [663 bp, 220 aa] {ON} Sy...    40   8e-04
KNAG0I02590 Chr9 complement(499721..500365) [645 bp, 214 aa] {ON...    39   0.002
KAFR0J02500 Chr10 (476605..477243) [639 bp, 212 aa] {ON} Anc_6.3...    39   0.002
Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051...    38   0.005
SAKL0A01870g Chr1 complement(167727..168347) [621 bp, 206 aa] {O...    38   0.006
KLLA0C09108g Chr3 complement(795433..796059) [627 bp, 208 aa] {O...    37   0.007
Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W ...    38   0.008
ZYRO0D08690g Chr4 complement(747083..747709) [627 bp, 208 aa] {O...    37   0.011
KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} simila...    37   0.013
Smik_16.74 Chr16 complement(142064..142750) [687 bp, 228 aa] {ON...    37   0.014
TDEL0A07340 Chr1 (1284474..1285121) [648 bp, 215 aa] {ON} Anc_6....    37   0.015
TPHA0D03790 Chr4 (797282..797923) [642 bp, 213 aa] {ON} Anc_6.31...    36   0.019
KAFR0B04260 Chr2 (884243..884935) [693 bp, 230 aa] {ON} Anc_5.97...    36   0.020
YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subun...    37   0.025
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    36   0.028
NDAI0D02540 Chr4 (584626..585336) [711 bp, 236 aa] {ON} Anc_5.97       36   0.030
Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W ...    35   0.054
NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {...    35   0.087
NDAI0B03700 Chr2 complement(925092..928517) [3426 bp, 1141 aa] {...    34   0.12 
NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa] ...    34   0.16 
Ecym_2082 Chr2 (140585..141286) [702 bp, 233 aa] {ON} similar to...    33   0.17 
Kwal_33.13259 s33 (143081..145075) [1995 bp, 664 aa] {ON} YLR182...    34   0.19 
NCAS0C01820 Chr3 complement(336290..339691) [3402 bp, 1133 aa] {...    34   0.20 
KAFR0C00940 Chr3 (189934..193296) [3363 bp, 1120 aa] {ON} Anc_3....    33   0.21 
ZYRO0B15114g Chr2 complement(1233061..1233741) [681 bp, 226 aa] ...    33   0.27 
NDAI0G03020 Chr7 complement(699746..704233) [4488 bp, 1495 aa] {...    33   0.29 
KNAG0K01700 Chr11 (352052..356122) [4071 bp, 1356 aa] {ON}             33   0.34 
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....    33   0.34 
YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Prote...    33   0.35 
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...    33   0.41 
NDAI0A06430 Chr1 (1461045..1464983) [3939 bp, 1312 aa] {ON} Anc_...    33   0.44 
Kwal_23.4914 s23 (921368..924499) [3132 bp, 1043 aa] {ON} YIL112...    33   0.45 
Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W ...    32   0.53 
TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {...    32   0.60 
KAFR0A00170 Chr1 complement(27115..30279) [3165 bp, 1054 aa] {ON...    32   0.60 
TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {...    32   0.69 
KLTH0C01650g Chr3 complement(146654..147352) [699 bp, 232 aa] {O...    32   0.73 
NCAS0B08660 Chr2 (1665156..1667411) [2256 bp, 751 aa] {ON} Anc_1...    32   0.80 
TPHA0K00750 Chr11 (155270..157843) [2574 bp, 857 aa] {ON} Anc_7....    32   0.81 
ZYRO0A05258g Chr1 (424968..429614) [4647 bp, 1548 aa] {ON} some ...    32   0.85 
TBLA0A00680 Chr1 complement(145681..150165) [4485 bp, 1494 aa] {...    32   0.89 
TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3....    32   0.93 
KNAG0E01880 Chr5 (389045..392023) [2979 bp, 992 aa] {ON} Anc_2.2...    32   0.94 
KAFR0H01350 Chr8 complement(253612..255501) [1890 bp, 629 aa] {O...    32   0.95 
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...    32   0.95 
Kpol_1048.28 s1048 complement(85092..88781) [3690 bp, 1229 aa] {...    32   1.1  
CAGL0D01012g Chr4 (118878..121286) [2409 bp, 802 aa] {ON} simila...    32   1.1  
Skud_1.91 Chr1 (162916..166413) [3498 bp, 1165 aa] {ON} YAR042W ...    32   1.2  
Kpol_1045.52 s1045 complement(122763..126530) [3768 bp, 1255 aa]...    31   1.2  
KNAG0A01560 Chr1 (74485..77964) [3480 bp, 1159 aa] {ON} Anc_5.96...    31   1.3  
TBLA0G01550 Chr7 complement(410811..411431) [621 bp, 206 aa] {ON...    31   1.3  
Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W...    31   1.3  
KAFR0A00280 Chr1 complement(53403..54566) [1164 bp, 387 aa] {ON}...    31   1.4  
TBLA0B01620 Chr2 complement(356040..359822) [3783 bp, 1260 aa] {...    31   1.5  
Kpol_1018.105 s1018 complement(274868..278014) [3147 bp, 1048 aa...    31   1.6  
TPHA0P00580 Chr16 (117136..120909) [3774 bp, 1257 aa] {ON} Anc_3...    31   1.6  
Kpol_1037.5 s1037 complement(8144..11782) [3639 bp, 1212 aa] {ON...    31   1.6  
TBLA0A00780 Chr1 complement(168204..170384) [2181 bp, 726 aa] {O...    31   1.7  
KNAG0C00650 Chr3 (110325..112571) [2247 bp, 748 aa] {ON} Anc_1.6...    31   1.9  
CAGL0H00935g Chr8 (91979..92560) [582 bp, 193 aa] {ON} highly si...    30   1.9  
AFR600C Chr6 complement(1517783..1520230) [2448 bp, 815 aa] {ON}...    31   1.9  
SAKL0E08382g Chr5 complement(676318..679575) [3258 bp, 1085 aa] ...    31   2.0  
Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W...    31   2.1  
ZYRO0C16544g Chr3 (1285279..1287558) [2280 bp, 759 aa] {ON} high...    30   2.4  
Kwal_14.982 s14 complement(141369..142619) [1251 bp, 416 aa] {ON...    30   2.5  
YLR182W Chr12 (517940..520351) [2412 bp, 803 aa] {ON}  SWI6Trans...    30   3.0  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...    30   3.0  
TBLA0G00840 Chr7 (200837..205522) [4686 bp, 1561 aa] {ON} Anc_3....    30   3.1  
KNAG0M02510 Chr13 complement(465793..467028) [1236 bp, 411 aa] {...    30   3.7  
TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {...    30   3.7  
TBLA0A07030 Chr1 (1721376..1722752) [1377 bp, 458 aa] {ON}             30   3.9  
ADL244W Chr4 (273377..276646) [3270 bp, 1089 aa] {ON} Syntenic h...    30   4.0  
NDAI0A00600 Chr1 complement(111082..113478) [2397 bp, 798 aa] {O...    30   4.1  
Suva_13.243 Chr13 (387561..388661,388691..388840) [1251 bp, 416 ...    30   4.1  
NCAS0F00590 Chr6 complement(117069..117776) [708 bp, 235 aa] {ON...    29   4.3  
TDEL0C06420 Chr3 complement(1174443..1176716) [2274 bp, 757 aa] ...    30   4.4  
SAKL0G15554g Chr7 complement(1337081..1340353) [3273 bp, 1090 aa...    30   4.4  
NDAI0A00710 Chr1 complement(134887..135894) [1008 bp, 335 aa] {O...    29   4.4  
NCAS0F00580 Chr6 (113589..117035) [3447 bp, 1148 aa] {ON} Anc_5....    30   4.4  
SAKL0B08008g Chr2 (680730..683054) [2325 bp, 774 aa] {ON} simila...    30   4.7  
CAGL0F06831g Chr6 (668173..671451) [3279 bp, 1092 aa] {ON} simil...    30   4.7  
SAKL0G19646g Chr7 (1690766..1694122) [3357 bp, 1118 aa] {ON} sim...    30   4.9  
NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]...    29   5.2  
TPHA0E03630 Chr5 complement(766656..768371) [1716 bp, 571 aa] {O...    29   5.3  
NDAI0D04430 Chr4 (1040300..1042711) [2412 bp, 803 aa] {ON} Anc_4...    29   5.3  
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    29   5.3  
TDEL0B07330 Chr2 (1291145..1292272) [1128 bp, 375 aa] {ON} Anc_2...    29   6.0  
CAGL0H03289g Chr8 (309091..310248) [1158 bp, 385 aa] {ON} simila...    29   6.1  
Kwal_14.889 s14 complement(96498..99782) [3285 bp, 1094 aa] {ON}...    29   6.3  
Kwal_27.12750 s27 (1360301..1361002) [702 bp, 233 aa] {ON} YGR23...    28   7.0  
TPHA0H00770 Chr8 (156886..160623) [3738 bp, 1245 aa] {ON} Anc_3....    29   7.2  
Skud_12.248 Chr12 (464584..466986) [2403 bp, 800 aa] {ON} YLR182...    29   7.4  
KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa] ...    29   8.0  
Suva_10.279 Chr10 (490526..492937) [2412 bp, 803 aa] {ON} YLR182...    29   8.6  
KLTH0C00638g Chr3 complement(63995..67252) [3258 bp, 1085 aa] {O...    28   9.6  
KLTH0G09724g Chr7 (818249..821470) [3222 bp, 1073 aa] {ON} simil...    28   9.7  

>Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AFR268C
          Length = 170

 Score =  347 bits (891), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/170 (100%), Positives = 170/170 (100%)

Query: 1   MDEIEGATYGEQLLDASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGS 60
           MDEIEGATYGEQLLDASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGS
Sbjct: 1   MDEIEGATYGEQLLDASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGS 60

Query: 61  WDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           WDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN
Sbjct: 61  WDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPEDG 170
           SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPEDG
Sbjct: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPEDG 170

>KAFR0J00180 Chr10 complement(29811..30359) [549 bp, 182 aa] {ON}
           Anc_3.565 YGL242C
          Length = 182

 Score =  220 bits (560), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 108/160 (67%), Positives = 132/160 (82%), Gaps = 4/160 (2%)

Query: 3   EIEGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCKYG 59
           E EGA++GEQLLDASRRNNVDLLE +   L  D   +A LIN +KDPFGNT LH+ CKYG
Sbjct: 2   ETEGASFGEQLLDASRRNNVDLLETVFSDLANDHKKIADLINSSKDPFGNTALHLSCKYG 61

Query: 60  SWDVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIK 118
           SW+VLD ILD++  IEIDP+N ++G+TPLH  VKYS+ EPEHGTFIASNLIQVGADPR+K
Sbjct: 62  SWEVLDKILDLEGDIEIDPKNNIDGETPLHCAVKYSQTEPEHGTFIASNLIQVGADPRLK 121

Query: 119 NNSGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINEN 158
           NN+ ++PI+LIH+++  DLIDLLQ AELAAD+   AINE+
Sbjct: 122 NNNNQRPIDLIHSEELDDLIDLLQGAELAADHANEAINES 161

>SAKL0F00858g Chr6 complement(76158..76679) [522 bp, 173 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 173

 Score =  218 bits (556), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 119/173 (68%), Positives = 138/173 (79%), Gaps = 5/173 (2%)

Query: 1   MDEIEGATYGEQLLDASRRNNVDLLEFILEQDSN---IVAKLINDTKDPFGNTCLHMCCK 57
           M EI+GA+  EQLLDASRRNN DLLE ILE   N    +AKLIN   DP GNTCLH+CCK
Sbjct: 1   MSEIQGASLQEQLLDASRRNNADLLETILESLDNNPDKIAKLINSACDPLGNTCLHLCCK 60

Query: 58  YGSWDVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPR 116
           YGSW+VLD ILD D  IEIDP+N V+GDTPLH  V+Y+ EEPEHGTFIA NLI+VGADPR
Sbjct: 61  YGSWEVLDRILDQDGGIEIDPRNNVDGDTPLHVTVRYAIEEPEHGTFIAQNLIEVGADPR 120

Query: 117 IKNNSGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPED 169
           I+N +G+KP++LIH D   DL+DLLQ AELAADN+G  INE +AE+IDD PED
Sbjct: 121 IRNKAGQKPVDLIHGDGLDDLLDLLQGAELAADNEGV-INEEDAEIIDDGPED 172

>Skud_7.25 Chr7 complement(48834..49379) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  218 bits (556), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 110/172 (63%), Positives = 136/172 (79%), Gaps = 5/172 (2%)

Query: 3   EIEGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCKYG 59
           + EGA+  EQLLDA+RRNN+DLLE +   L+ DS  +AKLIN +K+P GNT LH+CCKYG
Sbjct: 2   DTEGASLSEQLLDAARRNNLDLLETVFDGLDGDSEKIAKLINKSKEPLGNTALHLCCKYG 61

Query: 60  SWDVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIK 118
           SW+VLD ILD D  IEIDPQN V+GDTPLH  V+YS+EEPEHGTFIA NLI+VGADPR++
Sbjct: 62  SWEVLDRILDQDGGIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVR 121

Query: 119 NNSGRKPIELIHNDKFTDLIDLLQSAELAADN-KGTAINENEAEVIDDSPED 169
           N + +KPI+L+H D+  +LIDLLQ AELA D+  G A N  + E+IDDSP D
Sbjct: 122 NYNNQKPIDLVHGDELDELIDLLQGAELAIDSTNGLADNNEDEEMIDDSPSD 173

>AFR268C Chr6 complement(915788..916294) [507 bp, 168 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL242C
          Length = 168

