Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_25943.564ON1019101951500.0
AFR269W3.564ON1017100827910.0
SAKL0F00880g3.564ON1009100924360.0
Kwal_47.192583.564ON1011100720840.0
KLTH0G00792g3.564ON1021101019920.0
YGL241W (KAP114)3.564ON1004101618970.0
NCAS0F039503.564ON1012101618970.0
Smik_7.203.564ON1004101718820.0
TDEL0D063203.564ON1018101818520.0
NDAI0B062603.564ON1013102818350.0
Kpol_380.63.564ON1002100518250.0
Skud_7.263.564ON1015102318220.0
CAGL0H07777g3.564ON1021101317970.0
ZYRO0E09460g3.564ON1009101317910.0
TPHA0G036303.564ON1022101717800.0
Suva_7.203.564ON1008101717610.0
KNAG0D029403.564ON1009102117100.0
KAFR0J001903.564ON1012102716780.0
TBLA0E002403.564ON1010102216000.0
KLLA0A00803g3.564ON9528539831e-116
Kwal_26.85958.624ON1034881174e-05
SAKL0H07876g8.624ON1032791068e-04
CAGL0J06776g8.624ON10271401050.001
ACR159C8.624ON1025911020.002
NDAI0E021708.624ON10291001010.003
NCAS0C014308.624ON102997980.006
Suva_4.5211.344ON690154980.007
TDEL0A057008.624ON103187960.013
Suva_16.1858.624ON103298950.018
KLTH0D10010g8.624ON103479930.024
KAFR0H027008.624ON104177930.030
Smik_6.3248.624ON103277920.035
Skud_16.1558.624ON103277910.041
KLLA0D06633g8.624ON102379910.043
ZYRO0F06160g8.624ON1029147900.056
YPL125W (KAP120)8.624ON103277900.062
KNAG0J014208.624ON105374900.070
Kpol_530.128.624ON1030100890.071
TBLA0J004708.624ON103679880.11
TPHA0F031608.624ON103179860.17
CAGL0H07821g3.561ON961149850.25
Kpol_460.183.561ON956266840.32
NDAI0A003701.37ON63693830.32
Kwal_47.192473.561ON959148800.82
NCAS0B089301.33ON496118791.0
AFR273W3.561ON969174791.3
KLLA0F20119g6.68ON1085103781.5
Ecym_25903.561ON955148781.5
TDEL0D062903.561ON957206781.7
KLLA0F02387g7.56ON727122762.5
Smik_7.223.561ON96070753.4
SAKL0F00968g3.561ON961150753.4
KNAG0A023508.477ON42136743.8
Suva_7.223.561ON96070744.1
Skud_7.283.561ON96070744.3
Ecym_83098.624ON102777744.5
KLTH0A00726g7.541ON151253744.5
KLTH0B09768g5.11ON109257744.8
YGL238W (CSE1)3.561ON96070736.0
NCAS0E002903.561ON958148736.9
NCAS0A035304.180ON860289727.7
Ecym_50177.17ON978167727.8
KLTH0G00858g3.561ON959139728.6
NDAI0I032103.561ON958148728.7
NDAI0I014306.145ON67793719.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_2594
         (1019 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...  1988   0.0  
AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...  1079   0.0  
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   942   0.0  
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   807   0.0  
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   771   0.0  
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...   735   0.0  
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   735   0.0  
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...   729   0.0  
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   717   0.0  
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   711   0.0  
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   707   0.0  
Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...   706   0.0  
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   696   0.0  
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...   694   0.0  
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...   690   0.0  
Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...   682   0.0  
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   663   0.0  
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   650   0.0  
TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...   620   0.0  
KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...   383   e-116
Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {...    50   4e-05
SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highl...    45   8e-04
CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} high...    45   0.001
ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON} ...    44   0.002
NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {...    44   0.003
NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {...    42   0.006
Suva_4.521 Chr4 (902071..904143) [2073 bp, 690 aa] {ON} YBR259W ...    42   0.007
TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]...    42   0.013
Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL12...    41   0.018
KLTH0D10010g Chr4 complement(830376..833480) [3105 bp, 1034 aa] ...    40   0.024
KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8....    40   0.030
Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {O...    40   0.035
Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL12...    40   0.041
KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa] ...    40   0.043
ZYRO0F06160g Chr6 complement(509916..513005) [3090 bp, 1029 aa] ...    39   0.056
YPL125W Chr16 (313388..316486) [3099 bp, 1032 aa] {ON}  KAP120Ka...    39   0.062
KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa] ...    39   0.070
Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON} (33954.....    39   0.071
TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.6...    39   0.11 
TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {...    38   0.17 
CAGL0H07821g Chr8 (761870..764755) [2886 bp, 961 aa] {ON} highly...    37   0.25 
Kpol_460.18 s460 complement(33770..36640) [2871 bp, 956 aa] {ON}...    37   0.32 
NDAI0A00370 Chr1 (62290..64200) [1911 bp, 636 aa] {ON} Anc_1.37        37   0.32 
Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]...    35   0.82 
NCAS0B08930 Chr2 complement(1715878..1717368) [1491 bp, 496 aa] ...    35   1.0  
AFR273W Chr6 (923039..925948) [2910 bp, 969 aa] {ON} Syntenic ho...    35   1.3  
KLLA0F20119g Chr6 (1874062..1877319) [3258 bp, 1085 aa] {ON} sim...    35   1.5  
Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {O...    35   1.5  
TDEL0D06290 Chr4 complement(1129171..1132044) [2874 bp, 957 aa] ...    35   1.7  
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    34   2.5  
Smik_7.22 Chr7 (44367..47249) [2883 bp, 960 aa] {ON} YGL238W (REAL)    33   3.4  
SAKL0F00968g Chr6 (84333..87218) [2886 bp, 961 aa] {ON} highly s...    33   3.4  
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    33   3.8  
Suva_7.22 Chr7 (44148..47030) [2883 bp, 960 aa] {ON} YGL238W (REAL)    33   4.1  
Skud_7.28 Chr7 (53753..56635) [2883 bp, 960 aa] {ON} YGL238W (REAL)    33   4.3  
Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON...    33   4.5  
KLTH0A00726g Chr1 complement(72979..77517) [4539 bp, 1512 aa] {O...    33   4.5  
KLTH0B09768g Chr2 (805761..809039) [3279 bp, 1092 aa] {ON} simil...    33   4.8  
YGL238W Chr7 (49552..52434) [2883 bp, 960 aa] {ON}  CSE1Nuclear ...    33   6.0  
NCAS0E00290 Chr5 (43508..46384) [2877 bp, 958 aa] {ON} Anc_3.561...    33   6.9  
NCAS0A03530 Chr1 complement(698730..701312) [2583 bp, 860 aa] {O...    32   7.7  
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    32   7.8  
KLTH0G00858g Chr7 (59340..62219) [2880 bp, 959 aa] {ON} similar ...    32   8.6  
NDAI0I03210 Chr9 complement(754542..757418) [2877 bp, 958 aa] {O...    32   8.7  
NDAI0I01430 Chr9 (341557..343590) [2034 bp, 677 aa] {ON} Anc_6.1...    32   9.4  