 Score =  218 bits (554), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 94/166 (56%), Positives = 125/166 (75%)

Query: 4   IEGATYGEQLLDASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDV 63
           ++GA+ GEQLL+A+RRNNV+LLE ++      +  LIN ++DP GNTCLH+CC +GSW+ 
Sbjct: 3   VDGASLGEQLLEAARRNNVELLEAVVRDAGPEIEDLINGSRDPLGNTCLHLCCTHGSWEA 62

Query: 64  LDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGR 123
           LD ILD+DC IE+DPQN  GDTPLH   +Y+ EEPEH TF+ASNL+QVGADPR++N +G 
Sbjct: 63  LDMILDLDCAIEVDPQNTAGDTPLHAAARYAAEEPEHATFLASNLVQVGADPRVRNKAGL 122

Query: 124 KPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPED 169
           +P+EL+H  +   L+D+LQ  ELA D  G A+N +E E IDD P D
Sbjct: 123 RPVELVHGSELEPLVDVLQGGELAYDTHGEAVNADEIEEIDDEPSD 168

>Smik_7.19 Chr7 complement(39474..40019) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  210 bits (534), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 5/170 (2%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA+  EQLLDA+RRNN+DLLE +   L+ +   +AKLIN++++P GNT LH+CCKYGSW
Sbjct: 4   EGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSW 63

Query: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           +VLD +LD +  IEIDPQN V+GDTPLH  V+YS+EEPEHGTFIA NLI+VGADPR++N 
Sbjct: 64  EVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNY 123

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADN-KGTAINENEAEVIDDSPED 169
           + +KPI+L+H D+  +LIDLLQ AELA DN  G A N  + E+IDD   D
Sbjct: 124 NNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNNEDEEMIDDGSSD 173

>Suva_7.19 Chr7 complement(39229..39774) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  208 bits (530), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 130/163 (79%), Gaps = 4/163 (2%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA+  EQLLDA+RRNN+DL+E +   L+ D   +AKLIN++++P GNT LH+CCKYGSW
Sbjct: 4   EGASLSEQLLDAARRNNLDLVETVFDSLDNDPEKIAKLINESREPLGNTALHLCCKYGSW 63

Query: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           +VLD ILD D  IEIDPQN V+GDTPLH  VKYS+EEPEHGTFIA NLI+VGADPRIKN 
Sbjct: 64  EVLDKILDQDGGIEIDPQNDVDGDTPLHVTVKYSQEEPEHGTFIARNLIEVGADPRIKNY 123

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVI 163
           + +KPI+L+H D+  +LIDLLQ AELA D+     +++E+E I
Sbjct: 124 NNQKPIDLVHGDELDELIDLLQGAELAIDSNNGLADKDESEEI 166

>YGL242C Chr7 complement(44652..45197) [546 bp, 181 aa] {ON}
           Putative protein of unknown function; deletion mutant is
           viable
          Length = 181

 Score =  207 bits (528), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 130/164 (79%), Gaps = 5/164 (3%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA+  EQLLDA+RRNN+DLLE +   L+ D   +AKLIN++K+P GNT LH+CCKYGSW
Sbjct: 4   EGASLSEQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCKYGSW 63

Query: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           +VLD ILD D  IEIDPQN V+GDTPLH  V+YS+EEPEHGTFIA NLI+VGADPR++N 
Sbjct: 64  EVLDKILDQDGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNY 123

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADN-KGTAINENEAEVI 163
           + +KP++L+H D+  +LIDLLQ AELA D+  G+  N  + E+I
Sbjct: 124 NNQKPVDLVHGDELDELIDLLQGAELAIDSTNGSGDNNEDGEMI 167

>NDAI0B06270 Chr2 (1518518..1519066) [549 bp, 182 aa] {ON} Anc_3.565
           YGL242C
          Length = 182

 Score =  206 bits (525), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 108/172 (62%), Positives = 130/172 (75%), Gaps = 6/172 (3%)

Query: 4   IEGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCKYGS 60
           +EGA+  EQLLDASRRNNVDLLE I   L+ D   +A LIN  KDP GNT LH+ CKYGS
Sbjct: 3   VEGASLKEQLLDASRRNNVDLLEQIFTTLDNDEEKIADLINTAKDPLGNTALHLSCKYGS 62

Query: 61  WDVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKN 119
           W+VLD ILD +  IEIDP+N ++GDTPLH+ V+Y+++EPEHG FIA NLI+VGADPRI+N
Sbjct: 63  WEVLDKILDQEGDIEIDPKNDMDGDTPLHSAVRYAQDEPEHGEFIAQNLIEVGADPRIRN 122

Query: 120 NSGRKPIELIHNDKFTDLIDLLQSAELAADNK--GTAINENEAEVIDDSPED 169
           N  +KPI+LIH D F  LIDLLQ AELAADN+         E E+IDD P+D
Sbjct: 123 NHNQKPIDLIHGDDFDSLIDLLQGAELAADNRGNIENEEGEEEELIDDGPDD 174

>KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 171

 Score =  204 bits (518), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 128/169 (75%), Gaps = 5/169 (2%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFILEQ---DSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA+  EQLLDASRRNN DLL  +LE    D   +  LIND+KDP GNT +H+C KYGSW
Sbjct: 3   EGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGSW 62

Query: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           DVLD +LD +  ++++ QN ++GDT LH  V YS +EPE+GTFIA NLI+VGADPRI+N 
Sbjct: 63  DVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRNK 121

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPED 169
            G+ P++L+H+D+   L++LLQ AE+AADNKG  INE +AE IDD PED
Sbjct: 122 RGQTPLQLVHSDELESLVNLLQGAEIAADNKGKIINEEDAEEIDDGPED 170

>CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242c
          Length = 172

 Score =  202 bits (515), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 125/164 (76%), Gaps = 4/164 (2%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFILE---QDSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA+ GEQLLDASRRNN DLL  I E    D+  +A+LIN +KDP GNT LH+CCKYGSW
Sbjct: 4   EGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSW 63

Query: 62  DVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNS 121
           +VLDTILD +  I+IDPQNV+GDTPLH  V+Y +EEPEHG FIA NLI+VGADPRIKN +
Sbjct: 64  EVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNIN 123

Query: 122 GRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDD 165
            + P++L+H D   +LIDLLQ A LAADN       +E E+IDD
Sbjct: 124 NQLPLDLVHGDDKDELIDLLQGAALAADNY-DGDEGDEPELIDD 166

>KLTH0G00770g Chr7 complement(52958..53473) [516 bp, 171 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242C Hypothetical ORF
          Length = 171

 Score =  199 bits (506), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (78%), Gaps = 5/169 (2%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFILEQDSN---IVAKLINDTKDPFGNTCLHMCCKYGSW 61
           +GA+  EQLLDASRRNNVDLLE + ++  N    +A LIN   DP GN+ LH+CC YGSW
Sbjct: 3   DGASLREQLLDASRRNNVDLLETVFQELGNNEAQIADLINTAHDPMGNSGLHLCCMYGSW 62

Query: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           DVLD ILD +  IEID +N VEGDTPLH  V+Y+ EEPEHGTFIA NLI+VGADPRI N 
Sbjct: 63  DVLDVILDQEGGIEIDSKNKVEGDTPLHCAVRYAIEEPEHGTFIARNLIEVGADPRIVNQ 122

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPED 169
           +G+KPI+L+H D+  DLIDLLQ AELAA+N+G A+NE +AEVIDD P+D
Sbjct: 123 AGQKPIDLVHGDELDDLIDLLQGAELAAENQG-AVNEEDAEVIDDGPDD 170

>Kpol_507.11 s507 complement(58716..59285) [570 bp, 189 aa] {ON}
           complement(58716..59285) [570 nt, 190 aa]
          Length = 189

 Score =  199 bits (506), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 107/153 (69%), Positives = 125/153 (81%), Gaps = 4/153 (2%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFILE---QDSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA+  EQLLD SRRNNVDLL+ ILE    D   +A LIN +KDPFGNT LH+CCKYGSW
Sbjct: 4   EGASLSEQLLDLSRRNNVDLLDTILETLENDPEKIAGLINTSKDPFGNTALHLCCKYGSW 63

Query: 62  DVLDTILDVDCPIEIDPQNV-EGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           +VLD ILD +  IEIDP+N  +GDTPLH  V+YS EEPEHGTFIASNLI+VG+DPRIKNN
Sbjct: 64  EVLDKILDQEGDIEIDPKNTTDGDTPLHVTVRYSMEEPEHGTFIASNLIEVGSDPRIKNN 123

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGT 153
           S +KPI+LIH D+  DLIDLLQ AE+AAD++GT
Sbjct: 124 SNQKPIDLIHGDELDDLIDLLQGAEIAADSRGT 156

>Kwal_47.19262 s47 (1160155..1160670) [516 bp, 171 aa] {ON} YGL242C
           - Hypothetical ORF [contig 344] FULL
          Length = 171

 Score =  198 bits (503), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 133/169 (78%), Gaps = 5/169 (2%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFILEQ---DSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           +GA++ EQLLDASRRNNVDLLE + ++   D   +A+LIN   DP GN+ LH+CCK GSW
Sbjct: 3   QGASFREQLLDASRRNNVDLLETVFQELNNDEKKIAELINTAHDPMGNSSLHLCCKSGSW 62

Query: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           +VLD ILD +  IEID +N VEGDTPLH  V+Y+ EEPEHGTFIA NLI+VGADPRI N 
Sbjct: 63  EVLDIILDQEGGIEIDCKNSVEGDTPLHVTVRYAIEEPEHGTFIARNLIEVGADPRIINK 122

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDDSPED 169
           +G+KP++L+H +   DL+DLLQ AELAA+N G  +NE++AE+IDD PED
Sbjct: 123 AGQKPLDLVHGNDLDDLVDLLQGAELAAENHGV-VNEDDAELIDDGPED 170

>TDEL0D06330 Chr4 (1138062..1138601) [540 bp, 179 aa] {ON} Anc_3.565
           YGL242C
          Length = 179

 Score =  193 bits (491), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 98/159 (61%), Positives = 123/159 (77%), Gaps = 5/159 (3%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFILEQDSN---IVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA+YGEQLL+ASRRNNVDLL  ILE   N    +A+++N +KDPFGNT LH+CCK GSW
Sbjct: 4   EGASYGEQLLEASRRNNVDLLNDILESVKNDPVKIAEIVNFSKDPFGNTALHLCCKSGSW 63

Query: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           +VLD +LD    IEIDPQN ++GDTPLH  V+Y+++EPEHGTFIA NLI+VGADPR++N 
Sbjct: 64  EVLDILLD-QGDIEIDPQNKLDGDTPLHFTVRYAQDEPEHGTFIARNLIEVGADPRLRNK 122

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENE 159
             +KPI+LIH++   +L DLLQ AELA D  G    E+E
Sbjct: 123 HNQKPIDLIHSEDLDELTDLLQGAELAIDMGGHQAEEDE 161

>TPHA0A05990 Chr1 (1356065..1356595) [531 bp, 176 aa] {ON} Anc_3.565
           YGL242C
          Length = 176

 Score =  192 bits (488), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 116/153 (75%), Gaps = 4/153 (2%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFILEQ---DSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA+  EQLLD +RRNN DL   ILE    D+  +++LIN ++DPFGNT LH+ C+YGSW
Sbjct: 4   EGASLNEQLLDCARRNNEDLFNSILESLGNDTYNISELINTSRDPFGNTALHLACQYGSW 63

Query: 62  DVLDTILDVDCPIEIDPQNV-EGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           +VLD ILD +  IEIDPQN  +GDTPLH  VKY+  EPEHGTFIA NLI+VGADPRI+NN
Sbjct: 64  EVLDKILDQEGDIEIDPQNTTDGDTPLHVTVKYAHNEPEHGTFIAKNLIEVGADPRIRNN 123

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADNKGT 153
              +PI+ IH D+  +LIDLLQ AE++ADN G 
Sbjct: 124 RNERPIDCIHGDELEELIDLLQGAEISADNGGV 156

>KNAG0D02950 Chr4 (532378..532902) [525 bp, 174 aa] {ON} Anc_3.565
           YGL242C
          Length = 174

 Score =  189 bits (480), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 130/164 (79%), Gaps = 5/164 (3%)

Query: 4   IEGATYGEQLLDASRRNNVDLLEFILEQ---DSNIVAKLINDTKDPFGNTCLHMCCKYGS 60
           ++GA+  EQLLDASRRNN DLLE + +Q   D   +A+LIN  +DP GNT LH+CCKYGS
Sbjct: 3   VKGASLSEQLLDASRRNNDDLLEQVFKQLDNDPGKIAELINTARDPMGNTALHLCCKYGS 62

Query: 61  WDVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKN 119
           W+VLD ILD +  IEIDP+N ++GDTPLH  V+Y+ +EPEHGTFIA+NL++VGAD RIKN
Sbjct: 63  WEVLDKILDQEGDIEIDPRNELDGDTPLHLAVRYAMDEPEHGTFIANNLVEVGADARIKN 122

Query: 120 NSGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVI 163
           N+ +KP++LIH D+  DL DLLQ AELA D+ G AINE+E E+I
Sbjct: 123 NNNQKPVDLIHGDELDDLFDLLQGAELARDHPG-AINEDEVELI 165

>ZYRO0E09482g Chr5 (756328..756855) [528 bp, 175 aa] {ON} highly
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 175

 Score =  185 bits (469), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 97/150 (64%), Positives = 121/150 (80%), Gaps = 5/150 (3%)

Query: 5   EGATYGEQLLDASRRNNVDLLEFILEQ---DSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61
           EGA++GEQLLDASRRNN+DLL+ + E    D   +++LIN+++DP G+T LH+CC+YGSW
Sbjct: 4   EGASFGEQLLDASRRNNIDLLKMVFEGLGGDPERISELINESRDPLGDTALHLCCRYGSW 63

Query: 62  DVLDTILDVDCPIEIDPQNV-EGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120
           +VLD ILD D  IEIDPQN  E DTPLH  V+Y+ +EPEHGTFIA NL++VGADPRIKN 
Sbjct: 64  EVLDEILDQDG-IEIDPQNTKELDTPLHVTVRYAHDEPEHGTFIARNLVEVGADPRIKNM 122

Query: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADN 150
           +G KP++LIH D   +LIDLLQ AELAADN
Sbjct: 123 NGDKPVDLIHGDDLDELIDLLQGAELAADN 152

>TBLA0I03490 Chr9 (839793..840320) [528 bp, 175 aa] {ON} Anc_3.565
           YGL242C
          Length = 175

 Score =  183 bits (465), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 87/151 (57%), Positives = 113/151 (74%), Gaps = 4/151 (2%)

Query: 1   MDEIEGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCK 57
           M   +GA+Y EQLL+A+RRNN+DLL  I   L  D   +A L+N++KD FGNT LH+C K
Sbjct: 1   MSTTQGASYSEQLLEAARRNNIDLLNNIVTGLNNDPTKIAHLLNESKDAFGNTALHLCAK 60

Query: 58  YGSWDVLDTILDVDCPIEIDPQNV-EGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPR 116
           +GSWDVLD +LD +  IE+DPQN+ +GDTPLH  V+ +++EPE GTFIA NLI VGADPR
Sbjct: 61  HGSWDVLDKLLDQEGDIEVDPQNITDGDTPLHCAVRLAQDEPEEGTFIAKNLIAVGADPR 120

Query: 117 IKNNSGRKPIELIHNDKFTDLIDLLQSAELA 147
           I+N   +KP++LIH +  T L+D LQ AELA
Sbjct: 121 IRNKQNQKPVDLIHGNSLTALVDTLQGAELA 151

>NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.565
           YGL242C
          Length = 186

 Score =  182 bits (461), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 116/150 (77%), Gaps = 4/150 (2%)

Query: 4   IEGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCKYGS 60
           +EGA+  EQLLDASRRNNVDLLE     L+ D   +A LIN  KDP GNT LH+  KYGS
Sbjct: 3   VEGASLKEQLLDASRRNNVDLLEQAFNDLDNDPKKIADLINTAKDPLGNTALHLASKYGS 62

Query: 61  WDVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKN 119
           W+VLD ILD+D  IEIDPQN ++GDTPLH  V+Y++EEPEHGTFIA NLI+VGAD RI N
Sbjct: 63  WEVLDKILDLDGDIEIDPQNDIDGDTPLHEAVRYAKEEPEHGTFIAQNLIEVGADARIAN 122

Query: 120 NSGRKPIELIHNDKFTDLIDLLQSAELAAD 149
              +KP++LIH D+  DL+DLLQ AELAAD
Sbjct: 123 KHNQKPVDLIHGDELDDLVDLLQGAELAAD 152

>TBLA0F04020 Chr6 (993029..993688) [660 bp, 219 aa] {ON} Anc_6.319
           YCR051W
          Length = 219

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 73/153 (47%), Gaps = 15/153 (9%)

Query: 16  ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIE 75
           A+    +DL+E  L  D+ ++A    ++KDP G T +H    YG  D+L  +L      +
Sbjct: 6   AASDGRIDLVEKFLNNDNGLIA----NSKDPNGYTPIHAAAAYGHVDLL-RLLCQKYNGD 60

Query: 76  IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND-KF 134
           I+  + +GDTPLH       E+ E    I   L   G    +KNN G+  +E+   D +F
Sbjct: 61  INILDNDGDTPLHHC-----EDVETAKVIIEEL---GGGYNLKNNEGKTALEVFEEDSEF 112

Query: 135 TDLIDLLQ-SAELAADNKGTAINENEAEVIDDS 166
            DLI  L+  + +  D     IN+ +  +  DS
Sbjct: 113 PDLIMYLREKSGIPQDQDSLGINQEQLAMFQDS 145

>NDAI0I00510 Chr9 complement(104836..105474) [639 bp, 212 aa] {ON}
           Anc_6.319 YCR051W
          Length = 212

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 11/120 (9%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHG 101
           ++KDP G T +H    YG  D+L ++   +   +I+ ++ +GDTPLH    Y+      G
Sbjct: 29  NSKDPNGYTPIHAAAAYGHIDLLRSLCS-EFGGDINIRDNDGDTPLHHCEDYAT-----G 82

Query: 102 TFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLL-QSAELAADNKGTAINENE 159
             I   L   G +  + NN G+ P+E++  D + T+LI  L + + ++ +N    +NE E
Sbjct: 83  KVIVEEL---GGNFTLTNNEGKTPLEVVEEDGESTELIQYLKEKSGISVENDSLGLNEEE 139

>KLTH0A06248g Chr1 (524183..524791) [609 bp, 202 aa] {ON} similar to
           uniprot|P25631 Saccharomyces cerevisiae YCR051W
           Hypothetical ORF
          Length = 202

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHG 101
           ++KDP G T +H    YG  D+L  +        ++ ++ +GDTPLH       E+    
Sbjct: 26  ESKDPNGYTPIHAAASYGHIDLLRELCSAPYSGSVNVRDNDGDTPLHHC-----EDANTA 80

Query: 102 TFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLLQ 142
             I   L ++G D ++ NN G+  + +   D +FTDLI  L+
Sbjct: 81  RVI---LEELGGDAKLTNNEGKTALAVCEEDGEFTDLIQYLR 119

>Smik_3.153 Chr3 (212077..212817) [741 bp, 246 aa] {ON} YCR051W
           (REAL)
          Length = 246

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 69/146 (47%), Gaps = 13/146 (8%)

Query: 16  ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIE 75
           A+   NVD +E IL ++SN    +   TKD  G T +H    YG  D+L  +   +   +
Sbjct: 32  AASDGNVDRVERIL-RESN--GSMTPQTKDINGYTPMHAAAAYGHTDLLKKMCS-EYNGD 87

Query: 76  IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIE-LIHNDKF 134
           I+  + +GDTPLH V     E+      I   L   G D  I+N  G+ P +  + N + 
Sbjct: 88  INVLDNDGDTPLHHV-----EDVGTAKLIVEEL---GGDFTIRNAEGQTPYDSFVENGED 139

Query: 135 TDLIDLLQSAELAADNKGTAINENEA 160
            +LI+ ++     AD+ G   ++ E 
Sbjct: 140 GELIEYMRIKSGVADSHGADGSQGEG 165

>Kpol_1028.58 s1028 complement(133357..133983) [627 bp, 208 aa] {ON}
           complement(133357..133983) [627 nt, 209 aa]
          Length = 208

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 10/116 (8%)

Query: 28  ILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL 87
           ++E+  N    L  ++KDP G T +H    YG   +L+ +   +   +I+ ++ +GDTPL
Sbjct: 14  VVEKYLNSGNGLTANSKDPNGYTPVHAAAAYGHIGLLEKLCK-EYGGDINVRDSDGDTPL 72

Query: 88  HTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLLQ 142
           H V     E+     FI   L     D ++ N  G+  +E+   D +F +LI  ++
Sbjct: 73  HHV-----EDANTARFIVEEL---NGDYKLTNEEGKTALEVFEEDSEFPELIQYMR 120

>Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON}
           similar to Ashbya gossypii AAR063C
          Length = 207

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 63/118 (53%), Gaps = 15/118 (12%)

Query: 25  LEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGD 84
           +E +L+Q   + A    ++KDP G T +H    YG  D+L  +++     +I+ ++ +GD
Sbjct: 15  VEKLLQQQPGLTA----NSKDPNGYTAVHGAASYGHVDLLRLLVN-KYHGDINVRDNDGD 69

Query: 85  TPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLIDLLQ 142
           TPLH    ++E+       I     ++ AD +  NN G+ P+++   D+ +  I+L+Q
Sbjct: 70  TPLH----HTEDVATAKVIIE----ELNADFQATNNEGKTPLDVFEEDQES--IELIQ 117

>NCAS0D04430 Chr4 (843610..844302) [693 bp, 230 aa] {ON} Anc_6.319
          Length = 230

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 11/127 (8%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHG 101
           ++KDP G T +H    YG  D+L  +L      +++ ++ +GDTPLH       E+ E  
Sbjct: 43  NSKDPNGYTPIHAAAAYGHKDLL-RLLCSTYNGDVNVRDSDGDTPLHHC-----EDLETA 96

Query: 102 TFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLLQ-SAELAADNKGTAINENE 159
           T I   L     D  I NN G+  ++    D +F DLI  ++  + +  +     +N+ E
Sbjct: 97  TMIIEEL---NGDFTIANNEGKTALQTFEEDGEFPDLIQYMREKSGIPVEQDSLGLNQEE 153

Query: 160 AEVIDDS 166
                DS
Sbjct: 154 LAQFKDS 160

>KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa]
           {ON} Anc_2.257 YIL112W
          Length = 1068

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLH 88
           K+ FG+T LH  C  G +D++  IL+ D  I+I  ++  G+TPLH
Sbjct: 332 KNAFGSTKLHTACNKGKYDIVKQILE-DDEIDIHDRDNAGNTPLH 375

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 41/99 (41%), Gaps = 24/99 (24%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL-------HT-VVKYSE 95
           +D  GNT LH     G  D++  +L  +  I       + DTPL       H  V+KY  
Sbjct: 366 RDNAGNTPLHEAALGGHLDIVKLLLQYNAEINCISFESDRDTPLTDAANNGHVDVIKY-- 423

Query: 96  EEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI--HND 132
                       L++ GADP   N +G    EL+  HND
Sbjct: 424 ------------LLRHGADPTHVNTAGLTAYELLEQHND 450

>Suva_3.89 Chr3 (127217..127888) [672 bp, 223 aa] {ON} YCR051W
           (REAL)
          Length = 223

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 74/152 (48%), Gaps = 14/152 (9%)

Query: 16  ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIE 75
           A+   NV+ +E IL +DSN    +   +KD  G T +H    YG  D+L  +  V    +
Sbjct: 8   AASDGNVERVESIL-RDSN--GAMTPQSKDVNGYTPMHAAAAYGHADLLKKLCSV-YNGD 63

Query: 76  IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIE-LIHNDKF 134
           I+  + +GDTPLH V     E+      I   L   G +  I+N  G+ P +  + N + 
Sbjct: 64  INVLDNDGDTPLHHV-----EDVATARLIVEEL---GGNVTIRNAEGQTPYDSFVENGED 115

Query: 135 TDLIDLLQSAELAADNKGTAINENEAEVIDDS 166
            +LI+ ++     AD   ++++ ++ E I +S
Sbjct: 116 GELIEYMRIKSGVAD-AASSVDGSQGEGIVNS 146

>CAGL0C03003g Chr3 (297244..297864) [621 bp, 206 aa] {ON} similar to
           uniprot|P25631 Saccharomyces cerevisiae YCR051w
          Length = 206

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 65/140 (46%), Gaps = 16/140 (11%)

Query: 34  NIVAKLIND-----TKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLH 88
           +IV K + D     +KDP G T +H    YG  D+L  +   +   +I+ ++ +GDTPLH
Sbjct: 13  DIVEKFLADGLSANSKDPNGYTPVHAAAAYGHLDLLRKLCQ-EHGGDINVRDSDGDTPLH 71

Query: 89  TVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLLQ-SAEL 146
                  E+      I   L   G D  + N+ G+  +++   D +F +LI  ++  + L
Sbjct: 72  HC-----EDVRVAQLIVEEL---GGDYTLTNDEGKTALQVFEEDAEFPELIQYMRVKSGL 123

Query: 147 AADNKGTAINENEAEVIDDS 166
             D     I++++     DS
Sbjct: 124 NKDEDSLGIDQDQLAQFKDS 143

>AAR063C Chr1 complement(453099..453761) [663 bp, 220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR051W
          Length = 220

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 10/103 (9%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHG 101
           + KDP G T +H    YG  D+L  +L  +   +++ ++ +GDTPLH          E  
Sbjct: 27  NVKDPNGYTPMHAAAAYGHIDLL-RLLIANYRGDVNVRDNDGDTPLHHA--------EDL 77

Query: 102 TFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLLQS 143
             +   + ++GADP + N  G  P+ +  +D +  +LI+ +++
Sbjct: 78  QTVRVLVEELGADPSLLNADGNTPLAVYEDDAENAELIEYMRA 120

>KNAG0I02590 Chr9 complement(499721..500365) [645 bp, 214 aa] {ON}
           Anc_6.319 YCR051W
          Length = 214

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query: 16  ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTI-LDVDCPI 74
           A+    +D+++  L   + + A    ++ DP G T +H    YG  D+L T+  + D  I
Sbjct: 6   AASDGRLDVVKSFLTDSTGLTA----NSADPNGYTPIHAAAAYGHIDMLRTLCREYDGDI 61

Query: 75  EIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI-HNDK 133
            I  ++ +GDTPLH +     E+    TFI   L        + NN G+  +++   N +
Sbjct: 62  NI--RDADGDTPLHHI-----EDVATATFIIEEL---NGAYNLTNNEGKTALQVFEENAE 111