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
            similar to Ashbya gossypii AFR269W
          Length = 1019

 Score = 1988 bits (5150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 983/1019 (96%), Positives = 983/1019 (96%)

Query: 1    MKDTTSRWLTTKMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPS 60
            MKDTTSRWLTTKMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPS
Sbjct: 1    MKDTTSRWLTTKMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPS 60

Query: 61   AEVASKQFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIV 120
            AEVASKQFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIV
Sbjct: 61   AEVASKQFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIV 120

Query: 121  SASSYCIVQIAAVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGI 180
            SASSYCIVQIAAVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGI
Sbjct: 121  SASSYCIVQIAAVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGI 180

Query: 181  GWKTVQIVFSLLSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLH 240
            GWKTVQIVFSLLSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLH
Sbjct: 181  GWKTVQIVFSLLSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLH 240

Query: 241  IFLQLLGNHNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTL 300
            IFLQLLGNHNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTL
Sbjct: 241  IFLQLLGNHNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTL 300

Query: 301  GKYYSQILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQ 360
            GKYYSQILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQ
Sbjct: 301  GKYYSQILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQ 360

Query: 361  ADDLTNDLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWE 420
            ADDLTNDLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWE
Sbjct: 361  ADDLTNDLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWE 420

Query: 421  KQESMLYLLQSCQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEK 480
            KQESMLYLLQSCQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEK
Sbjct: 421  KQESMLYLLQSCQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEK 480

Query: 481  FVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKL 540
            FVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKL
Sbjct: 481  FVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKL 540

Query: 541  ERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYS 600
            ERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYS
Sbjct: 541  ERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYS 600

Query: 601  VQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLT 660
            VQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLT
Sbjct: 601  VQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLT 660

Query: 661  VFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHL 720
            VFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHL
Sbjct: 661  VFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHL 720

Query: 721  QTAIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIH 780
            QTAIMILERLLASDTSY              TKFADQIQDIMPKLLEAAARRLVQVNNIH
Sbjct: 721  QTAIMILERLLASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQVNNIH 780

Query: 781  TVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKEN 840
            TVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKEN
Sbjct: 781  TVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKEN 840

Query: 841  IVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVT 900
            IVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVT
Sbjct: 841  IVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVT 900

Query: 901  ELMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEG 960
            ELMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNA           VLEYEKLQEYIEG
Sbjct: 901  ELMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNADHDDDWEDIDDVLEYEKLQEYIEG 960

Query: 961  SXXXXXXXXXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLSIYIV 1019
            S           MNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLSIYIV
Sbjct: 961  SDIDDDDDDLLIMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLSIYIV 1019

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1008 (54%), Positives = 724/1008 (71%), Gaps = 8/1008 (0%)

Query: 12   KMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLV 71
            KMDL +L+L AQS  K +RESAE +LL  C +DP +V V L+ +A+  + E+AS+QFCL 
Sbjct: 18   KMDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLY 77

Query: 72   SIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIA 131
            ++RKLITMYWNAGFESYCGPPGV E AKE VR+ LL++ +  +Q+SKI+SAS+YC+VQIA
Sbjct: 78   TLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIA 137

Query: 132  AVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSL 191
            A DFPDEWP LL +VY++IT + S  AL LLHEIFDDVVSEEMFFQGG+GW+T++I+F L
Sbjct: 138  AFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFEL 197

Query: 192  LSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNL 251
            L +      +KDAAMKLYHSCLLQL +P ALE  + R+ +  HV+E L +F QLL +   
Sbjct: 198  LGD-DGPVALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHVHEALELFAQLLEHCRS 256

Query: 252  ADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASV 311
             +P  +LL  +AHTYENL L+KTQ PK+ FP  L+ +     L+DL  LG YY Q LA  
Sbjct: 257  LEPHADLLQFQAHTYENLVLIKTQLPKRFFPGALREALLDAVLRDLVLLGAYYEQHLAEG 316

Query: 312  DEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSF 371
            DE LL++V ESAI+++ FLSS+HEC+L    +  LL SL +L  L   Q +    D NSF
Sbjct: 317  DEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSF 376

Query: 372  VSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLYLLQS 431
            +SKETG++  YT RDE+FQ+LSD+ G NYR   + L EQ   V  + W  QES+L+LLQS
Sbjct: 377  ISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQS 436

Query: 432  CQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENIKLI 491
            CQ N+E  + + Q +  LL + Q +L S ++H LV  R+++T+ ++LEK++  L N+K +
Sbjct: 437  CQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVKDL 496