Query: 134 FTDLIDLLQ 142
             DLI+ ++
Sbjct: 112 DPDLIEYMK 120

>KAFR0J02500 Chr10 (476605..477243) [639 bp, 212 aa] {ON} Anc_6.319
           YCR051W
          Length = 212

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 60/121 (49%), Gaps = 14/121 (11%)

Query: 23  DLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVE 82
           +L+E  L ++ ++ A    +TKDP G T +H    YG  D+L  +   +   +++ ++ +
Sbjct: 13  ELVEKFLNENPSLSA----NTKDPNGYTPVHAAAAYGHHDLLRKLCS-EYNGDVNIRDAD 67

Query: 83  GDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLL 141
           GDTPLH       E+      I   L     D  + NN G+  +++   D +F +LI+ +
Sbjct: 68  GDTPLHHC-----EDVNTARLIIEEL---NGDFSLVNNEGKTALQVFEEDGEFPELIEYM 119

Query: 142 Q 142
           +
Sbjct: 120 R 120

>Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051W -
           Hypothetical ORF [contig 15] FULL
          Length = 202

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 9/103 (8%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHG 101
           ++KDP G T +H    Y   D+L  +        I+ ++ +GDTPLH          E  
Sbjct: 26  ESKDPNGYTPIHAAASYAHIDLLKKLCSDPYNGNINVKDNDGDTPLHHC--------EDA 77

Query: 102 TFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLLQS 143
           T     L ++G D  + NN G+  + +   D +  +LI  L++
Sbjct: 78  TTARVILEELGGDATLTNNEGKTALAVCEEDAENAELITYLRT 120

>SAKL0A01870g Chr1 complement(167727..168347) [621 bp, 206 aa] {ON}
           highly similar to gnl|GLV|CAGL0C03003g Candida glabrata
           CAGL0C03003g and similar to YCR051W uniprot|P25631
           Saccharomyces cerevisiae YCR051W Hypothetical ORF
          Length = 206

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 18/123 (14%)

Query: 33  SNIVAKLIND-----TKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL 87
           +++V + +N+     ++DP G T +H    Y   ++L  +       +I+ ++ +GDTPL
Sbjct: 12  TDLVEQFLNNGLSANSRDPNGYTPIHAAASYAHTELLRKLCSEPYNGDINVRDNDGDTPL 71

Query: 88  HTVVKYSEEEPEHGTFIASNLI--QVGADPRIKNNSGRKPIELIHND-KFTDLIDLLQSA 144
           H     +          A+ +I  ++G D ++ N+ G+  +E    D +F +LI  ++  
Sbjct: 72  HHCEDVN----------AAKVIIEELGGDYKLTNDEGKTALEAFEEDGEFPELIQYMRQV 121

Query: 145 ELA 147
             A
Sbjct: 122 SGA 124

>KLLA0C09108g Chr3 complement(795433..796059) [627 bp, 208 aa] {ON}
           similar to uniprot|P25631 Saccharomyces cerevisiae
           YCR051W Hypothetical ORF
          Length = 208

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 10/102 (9%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTF 103
           KD  G T +H    YG  D+L  ++  +   +++ ++ + DTPLH          E  T 
Sbjct: 28  KDENGYTPIHAAAAYGHIDLLKKLVQ-EHNGDVNIKDSDNDTPLHHC--------EDATT 78

Query: 104 IASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLIDLLQSAE 145
             S + Q+GAD  + NN G+   + +  +   D +DLL+ AE
Sbjct: 79  ARSLIEQLGADRELLNNEGKTCFQ-VWQETCDDNLDLLRYAE 119

>Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W
           (REAL)
          Length = 1141

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 28/110 (25%)

Query: 34  NIVAKLINDT------KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL 87
           ++V K+I D       +D  GNT LH     G  ++++ +++    + I    + GDTPL
Sbjct: 401 DVVQKMIEDGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPL 460

Query: 88  -------HT-VVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
                  H  VVKY              L++ GADP I+N+ G    E +
Sbjct: 461 IDASANGHLDVVKY--------------LLKQGADPTIRNSKGLTAFESV 496

 Score = 32.0 bits (71), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTF 103
           +D  G T L + C  G +DV+  +++ D   +I+ Q+  G+T LH        E      
Sbjct: 383 RDSGGRTRLQIACDKGKFDVVQKMIE-DGGYDINDQDNAGNTALHEAALQGHIE------ 435

Query: 104 IASNLIQVGADPRIKN 119
           I   LI+ GAD  IK+
Sbjct: 436 IVELLIENGADVNIKS 451

>ZYRO0D08690g Chr4 complement(747083..747709) [627 bp, 208 aa] {ON}
           highly similar to gnl|GLV|CAGL0C03003g Candida glabrata
           CAGL0C03003g and similar to YCR051W uniprot|P25631
           Saccharomyces cerevisiae YCR051W Hypothetical ORF
          Length = 208

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 65/136 (47%), Gaps = 18/136 (13%)

Query: 33  SNIVAKLIND-------TKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDT 85
           +++V KL+ +        KDP G T +H    YG  ++L  +   +    I+ ++ +GDT
Sbjct: 12  TSVVEKLLQENYQRDGNVKDPNGYTPVHAAAAYGHIELLRKLCQ-EYGGNINVKDSDGDT 70

Query: 86  PLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLLQ-S 143
           PLH        E  H   +   L ++G D  ++N  G+  ++    D +F +LI  L+  
Sbjct: 71  PLHHC------EDAHTAKVI--LEELGGDISLQNEEGKTALQSAEEDGEFPELIQYLRIK 122

Query: 144 AELAADNKGTAINENE 159
           + ++AD     I+ ++
Sbjct: 123 SGISADEGSLGIDADQ 138

>KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} similar
           to uniprot|P09959 Saccharomyces cerevisiae YLR182W SWI6
           Transcription cofactor forms complexes with DNA-binding
           proteins Swi4p and Mbp1p to regulate transcription at
           the G1/S transition involved in meiotic gene expression
           localization regulated by phosphorylation potential
           Cdc28p substrate
          Length = 663

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 8/72 (11%)

Query: 59  GSWDVLDTILDVDCPIE--IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPR 116
           G  D++ T +D+   I   ++ +++ GDT L+   +           I   L+  GADPR
Sbjct: 331 GDADIIMTTVDLKWFISHVLNARDINGDTCLNIASRLG------NVSIVEALLDYGADPR 384

Query: 117 IKNNSGRKPIEL 128
           I NNSG +P++ 
Sbjct: 385 ISNNSGLRPVDF 396

>Smik_16.74 Chr16 complement(142064..142750) [687 bp, 228 aa] {ON}
           YGR232W (REAL)
          Length = 228

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 13/121 (10%)

Query: 23  DLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNV- 81
           ++  F+L +  N+    ++D  D  G T  H+ C  G+ DV+ ++ D   PI+ D   V 
Sbjct: 50  EITSFLLSKMENVN---LDDYSDDSGWTPFHIACSVGNLDVVKSLYDR--PIKPDLNKVT 104

Query: 82  -EGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLIDL 140
            +G T LH  V     E      ++  LI  GA  RIK+   + P+    +     LI+L
Sbjct: 105 NQGVTCLHLAVGKKWFE------VSQFLITNGASVRIKDKFNQIPLHRAASVGSLKLIEL 158

Query: 141 L 141
           L
Sbjct: 159 L 159

>TDEL0A07340 Chr1 (1284474..1285121) [648 bp, 215 aa] {ON} Anc_6.319
           YCR051W
          Length = 215

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 14/121 (11%)

Query: 23  DLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVE 82
           D++E +L Q++ + A    ++KDP G T +H    YG  ++L  +       +I+ ++ +
Sbjct: 13  DVVEQLLAQNNGLNA----NSKDPNGYTSVHAAAAYGHIELLKKLCK-QYNGDINIRDND 67

Query: 83  GDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLIDLL 141
           GDTPLH       E+      I   L   G D  + N  G+  ++    D +F +LI  +
Sbjct: 68  GDTPLHHC-----EDVNTAKIIVEVL---GGDISLTNEEGKTALQSFEEDAEFPELIQYM 119

Query: 142 Q 142
           +
Sbjct: 120 R 120

>TPHA0D03790 Chr4 (797282..797923) [642 bp, 213 aa] {ON} Anc_6.319
           YCR051W
          Length = 213

 Score = 36.2 bits (82), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 14/128 (10%)

Query: 16  ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIE 75
           A+    +DL+E  L  ++ +      ++KD  G T +H    YG  D+L  + + +   +
Sbjct: 6   AASDGRIDLVEKFLNSNTGVTV----NSKDENGYTPVHAAAAYGHNDLLRKLCN-EYNGD 60

Query: 76  IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND-KF 134
           I+ ++ +GDTPLH V     E+      I   L     D ++ NN  +  +E    D +F
Sbjct: 61  INIRDFDGDTPLHHV-----EDVNTAKVIIEEL---DGDFKLTNNEDKTALETFEEDSEF 112

Query: 135 TDLIDLLQ 142
            +LI  ++
Sbjct: 113 PELITYMR 120

>KAFR0B04260 Chr2 (884243..884935) [693 bp, 230 aa] {ON} Anc_5.97
           YGR232W
          Length = 230

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 16/120 (13%)

Query: 14  LDASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCP 73
           L  +++ N D+++F+++  +++        KD  G   LH     GS  +++T+   + P
Sbjct: 116 LAVAKKYN-DVVKFLIDNGASV------RIKDKKGQIALHRAAAVGSMKLVETLCQKNSP 168

Query: 74  IEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLI-QVGADPRIKNNSGRKPIELIHND 132
           I     N  G TPL   +     +      IA  L+ Q+GAD  I++++G K +++  ND
Sbjct: 169 INWADSN--GWTPLFHALAEGHAD------IAVGLVNQMGADATIEDSNGLKAVDVSVND 220

>YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subunit
           of the Set3 complex, which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity; potential Cdc28p substrate
          Length = 1083

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 23/98 (23%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL-------HT-VV 91
           IND +D  GNT LH     G  ++++ +++    + I    + GDTPL       H  VV
Sbjct: 357 IND-QDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVV 415

Query: 92  KYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
           KY              L++ GADP I+N  G    E +
Sbjct: 416 KY--------------LLKNGADPTIRNAKGLTAFESV 439

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTF 103
           +D  G T L + C  G +DV+  +++ +   +I+ Q+  G+T LH        E      
Sbjct: 326 RDSGGRTRLQIACDKGKYDVVKKMIE-EGGYDINDQDNAGNTALHEAALQGHIE------ 378

Query: 104 IASNLIQVGADPRIKN 119
           I   LI+ GAD  IK+
Sbjct: 379 IVELLIENGADVNIKS 394

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 36.2 bits (82), Expect = 0.028,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 12/87 (13%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLH--TVVKYSEEEPE 99
           D+ DP G T LH     G  + ++ +L  D  + +   +  G TPLH  TV  +      
Sbjct: 186 DSPDPTGKTALHWAAYQGDPNTVEALLKFDADVRV--VDTGGFTPLHWATVKGHPH---- 239

Query: 100 HGTFIASNLIQVGADPRIKNNSGRKPI 126
               +   LI+ G+D  +KNN G+  +
Sbjct: 240 ----VLKALIEHGSDVFLKNNDGKNAL 262

>NDAI0D02540 Chr4 (584626..585336) [711 bp, 236 aa] {ON} Anc_5.97
          Length = 236

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 56/119 (47%), Gaps = 15/119 (12%)

Query: 31  QDSNIVAKLINDTKDPFGNTC--------LHMCCKYGSWDVLDTILDVDCPIEIDPQNVE 82
           Q+  IV  L++  KD   +T         +H+    G+ ++L  +++    ++++ Q V+
Sbjct: 54  QNEEIVTYLLSHMKDADVDTLKDDSLWTPIHIASSVGNSNILKQLIE-GRNVDLNLQTVQ 112

Query: 83  GDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLIDLL 141
           G TP+H  V     +      I   L++ GA  RIK+  G+ P+    +     L+++L
Sbjct: 113 GTTPIHLAVSKKHLQ------ICKFLLENGASVRIKDKQGQLPLHRAASIGSMGLVEML 165

>Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W
           (REAL)
          Length = 1085

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 23/98 (23%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL-------HT-VV 91
           IND +D  GNT LH     G  ++++ ++     + I    + GDTPL       H  VV
Sbjct: 353 IND-QDNAGNTALHEAALQGHIEIVELLIKNGADVNIKSIEMFGDTPLIDASANGHLDVV 411

Query: 92  KYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
           KY              L++ GADP I+N  G    E +
Sbjct: 412 KY--------------LLKNGADPTIRNAKGLTAFESV 435

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTF 103
           +D  G T L + C  G +DV+  +++ +   +I+ Q+  G+T LH        E      
Sbjct: 322 RDSGGRTRLQIACDKGKFDVVKNMIE-EGSYDINDQDNAGNTALHEAALQGHIE------ 374

Query: 104 IASNLIQVGADPRIKN 119
           I   LI+ GAD  IK+
Sbjct: 375 IVELLIKNGADVNIKS 390

>NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {ON}
           Anc_3.175
          Length = 1208

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 14/111 (12%)

Query: 20  NNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQ 79
           N   +++F   + SN VA++  + +  F N          S +    +LD++    +DP+
Sbjct: 150 NTAQMMQF---KRSNYVAEIAQEFRTAFNNRDFGHLESILSNNRNAELLDING---MDPE 203

Query: 80  NVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIH 130
              GDT LH  VK      +    +   L++ GADP  +++ G+ PI+L+ 
Sbjct: 204 T--GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDSKGKLPIDLVR 246