Query: 492  VKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIINDI 551
            V+EF+F T     +S N  + A +LI++  YSSFV  GSVLGV+  E+LE+ VL  I +I
Sbjct: 497  VREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIKNI 556

Query: 552  YAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYSVQVVVEAQDCL 611
               +D+DTPGFLLEVLSGV   N ES N+ LK  EL+ V  ++T+DP ++QVVVEAQ+CL
Sbjct: 557  LDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNVATADPSNIQVVVEAQECL 616

Query: 612  SSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNPSDGF 671
             +LLQ    ++Y+ YAELCIPSF+ VLRAD +HG+AYTPLVSLSLELL VF++K P D  
Sbjct: 617  KNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSLELLVVFMRKKPVDSA 675

Query: 672  LPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMILERLL 731
            LP+S+V+Y+F+PL+S+++++EDDELLQLSTEAF  LLA+S  DD+   +   I ILE+LL
Sbjct: 676  LPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDLLGRIPVIITILEKLL 735

Query: 732  ASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLILVFCH 791
            ++ TS+              TKFA+QIQDIMPK+LEAAA+RLVQ+ N+HT ENL+ VFC+
Sbjct: 736  SARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLFVFCY 795

Query: 792  LTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSKLFFLN 851
            LTS+D +QTVDFLSS I+D  G +ALQ I+P+WL++FE++RGE KIKENI++LSKLFFL 
Sbjct: 796  LTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKLFFLE 855

Query: 852  DSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQYNQPDP 911
            D R+A I VNGDLIP+DGD+IITRSMAK +PDKYT+ISA EKI+KL V EL FQ NQPDP
Sbjct: 856  DPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQNQPDP 915

Query: 912  DKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGSXXXXXXXXXX 971
             +Y    S        D++ +S +            +L+YEKLQEY + S          
Sbjct: 916  GRYPKDGSGP--ADPHDSEGDSAD----EDWEDVDDILDYEKLQEYADDSDIDDTGDSLL 969

Query: 972  XMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLSIYIV 1019
              +NI+E  + LL+QFFKEAV ++ SGF++IY+RL EQEK+ LS  +V
Sbjct: 970  FTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1009 (48%), Positives = 693/1009 (68%), Gaps = 14/1009 (1%)

Query: 14   DLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSI 73
            ++++L++ AQS  K +RE+AE++LL   + +P S+F+SLI+IA + S  + S+QF L+ +
Sbjct: 4    NVAQLVIQAQSADKKEREAAESSLLQFSAQEPESMFLSLIDIACN-SYPLTSRQFSLLFL 62

Query: 74   RKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAV 133
            R+L+TMYW+AGFESY GPPGV    K +VRE+LL+L L DSQ+ K  ++SSYC+VQI+AV
Sbjct: 63   RRLVTMYWSAGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQISAV 122

Query: 134  DFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLLS 193
            DFPDEWP LL  +Y+AI   YS +A+SLL EIFDDVVSEEMFFQGGIGW+T+QIV  +L+
Sbjct: 123  DFPDEWPDLLIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQVLT 182

Query: 194  NTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLL----GNH 249
            +++SS   K AA+ LYH+C+LQL SP A  + E +  IA+H+ + L +F+QLL     + 
Sbjct: 183  SSTSSVESKSAALDLYHACVLQLQSPQATSTIERKHAIAEHIKQMLGLFIQLLQFYQSSQ 242

Query: 250  NLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILA 309
            +   P+  LL LKA  YENL +LK+ F K+ FP++ K   K + LKDL+ +   Y + L 
Sbjct: 243  DEIQPT--LLKLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISNIYYRSLN 300

Query: 310  SVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLN 369
            + D+  + S+DE AI+II FLSSLHE      E   LL+SL ++C L   Q  D  N  N
Sbjct: 301  NTDDKDIDSLDECAIHIIVFLSSLHELVFSPTETPVLLDSLTKVCCLTDTQTSDWDNYFN 360

Query: 370  SFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLYLL 429
             FV+KETG++  Y+ RDE FQF S++ GTNY N+   L +   +    DW+ QES++YL+
Sbjct: 361  IFVTKETGLAASYSARDESFQFFSNLTGTNYTNLLAFLTQNVHASGIEDWKYQESLMYLM 420

Query: 430  QSCQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENIK 489
            ++   N EE   + Q +++ L     +L S   +  V  R+ + + KILEKF+  LE+IK
Sbjct: 421  EAAVNNDEEITNDFQPVLQTLDAFSELLASCETNEFVKVRVILILPKILEKFMDSLEDIK 480

Query: 490  LIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIIN 549
            L+VK+F+F+T T+ S+     +K  SLIS+  YSSF  L SVLG E  ++L+  VL IIN
Sbjct: 481  LLVKKFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQLKEAVLKIIN 540

Query: 550  DIYAEVDDDTPGFLLEVLSGVIASNPES-TNKSLKASELEFVLKLSTSDPYSVQVVVEAQ 608
            +IY + +DDTP  LLE L+ +I S   +    S++  EL+ +LK+S  DP ++QVV+EAQ
Sbjct: 541  EIYEDAEDDTPALLLETLNQIIGSTSNAEVIASVRFDELQLILKISAKDPSNIQVVLEAQ 600

Query: 609  DCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNPS 668
            +CL +LL+ +  + Y+ YAE+ IPSFV+VL    + GF Y+P++SLSLELLTVF+KK P+
Sbjct: 601  ECLQNLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSLSLELLTVFMKKKPT 660

Query: 669  DGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMILE 728
            +G LP  + ++VF+PL+  ++ S+DDE+LQL+T+ ++FL+ NS+   I+ HL T + +LE
Sbjct: 661  NGTLPPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENSQIAPHLNTILSVLE 720

Query: 729  RLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLILV 788
            +LL+ +TS                K +DQ+Q+ +P +LEAAA+RLVQV+NI T ENLI V
Sbjct: 721  KLLSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLVQVHNIATAENLIFV 780

Query: 789  FCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSKLF 848
            FC+LTS +  QTVDFLSSL+LDS+G+SAL+LI+PKWL+SFEIIRGEK+IKENI+ALSKLF
Sbjct: 781  FCYLTSTNPNQTVDFLSSLVLDSEGNSALKLILPKWLESFEIIRGEKRIKENILALSKLF 840

Query: 849  FLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQYNQ 908
            FLND R+++I+VNGD IPYDGDL+ITRSM+K +P+KYT+ISAYEKI+KL V EL FQ NQ
Sbjct: 841  FLNDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKIVKLFVAELSFQGNQ 900

Query: 909  PDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGSXXXXXXX 968
            P  +KY+    +K      D    + N            VLEYEKLQEY++         
Sbjct: 901  PGLEKYIPHDLKKY----DDQAIKAANDANDDDWEDVDDVLEYEKLQEYVDDESDLEDDE 956

Query: 969  XXXXMN--NIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                +    + ++T ELL QFF+EA  K++SGF++IY  LN+ EKR L+
Sbjct: 957  EGDVIGVQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEKRVLT 1005

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1007 (42%), Positives = 641/1007 (63%), Gaps = 10/1007 (0%)

Query: 15   LSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIR 74
            L E I  AQSP K  RE  E  +  LCS DP      L+ +A      + ++ F L+S+R
Sbjct: 5    LEEAIASAQSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSLLSLR 64

Query: 75   KLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVD 134
            KLITMYW+AGFESY GPPGVNE  KE++R +LL+L L D+Q+++I   SSYCIVQIAAVD
Sbjct: 65   KLITMYWSAGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQIAAVD 124

Query: 135  FPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLLSN 194
            FPDEWP L++ VY+AI   +S +AL +L+EIFDDVVSEEMFF  G+GW+T+Q++ ++L++
Sbjct: 125  FPDEWPGLIEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISNILND 184