>NDAI0B03700 Chr2 complement(925092..928517) [3426 bp, 1141 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1141

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 9/91 (9%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPE 99
           +ND +D  GN+ LH     G  D++  +++ D  + I    +  DTPL        +   
Sbjct: 382 VND-QDNAGNSALHEAALNGHLDIVKLLVEHDANVNIQSYEMFQDTPLF-------DASA 433

Query: 100 HGTF-IASNLIQVGADPRIKNNSGRKPIELI 129
           +G   +   L++ GA+P + N  GR   E I
Sbjct: 434 NGYLDVVEYLLEHGANPTLTNAKGRTACESI 464

>NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa]
           {ON} Anc_2.639
          Length = 408

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 38  KLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSE 95
           + IN+ K   G T +H  C Y  +  L  ++ V   + I  ++ +G+TPLH  ++YS 
Sbjct: 100 RFINE-KGEHGRTPVHFACMYDHFQCLSLLIGVGANLTI--KDEDGETPLHICLEYSS 154

>Ecym_2082 Chr2 (140585..141286) [702 bp, 233 aa] {ON} similar to
           Ashbya gossypii ADL142C
          Length = 233

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 6/76 (7%)

Query: 52  LHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQV 111
           +H+    G +++   +L+ D    +D    +G TPLH       ++      I S+LI+ 
Sbjct: 80  MHVASAVGDYEIFVMLLNHDIKPLLDESTSQGTTPLHLACSKKHQK------IVSSLIER 133

Query: 112 GADPRIKNNSGRKPIE 127
           GA  R K+   R  + 
Sbjct: 134 GASVRTKDKYQRMALH 149

>Kwal_33.13259 s33 (143081..145075) [1995 bp, 664 aa] {ON} YLR182W
           (SWI6) - transcription factor [contig 119] FULL
          Length = 664

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 76  IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIEL 128
           ++ +++ GDT L+   +           I   L+  GADPRI NNSG +P++ 
Sbjct: 351 LNARDINGDTCLNIASRLG------NVSIVEALLDYGADPRISNNSGLRPMDF 397

>NCAS0C01820 Chr3 complement(336290..339691) [3402 bp, 1133 aa] {ON}
           Anc_8.599
          Length = 1133

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 48  GNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASN 107
           G T LH+ CKY S +++  +L      E+  +N  G TPL         E      +   
Sbjct: 485 GETALHIACKYNSPEIVACLLAHGANSEV-VENKLGWTPLFIAAAKGYNE------VLQI 537

Query: 108 LIQVGADPRIKNNSG 122
           L+Q G D  +K+N+G
Sbjct: 538 LLQYGCDVNLKDNAG 552

>KAFR0C00940 Chr3 (189934..193296) [3363 bp, 1120 aa] {ON} Anc_3.175
           YAR042W
          Length = 1120

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 53/111 (47%), Gaps = 11/111 (9%)

Query: 22  VDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNV 81
           V++ + +  + S  +A++    K  F N          S      +LD++    IDP++ 
Sbjct: 138 VNIAQLMQYKKSTYIAEIATAFKLAFNNRDFEHLESILSNQRNAQLLDING---IDPKS- 193

Query: 82  EGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND 132
            GDT LH  VK      +    + + L++ G+DP  ++  GR P+++I N+
Sbjct: 194 -GDTVLHEFVK------KRDVIMCNWLLEHGSDPFKRDAKGRLPVDIIKNN 237

>ZYRO0B15114g Chr2 complement(1233061..1233741) [681 bp, 226 aa]
           {ON} similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 226

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 14/118 (11%)

Query: 16  ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIE 75
           A  + +  + EF+L   +++        KD      LH     GS  ++D +     P+ 
Sbjct: 113 AVSKKHARICEFLLNNGASV------RVKDKRSQLPLHRAAAIGSMGMVDMLCRAGSPL- 165

Query: 76  IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDK 133
            +  + EG TPL   +     +      +A  L++ GADP ++   G K ++   ND+
Sbjct: 166 -NRNDGEGWTPLFHALAEGNGD------VAVLLVKHGADPDLETTDGSKAVDFAVNDQ 216

>NDAI0G03020 Chr7 complement(699746..704233) [4488 bp, 1495 aa] {ON}
           Anc_3.175
          Length = 1495

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 11/109 (10%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
           N++  + I  + SN VA++  + +  F N   +      + D    +LD++    +DP+ 
Sbjct: 313 NLNTAQLIQFKRSNYVAEIAQEFRLAFNNRDFNHLETILNNDRNAQLLDING---MDPET 369

Query: 81  VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
             GDT LH  VK      +    +   L++ GADP  ++  G+ PI LI
Sbjct: 370 --GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDVKGKLPINLI 410

>KNAG0K01700 Chr11 (352052..356122) [4071 bp, 1356 aa] {ON} 
          Length = 1356

 Score = 33.1 bits (74), Expect = 0.34,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 70  VDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
           V  P++++ ++  G+TPLH     S  +      I   L Q   D  + N+ GR PI++ 
Sbjct: 88  VGVPLQLNTRDEFGNTPLHLAAAQSRTK-----VIEFLLEQPDIDETVLNDDGRMPIDMC 142

Query: 130 HNDKFTDLIDLLQS 143
            N    D++ + +S
Sbjct: 143 SNLNVADMMQIYRS 156

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
           YML002W
          Length = 1193

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSE 95
           +ND  D  GN+ LH+     S  +LD   D + PI ++  N +G TPL    KY  
Sbjct: 642 MNDHDDSNGNSLLHILQNNIS-ILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKR 696

>YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Protein
           similar to mammalian oxysterol-binding protein; contains
           ankyrin repeats; localizes to the Golgi and the
           nucleus-vacuole junction
          Length = 1188

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 11/109 (10%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
           N+++ + +  + S  VA+   + +  F N          S      +LD++    +DP+ 
Sbjct: 140 NLNIAQMMQVKRSTYVAETAQEFRTAFNNRDFGHLESILSSPRNAELLDING---MDPET 196

Query: 81  VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
             GDT LH  VK      +    +   L++ GADP  ++  G+ PIEL+
Sbjct: 197 --GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIELV 237

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]
           {ON} some similarities with uniprot|Q04257 Saccharomyces
           cerevisiae YML002w and some similarities with
           uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 48/116 (41%), Gaps = 25/116 (21%)

Query: 42  DTKDPFGNTCLHMC-CKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEH 100
           D  D  GNT LH+  C          IL  D  I ++  N  G TPL T ++Y   E   
Sbjct: 668 DHVDKKGNTLLHILKCNLP-------ILLADKHINVNATNRSGQTPLMTSIRYKRTE--- 717

Query: 101 GTFIASNLIQVGADPRIK-----NNSGRKPIELIHNDKFTDLI---DLLQSAELAA 148
                 N+  +  DPR++      N+     +   +D+ T L+   +LL S  LA 
Sbjct: 718 ------NIRDLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAV 767

>NDAI0A06430 Chr1 (1461045..1464983) [3939 bp, 1312 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1312

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 23/114 (20%)

Query: 22  VDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNV 81
           +++ + +  + SN + K  N   D F    +           L+TIL+   P  +D  ++
Sbjct: 152 LNIAQLMQIERSNYLTKTKNQIHDAFEKNDIK---------TLETILN--TPRNVDVLDI 200

Query: 82  ------EGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
                  GD+ LHT V+    E      + S L++ GADP  KN  G+ P++L+
Sbjct: 201 NYFDQKSGDSLLHTFVRKRNIE------MCSWLLKHGADPHRKNFDGKTPLDLL 248

>Kwal_23.4914 s23 (921368..924499) [3132 bp, 1043 aa] {ON} YIL112W -
           Hypothetical ORF [contig 6] FULL
          Length = 1043

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 50/115 (43%), Gaps = 14/115 (12%)

Query: 19  RNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDP 78
           + N ++ + ++++  N+      D +D  GN+ LH     G  D+++ +L+    + +  
Sbjct: 332 KGNYEVAKRLIQEGYNV------DDQDNAGNSSLHEAALNGHLDIVELLLESGASVNVQS 385

Query: 79  QNVEGDTPLHTVVKYSEEEPEHGTF-IASNLIQVGADPRIKNNSGRKPIELIHND 132
                DTPL            +G   +   L++  ADP I N+ G   IE I  D
Sbjct: 386 HEPIRDTPLIDAAA-------NGHLDVVKVLLRHRADPTITNSKGLTAIESIEED 433

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 19/119 (15%)

Query: 55  CCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGAD 114
             KYG  D+    L      + +  + EG TPL   V          T     L++ GAD
Sbjct: 534 AVKYGHEDITSLFLAFGA--QPNMTSREGQTPLMVSVGRGH------TGTVKLLLEAGAD 585

Query: 115 PRIKNNSGRKPIELIHNDKFTDL-------IDLLQSAELAADNKGTAINENEAEVIDDS 166
           P +K+  GR    +++  K ++L       IDL+Q A ++  ++ T ++ +E+  +D+S
Sbjct: 586 PLVKDKQGR---SVLNYAKRSELGLVSKQEIDLIQDA-ISVKSQNTGVSGDESIDVDNS 640

>Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W
           (REAL)
          Length = 1077

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 23/98 (23%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL-------HT-VV 91
           IND +D  GNT LH     G  ++++ +++    + I    + GDTPL       H  VV
Sbjct: 346 IND-QDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVV 404

Query: 92  KYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
           KY              L++  ADP I+N  G    E +
Sbjct: 405 KY--------------LLKNDADPTIRNAKGLTAFESV 428

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTF 103
           +D  G T L + C  G +DV+  +L+ +   +I+ Q+  G+T LH        E      
Sbjct: 315 RDSGGRTRLQIACDKGKFDVVKKMLE-EGGYDINDQDNAGNTALHEAALQGHIE------ 367

Query: 104 IASNLIQVGADPRIKN 119
           I   LI+ GAD  IK+
Sbjct: 368 IVELLIENGADVNIKS 383

>TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {ON}
           Anc_8.599 YPL110C
          Length = 1246

 Score = 32.3 bits (72), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 7/88 (7%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPE 99
           I+ T D  G T L++  K  ++++   +L      E+ P+ +   TPL           E
Sbjct: 532 IDVTNDESGETALYLASKLNNFEIAKVLLQNGASTEV-PEKLFSWTPLFIAA------VE 584

Query: 100 HGTFIASNLIQVGADPRIKNNSGRKPIE 127
           +   IA  LI+ GA   + + SG  P+E
Sbjct: 585 NNLEIAKLLIEYGAHVYVFDESGWTPLE 612

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVE-GDTPLHTVVKYSEEEPEHGT 102
           KD   +T +++C K    +VL  +  ++C   ID  N E G+T L+   K +  E     
Sbjct: 501 KDSCDDTIIYLCIKANLLEVLRALFSMNC-YNIDVTNDESGETALYLASKLNNFE----- 554

Query: 103 FIASNLIQVGADPRI 117
            IA  L+Q GA   +
Sbjct: 555 -IAKVLLQNGASTEV 568

>KAFR0A00170 Chr1 complement(27115..30279) [3165 bp, 1054 aa] {ON}
           Anc_2.662 YIR033W
          Length = 1054

 Score = 32.3 bits (72), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 57/126 (45%), Gaps = 25/126 (19%)

Query: 32  DSNIVAKLINDTK---------DPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVE 82
           D N++ K+IN            D  G T LH+    G +D+  T+  +     ID ++  
Sbjct: 666 DENLIIKVINSLNKTTSNFSMCDSVGRTLLHLASLKGYYDLTSTL--IQSGARIDDKDSF 723

Query: 83  GDTPLHTVVKYSEEEPEHGTF-IASNLIQVGADPRIKNNSGRKPIEL-IHNDK-----FT 135
           G TPLH           +G++ +   L+   ++P +K+++   P +L I N +     F 
Sbjct: 724 GFTPLHFACI-------NGSYQVIRLLLNCQSNPNVKSSNHLSPKDLFIKNHQPSENDFF 776

Query: 136 DLIDLL 141
            +ID+L
Sbjct: 777 KIIDVL 782

 Score = 32.3 bits (72), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 10  GEQLLD-ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTIL 68
           G  LL  AS +   DL   +++  + I      D KD FG T LH  C  GS+ V+  +L
Sbjct: 691 GRTLLHLASLKGYYDLTSTLIQSGARI------DDKDSFGFTPLHFACINGSYQVIRLLL 744

Query: 69  D 69
           +
Sbjct: 745 N 745

>TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1259

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 28/108 (25%)

Query: 23  DLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVE 82
           DL + +LE++ ++      + +D  GNT LH     G  D++  +++    I +    + 
Sbjct: 526 DLAKKLLEENYDV------NYQDNAGNTALHEAALNGYLDIVKLLIEYGADINLQSYELF 579

Query: 83  GDTPL-------HT-VVKYSEEEPEHGTFIASNLIQVGADPRIKNNSG 122
            DTPL       H  VVK+              L+  GADP I N  G
Sbjct: 580 KDTPLIDASSNGHLDVVKF--------------LLNSGADPLIANAKG 613

>KLTH0C01650g Chr3 complement(146654..147352) [699 bp, 232 aa] {ON}
           similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 232

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTF 103
           KD  G   LH     GS  ++  + D   P+  + ++V+G  PL   +        HG  
Sbjct: 138 KDVRGQLALHRAASVGSIPLVKLLCDERSPV--NAKDVQGWIPLFHALSEG-----HGDV 190