Query: 195  TSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNH-NLAD 253
               S   K +A KLY +CLLQL SP A  + E RS +  H+ E+  + L LL  + N+ D
Sbjct: 185  PGCSILAKHSAAKLYQACLLQLQSPAASSTPELRSALTNHIQESTKMLLNLLQAYSNIQD 244

Query: 254  PSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASVDE 313
             + +LL L     + LT ++T FPKKL  D +     TV +++   +    +    + +E
Sbjct: 245  EAIDLLRLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVLIENFTRVAALSND---NTEE 301

Query: 314  ALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSFVS 373
                 ++E  I ++  L+++ +  L GP ++ ++E  V    L   + +   +D N FVS
Sbjct: 302  EKSSEINEVGIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEEAWESDFNHFVS 361

Query: 374  KETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLYLLQSCQ 433
            KE G++  Y IRDE  QFL ++ G  Y++IF+ L+     V  L+W  +E++ YL+QS  
Sbjct: 362  KEVGLASSYYIRDECSQFLQEISGARYQSIFEILVSALSKVDPLEWRLKEAVFYLIQSLC 421

Query: 434  GNTEEFEV-NSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENIKLIV 492
             N +E  V N+  + +LL  L+  +E QN+   V +R  + + K++EKF+ +LEN+K IV
Sbjct: 422  INEDEVTVFNNNEVFDLLNELRQNMEGQNLQLHVRTRAILALPKVVEKFMDRLENVKDIV 481

Query: 493  KEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIINDIY 552
            KE +F TL  A    + T+KA +LI++  Y+SF  L SVLG+E  ++    VL++I D+ 
Sbjct: 482  KELLFATLNGACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEARCLVLNLIQDVL 541

Query: 553  AEVDDDTPGFLLEVLSGVIASNPESTNKSLKASE-LEFVLKLSTSDPYSVQVVVEAQDCL 611
             + +DDTP  LLE L+  +A    +T  +L   + L  VLK+S  DP ++QVV+EAQDC+
Sbjct: 542  EDSEDDTPAVLLEALNPALAKQSNTTKDTLFYQQALNLVLKISAKDPSNLQVVLEAQDCI 601

Query: 612  SSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNPSDGF 671
            S+LL    ++ Y+  ++ CIP FV++L     + + Y P+VSLSLELLTVF+KK PSDGF
Sbjct: 602  SALLSGESTESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLELLTVFMKKKPSDGF 661

Query: 672  LPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMILERLL 731
            LP ++  YVFEPL+ ++++S DDE+LQ++++A  +L++NS+  D+   L T + ILE+LL
Sbjct: 662  LPSNISSYVFEPLSDILINSSDDEILQVASDALTYLMSNSQASDLEPLLPTVLSILEKLL 721

Query: 732  ASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLILVFCH 791
            + +TS                K++ Q+Q++ PK+LEAA +R V   N+ T ENL+ VFC+
Sbjct: 722  SVNTSDSGAMNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAKNVATTENLVFVFCY 781

Query: 792  LTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSKLFFLN 851
            LTS++  + ++FLSS  ++    ++L  ++PKWL+SFE++RGE++IKENIVALSK+FF +
Sbjct: 782  LTSINPAEAINFLSSFTINEKEGNSLNYVLPKWLESFEVLRGERRIKENIVALSKIFFQS 841

Query: 852  DSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQYNQPDP 911
            D RV +++VNGD +PY GD+I+TRSMAK +P +YTRI+A+EKI+KL V EL FQ +QP  
Sbjct: 842  DPRVGSVIVNGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKLFVAELEFQSSQPSL 901

Query: 912  DKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGSXXXXXXXXXX 971
            DK++   + K   ++  N +N+ +            VLEY++LQ+++             
Sbjct: 902  DKFLPVNARKFDTSSSFN-NNAEDEQDDGEWEDVDDVLEYDQLQQFVVEDGERNDSDDED 960