Query: 104 IASNLIQVGADPR-IKNNSGRKPIELIHNDK 133
               + +  A+ R +++NSG+ P++++ +DK
Sbjct: 191 AVILVQEYNAEYRELQDNSGKAPLDVVPDDK 221

>NCAS0B08660 Chr2 (1665156..1667411) [2256 bp, 751 aa] {ON} Anc_1.60
          Length = 751

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 76  IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIEL 128
           ++ Q+V GDT L+   +           I   L++ GADP I N SG +P++ 
Sbjct: 403 LNAQDVNGDTCLNIAARLG------NVGIVDALLEYGADPYIANKSGLRPLDF 449

>TPHA0K00750 Chr11 (155270..157843) [2574 bp, 857 aa] {ON} Anc_7.409
           YER111C
          Length = 857

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 24  LLEFILEQDSNIVA--KLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNV 81
           +LE++   D++ ++  KL  + +D +GNT LH+     +  + + +L + C  ++   N+
Sbjct: 453 ILEYLQSNDNDDISILKLTVNHQDSYGNTILHIAALNNNLKIYNKLLKIGCSEKLT--NM 510

Query: 82  EGDTPLHTVVK 92
             +TPL  + K
Sbjct: 511 NNETPLSIMEK 521

>ZYRO0A05258g Chr1 (424968..429614) [4647 bp, 1548 aa] {ON} some
           similarities with uniprot|Q12451 Saccharomyces
           cerevisiae YDL019C OSH2 Member of an oxysterol-binding
           protein family with seven members in S. cerevisiae
           family members have overlapping redundant functions in
           sterol metabolism and collectively perform a function
           essential for viability
          Length = 1548

 Score = 32.0 bits (71), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 33/120 (27%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
           N+ +   +  + +  VA++  + +  F N        +G    LD+IL       ++P+N
Sbjct: 172 NLSIAHMMQAKRATYVAEIAQEFRTAFNNR------DFGH---LDSIL-------VNPRN 215

Query: 81  VE-----------GDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
            E           GDT LH  VK      +    +   L++ GADP  ++  GR P++L+
Sbjct: 216 AELLDINGMDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFNRDRQGRLPVDLV 269

>TBLA0A00680 Chr1 complement(145681..150165) [4485 bp, 1494 aa] {ON}
            Anc_2.662 YIR033W
          Length = 1494

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 40   INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
            +ND KD FG T LH  C  G++ ++  +L  +    I  QN
Sbjct: 1024 VND-KDSFGFTPLHFACVNGNFKIIKILLSCNADYSIKAQN 1063

>TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3.175
           YAR042W
          Length = 1268

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 11/109 (10%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
           N+++ + +  + ++ VA++  + +  F N          S      +LD++    +DP+ 
Sbjct: 168 NLNIAQMMQVKRAHYVAEIAQEFRTAFNNRDFGHLESILSAPRNAELLDING---MDPET 224

Query: 81  VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
             GDT LH  VK      +    +   L++ GADP  ++  G+ PI+L+
Sbjct: 225 --GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRQGKLPIDLV 265

>KNAG0E01880 Chr5 (389045..392023) [2979 bp, 992 aa] {ON} Anc_2.257
           YIL112W
          Length = 992

 Score = 31.6 bits (70), Expect = 0.94,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 6/88 (6%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHG 101
           D +D  GNT LH     G  D++  +++    + I    + GDTPL         +    
Sbjct: 275 DDQDNAGNTPLHEAALNGHLDIVKLLVETGANVNIQSFAMFGDTPLIDASANGHLD---- 330

Query: 102 TFIASNLIQVGADPRIKNNSGRKPIELI 129
             +   L+  G+DP I N  G    E I
Sbjct: 331 --VVQYLVAHGSDPTITNAKGLTAYEAI 356

>KAFR0H01350 Chr8 complement(253612..255501) [1890 bp, 629 aa] {ON}
           Anc_3.293 YDR049W
          Length = 629

 Score = 31.6 bits (70), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 70  VDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
           VD  ++++P++    TP  T++ Y+ +   H   I   L  + +DPRIKN  GR   +L 
Sbjct: 452 VDVNVKLEPESKYMYTP--TMLHYASQNG-HKRMINVLLSNLRSDPRIKNIHGRTAYDLS 508

Query: 130 HND 132
            N+
Sbjct: 509 KNE 511

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
           Ashbya gossypii ACR006C
          Length = 1079

 Score = 31.6 bits (70), Expect = 0.95,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 10/97 (10%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHG 101
           D +DP GN+ LH+  K G   +L         I ++  N++G TPL    KY+  E    
Sbjct: 617 DHEDPMGNSLLHIM-KGGIQSILS-----QPNINVNKSNIKGMTPLMLYAKYNRIENIRD 670

Query: 102 TFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLI 138
                 LI      +I+N    K I+ + N    +LI
Sbjct: 671 ILEDKRLIV----SKIQNPQTLKAIDYVKNPMILNLI 703

>Kpol_1048.28 s1048 complement(85092..88781) [3690 bp, 1229 aa] {ON}
           complement(85092..88781) [3690 nt, 1230 aa]
          Length = 1229

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILD 69
           KD FG T LH   +YG  D++D I++
Sbjct: 407 KDGFGRTVLHYAAQYGLADLVDIIME 432

>CAGL0D01012g Chr4 (118878..121286) [2409 bp, 802 aa] {ON} similar
           to uniprot|P39678 Saccharomyces cerevisiae YDL056w MBP1
           transcription factor
          Length = 802

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 43/106 (40%), Gaps = 20/106 (18%)

Query: 45  DPFGNTCLHMCCKYGSWD---------VLDTILDVDCPIEID----PQNVEGDTPLHTVV 91
           D  G T LH   K  S           +L  I D+     I+     ++  GDT LH   
Sbjct: 451 DSMGQTVLHHIVKRKSSTPSAIYYVNVLLSKIKDISPKYRIELLLNTKDANGDTALHIAA 510

Query: 92  KYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDL 137
           + ++ E          LI+ G+   I NN G+ P E++ N  + DL
Sbjct: 511 RNNDRE------FFDILIKNGSLSTISNNDGQTPTEIM-NQHYQDL 549

>Skud_1.91 Chr1 (162916..166413) [3498 bp, 1165 aa] {ON} YAR042W
           (REAL)
          Length = 1165

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 11/110 (10%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
           N+++ + +  + S  VA+   + +  F N          S      +LD++    +DP+ 
Sbjct: 139 NLNIAQMMQVKRSTYVAETAQEFRTAFNNRDFAHLESILSSPRNAELLDING---MDPET 195

Query: 81  VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIH 130
             GDT LH  VK      +    +   L++ GADP  ++  G+ PI+L+ 
Sbjct: 196 --GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIDLVR 237

>Kpol_1045.52 s1045 complement(122763..126530) [3768 bp, 1255 aa]
           {ON} complement(122765..126532) [3768 nt, 1256 aa]
          Length = 1255

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 11/91 (12%)

Query: 12  QLLDASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDV- 70
           +LLD+ R +N + L+ +L+ D N   K   D+KD   N  LH   +  + D+++ I+   
Sbjct: 22  KLLDSLRGSNFEELKKLLDTDFNDFDK---DSKD-LKNLVLHYAVQVANLDLIEQIVSSR 77

Query: 71  ------DCPIEIDPQNVEGDTPLHTVVKYSE 95
                     +I+ Q+ +G+TPLH     S 
Sbjct: 78  NGEGSSKIITDINLQDKDGNTPLHLAAAQSR 108

>KNAG0A01560 Chr1 (74485..77964) [3480 bp, 1159 aa] {ON} Anc_5.96
           YGR233C
          Length = 1159

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 11/116 (9%)

Query: 13  LLDASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGS-WDVLDTILDVD 71
           LL A R NN    + IL    N      N  +D  G   LH+  KYG    ++D +++  
Sbjct: 470 LLTACRYNNYGATKIILRL-CNERGIQFNSVQDSHGLGALHLVAKYGGDPSLIDLLIEYG 528

Query: 72  C-PIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPI 126
             P E+D  +++   P+   +K      E    + + L++ GA+  +K++ G+ P+
Sbjct: 529 ADPNELD--SLDNLPPIVYAIK------EGRPLLVNKLLKSGANINMKDDEGKSPL 576

>TBLA0G01550 Chr7 complement(410811..411431) [621 bp, 206 aa] {ON}
           Anc_6.265 YPL239W
          Length = 206

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 17/89 (19%)

Query: 48  GNTCLHMCCKYGSWDVLDTILDVDCP--------IEIDPQNVEGDTPLHTVVKYSEEEPE 99
            +T LH+    G  D++  I+ +  P          I+  N EG+TPLH           
Sbjct: 50  ASTILHILAANGDNDIIKYIISLVRPNTTMEEFEKYINHANKEGNTPLHWA-------SL 102

Query: 100 HGTFIASNLI--QVGADPRIKNNSGRKPI 126
           +G      L+  +  ADP I+NN+G   I
Sbjct: 103 NGKLETVKLLCDEYEADPFIRNNAGHDSI 131

>Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W
           (REAL)
          Length = 1179

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 11/109 (10%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
           N+++ + +  + S  VA+   + +  F N          S      +LD++    +DP+ 
Sbjct: 139 NLNIAQMMQVKRSTYVAETAQEFRTAFNNRDFGHLESILSSPRNAELLDING---MDPET 195

Query: 81  VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
             GDT LH  VK      +    +   L++ GADP  ++  G+ PI+L+
Sbjct: 196 --GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIDLV 236

>KAFR0A00280 Chr1 complement(53403..54566) [1164 bp, 387 aa] {ON}
           Anc_2.639 YMR068W
          Length = 387

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 48  GNTCLHMCCKYGSWDVLDTILDVDCPIE 75
           G T LH+C +YGS+  L  +L  D  I+
Sbjct: 143 GETPLHLCLEYGSYHCLRMLLTYDTSIK 170

>TBLA0B01620 Chr2 complement(356040..359822) [3783 bp, 1260 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1260

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 11/111 (9%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
           NV L + +  + S  V ++  + +  F N          S      +LD++    +DP  
Sbjct: 160 NVSLAQIMQMRRSTYVIEIAQEFRTAFNNRDFQHLESILSKPRNLALLDING---MDP-- 214

Query: 81  VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHN 131
             GDT LH  VK  + +      +   L+  GADP  ++  G+ P EL+ N
Sbjct: 215 ATGDTVLHEFVKKRDVQ------MCEWLLSHGADPFKRDRFGKLPTELLRN 259

>Kpol_1018.105 s1018 complement(274868..278014) [3147 bp, 1048 aa]
           {ON} complement(274868..278014) [3147 nt, 1049 aa]
          Length = 1048

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 22  VDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNV 81
           +D++  IL  +   + K+  + +D  GNT LH+     + D+ +T+L      +I   N 
Sbjct: 637 MDMIIKILGTEDYSLLKMCLNFQDSMGNTVLHLAALNMNIDIYNTLLQFGASADI--ANF 694

Query: 82  EGDTPLHTVVKY 93
             +TP   + KY
Sbjct: 695 NNETPSFILAKY 706

>TPHA0P00580 Chr16 (117136..120909) [3774 bp, 1257 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1257

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 12  QLLDASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTIL--- 68
           +LL+   ++++  L+ + E+D N      N        + LH C + GS +++  ++   
Sbjct: 19  KLLEVLGQSDISQLKVLFERDFNSEDSRNNKYIQDIKKSLLHYCVQVGSLELIKDVVNEF 78

Query: 69  -------DVDCPIEIDPQNVEGDTPLH 88
                  ++   ++I+ Q+  G+TPLH
Sbjct: 79  YQSDNSNELGVKLDINQQDENGNTPLH 105

>Kpol_1037.5 s1037 complement(8144..11782) [3639 bp, 1212 aa] {ON}
           complement(8144..11782) [3639 nt, 1213 aa]
          Length = 1212

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 33/127 (25%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQN 80
           N+++ + +  + SN VA++  + +  F N        +G    L+ IL+       +P+N
Sbjct: 157 NLNIAQMMQYKRSNYVAEIAQEFRMAFNNR------DFGH---LENILN-------NPRN 200

Query: 81  VE-----------GDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
            E           GDT LH  VK      +    +   L++ GADP  ++++G  P+E++
Sbjct: 201 AELLDINGTDPETGDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDSNGVLPVEIL 254

Query: 130 HNDKFTD 136
            N   TD
Sbjct: 255 GNVNDTD 261

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 71  DCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIH 130
           D  ++++ Q++ G+TPLH     S      G  ++  + QV  +  + NN   +PIE+  
Sbjct: 102 DLKLDLNKQDLNGNTPLHLACYQS-----RGDVVSYLMDQVTINDCLANNQRLQPIEVCK 156

Query: 131 NDKFTDLIDLLQSAELA 147
           N     ++   +S  +A
Sbjct: 157 NLNIAQMMQYKRSNYVA 173

>TBLA0A00780 Chr1 complement(168204..170384) [2181 bp, 726 aa] {ON}
           Anc_2.639 YMR068W
          Length = 726

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 10/80 (12%)

Query: 48  GNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASN 107
           G T  H+ C +  +  L  ++ V   + I   N EGDTPLH  ++Y              
Sbjct: 109 GQTPTHIACMHDYYQCLSLLVGVGADLSI--VNDEGDTPLHVCLEYGSVN------CMKM 160

Query: 108 LIQVG--ADPRIKNNSGRKP 125
           LIQ G   D  I+N +  +P
Sbjct: 161 LIQEGNMTDDTIRNRNNWRP 180

>KNAG0C00650 Chr3 (110325..112571) [2247 bp, 748 aa] {ON} Anc_1.60
           YLR182W
          Length = 748

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 6/53 (11%)

Query: 76  IDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIEL 128
           ++ Q+  GDT L+   +           I   L+  GADP I N SG +P++ 
Sbjct: 414 LNAQDYNGDTSLNIAARLG------NVAIVDALLDYGADPYIANKSGLRPVDF 460

>CAGL0H00935g Chr8 (91979..92560) [582 bp, 193 aa] {ON} highly
           similar to uniprot|P46683 Saccharomyces cerevisiae
           YPL239w YAR1 ankyrin repeat-containing protein
          Length = 193

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 7/89 (7%)

Query: 16  ASRRNNVDLLEFILEQ-----DSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDV 70
           A+   +++++++I+EQ     D+  V + +N  ++  GNT LH     G  DV+  + D 
Sbjct: 57  AAANGHLEVVKYIMEQVKQSADAGAVGRYVN-LQNKTGNTALHWATLNGKLDVVQYLCD- 114

Query: 71  DCPIEIDPQNVEGDTPLHTVVKYSEEEPE 99
           +C  +   +N  G  P+       +EE E
Sbjct: 115 ECDADPFVKNEFGHDPIFEAENNGKEEVE 143

>AFR600C Chr6 complement(1517783..1520230) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL056W
           (MBP1)
          Length = 815

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 8/63 (12%)

Query: 101 GTF-IASNLIQVGADPRIKNNSGRKPI---ELIHND----KFTDLIDLLQSAELAADNKG 152
           GT  I   L+Q GA PR  N +G  P+    L+HN      +  +  LLQ      D++ 
Sbjct: 375 GTLPIVEALLQAGASPRALNQAGETPLMRASLVHNSYTKRTYPRIFQLLQDTVFDVDSRS 434

Query: 153 TAI 155
             +
Sbjct: 435 QTV 437

>SAKL0E08382g Chr5 complement(676318..679575) [3258 bp, 1085 aa]
           {ON} similar to uniprot|P40480 Saccharomyces cerevisiae
           YIL112W HOS4 Subunit of the Set3 complex which is a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity potential Cdc28p
           substrate
          Length = 1085

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 38/90 (42%), Gaps = 7/90 (7%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPE 99
           +ND +D  GN+ LH     G  D++  +L+    I I    +  DTPL         E  
Sbjct: 385 VND-QDNAGNSPLHEAALNGHLDIVKLLLEHGADINIQSYEMFKDTPLIDASANGHLE-- 441

Query: 100 HGTFIASNLIQVGADPRIKNNSGRKPIELI 129
               +   L+  GADP I N  G   IE I
Sbjct: 442 ----VVKLLLDHGADPTIVNAKGLTAIESI 467

>Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W
           (REAL)
          Length = 1159

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 23/115 (20%)

Query: 21  NVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDT------ILDVDCPI 74
           N+++ + +  + S  VA+   + +  F N        +G  + + T      +LD++   
Sbjct: 139 NLNIAQMMQVKRSTYVAETAQEFRTAFNNR------DFGHLESILTSPRNAELLDING-- 190

Query: 75  EIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
            +DP+   GDT LH  VK      +    +   L++ GADP  ++  G+ PI+L+
Sbjct: 191 -MDPET--GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIDLV 236

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 49/128 (38%), Gaps = 22/128 (17%)

Query: 45  DPFGNTCLHMCCKYG--------------SWDVLDTILDVDCPIEIDPQNVEGDTPLHTV 90
           DP     LH+   Y                W    T   +D  ++++ Q+  G+TPLH  
Sbjct: 45  DPNVQQVLHLMLHYAVQVAPMAVIKEIVHHWATTGTTF-LDIHLDLNEQDSNGNTPLHIA 103

Query: 91  VKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLIDLLQSAELA--A 148
              S      G  +A  + Q   +  + NNS  + IE+  N     ++ + +S  +A  A
Sbjct: 104 AYQSR-----GDIVAFLMDQPSINDCVLNNSRLQAIEMCKNLNIAQMMQVKRSTYVAETA 158

Query: 149 DNKGTAIN 156
               TA N
Sbjct: 159 QEFRTAFN 166

>ZYRO0C16544g Chr3 (1285279..1287558) [2280 bp, 759 aa] {ON} highly
           similar to uniprot|P31244 Saccharomyces cerevisiae
           YBR114W RAD16 Protein that recognizes and binds damaged
           DNA in an ATP-dependent manner (with Rad7p) during
           nucleotide excision repair subunit of Nucleotide
           Excision Repair Factor 4 (NEF4) member of the SWI/SNF
           family
          Length = 759

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 54/123 (43%), Gaps = 13/123 (10%)

Query: 32  DSNIVAKLIND-TKDPFGNTCLHMCCKYGSWDVLDTILD-----VDCP-------IEIDP 78
           D  IV +L ND  ++P  + C H  C+    + +++ ++     + CP       I++  
Sbjct: 500 DGVIVCQLCNDEAEEPIESKCHHKFCRLCIKEYVESFMEESQKKLTCPVCHIGLSIDLSQ 559

Query: 79  QNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLI 138
           Q++E D                GT+ +S  I+   +      S ++ I+ I   +FT ++
Sbjct: 560 QSIEVDMDSFHKQSIVNRLNMQGTWKSSTKIEALVEELYNLRSDKRTIKSIVFSQFTSML 619

Query: 139 DLL 141
           DL+
Sbjct: 620 DLI 622

>Kwal_14.982 s14 complement(141369..142619) [1251 bp, 416 aa] {ON}
           YMR068W - Hypothetical ORF [contig 244] FULL
          Length = 416

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTIL 68
           +D FGNT LH+C  YGS + +  ++
Sbjct: 138 RDEFGNTALHICLIYGSENCMRMLV 162

>YLR182W Chr12 (517940..520351) [2412 bp, 803 aa] {ON}
           SWI6Transcription cofactor; forms complexes with Swi4p
           and Mbp1p to regulate transcription at the G1/S
           transition; involved in meiotic gene expression; also
           binds Stb1p to regulate transcription at START; cell
           wall stress induces phosphorylation by Mpk1p, which
           regulates Swi6p localization; required for the unfolded
           protein response, independently of its known
           transcriptional coactivators
          Length = 803

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 35  IVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILD 69
           I+A ++N  +D  G+TCL++  + G+  ++D +LD
Sbjct: 458 IIANMLN-AQDSNGDTCLNIAARLGNISIVDALLD 491

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
           YML002W
          Length = 1107

 Score = 30.0 bits (66), Expect = 3.0,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 31  QDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTV 90
           ++++I+ K ++D  D FG++ LH+     S  +    LD++ P      N++G TPL T 
Sbjct: 628 KNNDIIFK-VSDHTDLFGDSLLHILKSQVSLLLKFEDLDINIP------NLKGMTPLMTY 680

Query: 91  VKYS 94
           VKY+
Sbjct: 681 VKYN 684

>TBLA0G00840 Chr7 (200837..205522) [4686 bp, 1561 aa] {ON} Anc_3.175
           YAR042W
          Length = 1561

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 67  ILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPI 126
           +LD++    IDP+   GDT LH  +K      +    +   LI+ G+DP  ++ SG+ P 
Sbjct: 236 LLDING---IDPET--GDTVLHEFIK------KRDVHMCKWLIEHGSDPFKRDRSGKLPS 284

Query: 127 ELIHN 131
           +L+ N
Sbjct: 285 DLLMN 289

>KNAG0M02510 Chr13 complement(465793..467028) [1236 bp, 411 aa] {ON}
           Anc_2.639 YMR068W
          Length = 411

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEE 97
           D K   G+  +H+ C +  +     ++ V   + +  Q+ +G+TPLH  ++Y   E
Sbjct: 103 DAKGENGSAPIHVACMHDYFRCASLLISVGADLSL--QDGQGETPLHICLEYGSTE 156

>TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1007

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 40/98 (40%), Gaps = 23/98 (23%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL-------HT-VV 91
           +ND +D  GNT LH     G  D++  +++    + +    +  DTPL       H  VV
Sbjct: 346 VND-QDNAGNTALHEAALNGHLDIVKLLIENGADVNMQSFEMFKDTPLIDASANGHLDVV 404

Query: 92  KYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
           KY              L+  GADP I N  G    E I
Sbjct: 405 KY--------------LLSHGADPTICNAKGLTAFESI 428

>TBLA0A07030 Chr1 (1721376..1722752) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 13/86 (15%)

Query: 77  DPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKP----IELIHN- 131
            P + EG+TPLH +V  +     H T +   LI+ GAD  I    G  P    +   +N 
Sbjct: 55  SPLDDEGNTPLHWLVSVA-----HVTLV-RRLIEAGADSCIGCARGETPLMRAVSCTNNY 108

Query: 132 --DKFTDLIDLLQSAELAADNKGTAI 155
               F  L+D+L+ + +  D  G  +
Sbjct: 109 DAGTFESLLDILEPSIICVDTLGRTV 134

>ADL244W Chr4 (273377..276646) [3270 bp, 1089 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL112W
          Length = 1089

 Score = 29.6 bits (65), Expect = 4.0,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 7/90 (7%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPE 99
           +ND +D  GN+ LH     G  +V+  ++     + I    +  DTPL         +  
Sbjct: 367 VND-QDNAGNSPLHEAALNGHLEVVKLLIRHGANVNIQSYEMFKDTPLIDASANGHLD-- 423

Query: 100 HGTFIASNLIQVGADPRIKNNSGRKPIELI 129
               I   L+Q GADP I N  G   IE I
Sbjct: 424 ----ILRELLQNGADPTIVNAKGLTAIESI 449

>NDAI0A00600 Chr1 complement(111082..113478) [2397 bp, 798 aa] {ON}
           Anc_1.60 YLR182W
          Length = 798

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 7/57 (12%)

Query: 71  DCPIEID-PQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPI 126
           + P+ ++ P +  G+TPLH +   +         +  NL++ GAD  I +NSG  P+
Sbjct: 293 NTPLNLNIPVDEHGNTPLHWLTTIA------NITLVKNLVENGADRLIGDNSGESPL 343

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 35  IVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDC 72
           I+  ++N  +D  G+TCL++  + G+  ++D++L+  C
Sbjct: 441 IINNMLN-AQDSNGDTCLNIAARLGNVSIVDSLLEYGC 477

>Suva_13.243 Chr13 (387561..388661,388691..388840) [1251 bp, 416 aa]
           {ON} YMR068W (REAL)
          Length = 416

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 13/85 (15%)

Query: 48  GNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASN 107
           G   +H+ C    +  L  ++ V   + +   +  GDTPLH  ++Y       G+     
Sbjct: 109 GRAPIHIACMKNYYQCLSLLIGVGADLWV--MDTNGDTPLHVCLEY-------GSLNCMK 159

Query: 108 LI----QVGADPRIKNNSGRKPIEL 128
           ++    +V  D  +K+N   KPI++
Sbjct: 160 MLVNEGEVSLDDNVKDNGNWKPIDV 184

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 7/81 (8%)

Query: 48  GNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASN 107
           GNTC+H+    G    L  +L    P  I+ +   G  P+H     +  +        S 
Sbjct: 75  GNTCVHLALMKGHEQTLHLLLQ-QFPQFINHRGENGRAPIHIACMKNYYQ------CLSL 127

Query: 108 LIQVGADPRIKNNSGRKPIEL 128
           LI VGAD  + + +G  P+ +
Sbjct: 128 LIGVGADLWVMDTNGDTPLHV 148

>NCAS0F00590 Chr6 complement(117069..117776) [708 bp, 235 aa] {ON}
           Anc_5.97 YGR232W
          Length = 235

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 12/93 (12%)

Query: 44  KDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNV---EGDTPLHTVVKYSEEEPEH 100
           KD  G   LH     GS     T++++ C     P NV   +G TPL     +      H
Sbjct: 142 KDQKGQLPLHRAASIGSM----TLVELLCTQGKSPVNVRDKQGWTPL-----FHALAEGH 192

Query: 101 GTFIASNLIQVGADPRIKNNSGRKPIELIHNDK 133
           G      + +  AD ++++N+G+KP ++  N++
Sbjct: 193 GDIALLLVNKYDADVQLEDNAGKKPADVALNEQ 225

>TDEL0C06420 Chr3 complement(1174443..1176716) [2274 bp, 757 aa]
           {ON} Anc_1.60 YLR182W
          Length = 757

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 36/94 (38%), Gaps = 42/94 (44%)

Query: 35  IVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYS 94
           ++A ++N T D  G+TCL++  + G+  ++D +LD                         
Sbjct: 418 VIANMLNAT-DSNGDTCLNIASRLGNVAIVDALLD------------------------- 451

Query: 95  EEEPEHGTFIASNLIQVGADPRIKNNSGRKPIEL 128
                            GADP + N SG +P++ 
Sbjct: 452 ----------------YGADPYVANKSGLRPVDF 469

>SAKL0G15554g Chr7 complement(1337081..1340353) [3273 bp, 1090 aa]
           {ON} similar to uniprot|P17442 Saccharomyces cerevisiae
           YGR233C PHO81 Cyclin-dependent kinase (CDK) inhibitor
           regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK
           complexes in response to phosphate levels required for
           derepression of PHO5 transcriptionally regulated by
           Pho4p and Pho2p
          Length = 1090

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 8/98 (8%)

Query: 28  ILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL 87
           +L Q+S  + KL+N  +D  G T LH  C+ G  +++  ++       +D  + +  TPL
Sbjct: 378 LLPQES--LRKLLN-ARDIHGRTPLHYACELGKMELVQLLVQSQMLDSVDVLDNDSKTPL 434

Query: 88  HTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKP 125
              +  +     H     + L+  GA+P  + N   +P
Sbjct: 435 ILAITRN-----HIDITKTLLVNAGANPSPEINEFSRP 467

>NDAI0A00710 Chr1 complement(134887..135894) [1008 bp, 335 aa] {ON}
           Anc_1.138 YCR036W
          Length = 335

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 8   TYGEQLLDASRRNNVDLLEF-ILEQDSNIVAKLINDTKDPFG 48
           ++GEQLLD  R+NNVD+    IL      +A ++ + KD  G
Sbjct: 69  SFGEQLLDILRKNNVDVANVGILPNVMTGIATILVEQKDGSG 110

>NCAS0F00580 Chr6 (113589..117035) [3447 bp, 1148 aa] {ON} Anc_5.96
           YGR233C
          Length = 1148

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 19/119 (15%)

Query: 16  ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYG-----SWDVLDTILDV 70
           A + NN +  E +L  D N++   ++DTK   G T LH+  K G     S  ++  ++  
Sbjct: 490 ACQYNNFEAAELLLAADINLLN--VSDTK---GLTPLHIVAKNGTNETNSRKLVQLLIQK 544

Query: 71  DC-PIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIEL 128
              P  +D  N    TP+   ++  + E      I   L++ GAD  IK++  R P+ L
Sbjct: 545 GANPNALDTFN--KWTPIFYAIQRGQRE------IVDELLKNGADLAIKDDENRSPLHL 595

>SAKL0B08008g Chr2 (680730..683054) [2325 bp, 774 aa] {ON} similar
           to uniprot|P31244 Saccharomyces cerevisiae YBR114W RAD16
           Protein that recognizes and binds damaged DNA in an
           ATP-dependent manner (with Rad7p) during nucleotide
           excision repair subunit of Nucleotide Excision Repair
           Factor 4 (NEF4) member of the SWI/SNF family
          Length = 774

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 53/120 (44%), Gaps = 12/120 (10%)

Query: 35  IVAKLIND-TKDPFGNTCLHMCCKYGSWDVLDTILD----VDCP-------IEIDPQNVE 82
           IV +L +D  ++P  + C H  C+    + +++ +D    + CP       I++    +E
Sbjct: 519 IVCQLCDDEAEEPIESKCHHRFCRLCIKEYIESFMDASEKLSCPVCHISLSIDLAQPALE 578

Query: 83  GDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTDLIDLLQ 142
            D  L             GT+ +S  I+   +      S R+ I+ I   +FT ++DL++
Sbjct: 579 VDEDLFKKQSIVSRLNMKGTWRSSTKIEALVEELYNLRSDRRTIKSIVFSQFTSMLDLVE 638

>CAGL0F06831g Chr6 (668173..671451) [3279 bp, 1092 aa] {ON} similar
           to uniprot|P40578 Saccharomyces cerevisiae YIR033w MGA2
           or uniprot|P35210 Saccharomyces cerevisiae YKL020c SPT23
          Length = 1092

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 63/160 (39%), Gaps = 18/160 (11%)

Query: 10  GEQLLD-ASRRNNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTIL 68
           G  LL  AS +    L+  ++++ + I      D KD F  T LH  C  G   ++  +L
Sbjct: 731 GRTLLHLASLKGYFKLVSTLIKKGARI------DDKDSFDFTPLHFACVSGDVKIIRILL 784

Query: 69  DVDCPIEIDPQNVEGDTPLHTV-VKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIE 127
             DC  + + +   G  PL    + +   E EH   +   +     D   ++  GRK   
Sbjct: 785 --DCGADKNRKTKHGLLPLELFEINHGYGEKEHSDHMTEVVKMFTEDESAESGMGRK--- 839

Query: 128 LIHNDKFTDLIDLLQSAELAADNKGTAINE--NEAEVIDD 165
            +    F   I    S  L ++N  +  NE  NE  V  D
Sbjct: 840 -LSTSSFNSSI--FDSESLQSENANSHDNEIDNEYPVYSD 876

>SAKL0G19646g Chr7 (1690766..1694122) [3357 bp, 1118 aa] {ON}
           similar to uniprot|P40578 MGA2 and to YKL020C
           uniprot|P35210 SPT23, Saccharomyces cerevisiae ER
           membrane proteins involved in regulation of OLE1
           transcription
          Length = 1118

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 8/89 (8%)

Query: 48  GNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASN 107
           G T LH+ C  G + +  T+  V     +D ++  G TPLH      +        I   
Sbjct: 759 GQTMLHLACLKGYFQLASTL--VKKGTRVDAKDSFGFTPLHFACVNGDPR------IIRL 810

Query: 108 LIQVGADPRIKNNSGRKPIELIHNDKFTD 136
           L Q  AD   K  +G  P +L   +  TD
Sbjct: 811 LAQCKADVTTKATNGVAPRDLFVTNHDTD 839

>NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]
           {ON} Anc_2.257
          Length = 1054

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 40/94 (42%), Gaps = 9/94 (9%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPE 99
           +ND +D  GN+ LH     G   ++  ++D    + I    +  DTPL        +   
Sbjct: 331 VND-QDNAGNSALHEAALNGHISIVKLLIDNGANVNIQSYEMFQDTPL-------VDASA 382

Query: 100 HGTF-IASNLIQVGADPRIKNNSGRKPIELIHND 132
           +G   +   L++ GADP I N  G    E I  D
Sbjct: 383 NGHLDVVQLLLENGADPTITNAKGITAYESIEED 416

>TPHA0E03630 Chr5 complement(766656..768371) [1716 bp, 571 aa] {ON}
           Anc_1.60 YLR182W
          Length = 571

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 83  GDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND-KFTDLID 139
           GDT L+   K         + +   L+  G DP IKNNSG   ++   N  K  DL+D
Sbjct: 304 GDTSLNIAAKIG------SSSLVETLMDYGTDPSIKNNSGLNALDFKDNKYKECDLVD 355

>NDAI0D04430 Chr4 (1040300..1042711) [2412 bp, 803 aa] {ON}
           Anc_4.232
          Length = 803

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 23/118 (19%)

Query: 35  IVAKLINDT---KDPFGNTCLHMCCKYGSWD---------VLDTILDVDCPIEID----P 78
           ++ KL+++T   +D  G T LH   K  S            L ++ D   P  ID     
Sbjct: 473 MIFKLLHETVFDEDRHGQTVLHHIIKRKSTTPSAVYYLDIFLGSLKDFAQPYGIDLLMNA 532

Query: 79  QNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHNDKFTD 136
           Q+  G+T LH      ++         + LI  G+   I+N  GR P E++ N+K+ D
Sbjct: 533 QDENGNTALHLAALNGDKR------FFNTLISNGSLLTIQNKEGRTPNEIM-NNKYED 583

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 40/101 (39%), Gaps = 23/101 (22%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPL-------HT-VV 91
           +ND +D  GN+ LH     G   ++  ++     + I    +  DTPL       H  +V
Sbjct: 388 VND-QDNAGNSALHEAALNGHLSIVKLLISHGANVNIQSYEMFKDTPLVDASANGHLDIV 446

Query: 92  KYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELIHND 132
           +Y              L++ GADP I N  G    E I  D
Sbjct: 447 RY--------------LLRHGADPTIPNAKGLTAYESIEED 473

>TDEL0B07330 Chr2 (1291145..1292272) [1128 bp, 375 aa] {ON}
           Anc_2.639 YMR068W
          Length = 375

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 48  GNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKY 93
           G   +H+ C +  +  L  ++ V   ++I   + +GDTPLH  ++Y
Sbjct: 109 GRAPIHIACMHDHFQCLSLLMGVGAKLDIT--DDDGDTPLHVCLEY 152

>CAGL0H03289g Chr8 (309091..310248) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53155 Saccharomyces cerevisiae YGL082w
          Length = 385

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 123 RKPIELIHNDKFT---DLIDLLQSAELAADNKGTAINENEAEVIDDS 166
           R P    H  K++       L+Q+ E+  D  G A+N N  +V+DDS
Sbjct: 136 RDPTSYYHLSKYSYEEAQRVLVQAYEIRKDQNGVALNTNAQQVLDDS 182

>Kwal_14.889 s14 complement(96498..99782) [3285 bp, 1094 aa] {ON}
           YKL020C (SPT23) - suppressor protein [contig 245] FULL
          Length = 1094

 Score = 29.3 bits (64), Expect = 6.3,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 7/71 (9%)

Query: 34  NIVAKLIN-----DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLH 88
           N+V+ L+      D KD FG   LH  C  G   ++  +  V C   I  + + G TP  
Sbjct: 748 NLVSALVRKGARVDAKDSFGFLPLHFACLNGDARIISLL--VQCKATIHAETINGSTPRD 805

Query: 89  TVVKYSEEEPE 99
             V   + + E
Sbjct: 806 LFVANHDTDDE 816

>Kwal_27.12750 s27 (1360301..1361002) [702 bp, 233 aa] {ON} YGR232W
           (NAS6) -  [contig 260] FULL
          Length = 233

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPE 99
           ++D  D  G + LH+    G+ +++ ++L +    ++D    +G T LH      +  P 
Sbjct: 68  LDDLVDESGWSPLHIASSVGNLNIVKSLLSLSIKPDLDLATSQGVTALHLACS-KQHLP- 125

Query: 100 HGTFIASNLIQVGADPRIKN 119
               +AS LI+ GA  R K+
Sbjct: 126 ----VASLLIEEGASVRKKD 141

>TPHA0H00770 Chr8 (156886..160623) [3738 bp, 1245 aa] {ON} Anc_3.175
           YAR042W
          Length = 1245

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 8/53 (15%)

Query: 77  DPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
           DPQ   GDT LH  VK      +    +   L++ GADP  ++ +G  PIE++
Sbjct: 208 DPQT--GDTVLHEFVK------KRDIIMCRWLLEHGADPFKRDITGVLPIEIL 252

>Skud_12.248 Chr12 (464584..466986) [2403 bp, 800 aa] {ON} YLR182W
           (REAL)
          Length = 800

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 35/94 (37%), Gaps = 42/94 (44%)

Query: 35  IVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYS 94
           I+  ++N  +D  G+TCL++  + G+  ++D +LD                         
Sbjct: 455 IITNMLN-AQDSNGDTCLNIAARLGNISIVDALLD------------------------- 488

Query: 95  EEEPEHGTFIASNLIQVGADPRIKNNSGRKPIEL 128
                            GADP I N SG +P++ 
Sbjct: 489 ----------------YGADPFIANKSGLRPVDF 506

>KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa]
           {ON} Anc_3.175 YAR042W
          Length = 1228

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 14/110 (12%)

Query: 20  NNVDLLEFILEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQ 79
           N   L++F   + S+ +A++  + +  F N          S      +LD++    +DP+
Sbjct: 166 NIAQLMQF---KRSSYIAEIATEFRTAFNNRDFQHLESILSNPRNFNLLDING---MDPK 219

Query: 80  NVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNSGRKPIELI 129
              GDT LH  VK      +    +   L++ GADP  ++  G+ P++L+
Sbjct: 220 T--GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDAKGKLPLDLL 261

>Suva_10.279 Chr10 (490526..492937) [2412 bp, 803 aa] {ON} YLR182W
           (REAL)
          Length = 803

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 35/94 (37%), Gaps = 42/94 (44%)

Query: 35  IVAKLINDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYS 94
           I+  ++N  +D  G+TCL++  + G+  ++D +LD                         
Sbjct: 458 IITNMLN-AQDSNGDTCLNIAARLGNISIVDALLDY------------------------ 492

Query: 95  EEEPEHGTFIASNLIQVGADPRIKNNSGRKPIEL 128
                            GADP I N SG +P++ 
Sbjct: 493 -----------------GADPFIANKSGLRPVDF 509

>KLTH0C00638g Chr3 complement(63995..67252) [3258 bp, 1085 aa] {ON}
           similar to uniprot|P40578 Saccharomyces cerevisiae
           YIR033W MGA2 or to uniprot|P35210 Saccharomyces
           cerevisiae YKL020C SPT23, ER membrane proteins involved
           in regulation of OLE1 transcription
          Length = 1085

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 2/45 (4%)

Query: 42  DTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTP 86
           D KD FG   LH  C  G   ++  +  V C   +  + + G +P
Sbjct: 751 DAKDSFGFLPLHFACLNGDARIIRLL--VQCKATVHAETINGSSP 793

>KLTH0G09724g Chr7 (818249..821470) [3222 bp, 1073 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 1073

 Score = 28.5 bits (62), Expect = 9.7,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 7/93 (7%)

Query: 40  INDTKDPFGNTCLHMCCKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPE 99
           +ND +D  GN+ LH     G  D++  +L     + I       DTPL         +  
Sbjct: 370 VND-QDNAGNSPLHEAALNGHLDIVKLLLSNGADVNIQSHEPVKDTPLIDAAANGHLK-- 426

Query: 100 HGTFIASNLIQVGADPRIKNNSGRKPIELIHND 132
               +   L++  ADP I N  G    E I  D
Sbjct: 427 ----VVKLLLKYNADPTISNAKGLTAFESIDED 455

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,218,992
Number of extensions: 1016923
Number of successful extensions: 2586
Number of sequences better than 10.0: 179
Number of HSP's gapped: 2511
Number of HSP's successfully gapped: 200
Length of query: 170
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 68
Effective length of database: 41,785,467
Effective search space: 2841411756
Effective search space used: 2841411756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)