Query: 972  XMNN---IQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
             + N   IQ++T ELL  FFKEA  K+I+  +D+Y  L+E EK+ LS
Sbjct: 961  SLANIQDIQQSTKELLIDFFKEAAAKNINNLRDLYENLSEHEKKILS 1007

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1010 (41%), Positives = 631/1010 (62%), Gaps = 11/1010 (1%)

Query: 12   KMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLV 71
            K  L E I+ AQS     RE++E AL SLCS +P +   SL+ +A      V  + F L+
Sbjct: 13   KEKLKEAIVGAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLL 72

Query: 72   SIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIA 131
            S+RKLITMYW+AGFESY GPPG+ +  K ++RE+LL L L DSQ++++ + SSYCIVQIA
Sbjct: 73   SLRKLITMYWSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIA 132

Query: 132  AVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSL 191
            AVDFPDEWP+L+D+++DAI    S +AL +L+EIFDDVVSEEMFF  GIGW+T+Q++F +
Sbjct: 133  AVDFPDEWPTLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRI 192

Query: 192  LSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNL 251
            LSN+ SS   K A+ KLY +CLLQL SP A  + + +  ++ H+ E++ + +++L  H++
Sbjct: 193  LSNSDSSTQAKTASAKLYQACLLQLQSPMATSTQDYKYALSNHIQESVLLLIKVLKEHHI 252

Query: 252  ADPSN-ELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILAS 310
            A   N   L+L+      L  +KT F KKLF  +          ++   + +    I  +
Sbjct: 253  AKGINTSALNLQQVLLSCLNTIKTGFSKKLFTIESAQELIEFLFENFRKIAELC--IDVT 310

Query: 311  VDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNS 370
            +D  +  + +E  I ++   ++L +   E    N ++ES V    +    A+   ND N 
Sbjct: 311  IDPDMKLAANEVGIQMVSLFATLMDTLTENQNWNFIVESFVIAGMISDEDAECWDNDFNV 370

Query: 371  FVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLYLLQ 430
            F SKETG+S  +T+RDE  QF+  + G  Y ++F  L          +W+ QES+L+ +Q
Sbjct: 371  FASKETGLSTSFTVRDECEQFMQGLSGFAYNSVFNALTSALIYNESPNWKVQESILFFIQ 430

Query: 431  SCQGNT-EEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENIK 489
            +  GN  +E   N +    LL  L+ ILE ++ H LV +R  I + K++E+F+  LE++K
Sbjct: 431  ALCGNEDDEVSFNFEKTQSLLNTLRQILELEDSHILVKTRSLIALPKVIERFMETLESVK 490

Query: 490  LIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIIN 549
             +VK+ +F + ++A  +P+ T+K G LIS+  Y+SF  L SVLG     + +R V  II 
Sbjct: 491  ALVKDSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSVSAIIQ 550

Query: 550  DIYAEVDDDTPGFLLEVLSGVIASNPESTNK-SLKASELEFVLKLSTSDPYSVQVVVEAQ 608
            ++  E ++DTP  LLE L+  ++SN ++T   S     L+ +LK+S+  P ++QV +EAQ
Sbjct: 551  ELLEEAEEDTPSILLEALAPTLSSNHKTTETISFYQLALQLILKISSKHPSNIQVGLEAQ 610

Query: 609  DCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNPS 668
            DCLS+LL+   +++Y+ Y++ CIP F +VL     + FAY P+V LSLE+LTVF+K+ P 
Sbjct: 611  DCLSNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVFIKRKPR 670

Query: 669  DGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMILE 728
            DG LP  +  YVF PL+ ++++S DDE++QL+++A  +L++NS+   +  HL   +  LE
Sbjct: 671  DGCLPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNVVLCDLE 730

Query: 729  RLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLILV 788
            +LL+++TS                KF+ Q+Q+I P++LEAA ++ +  +N+ T ENL  V
Sbjct: 731  KLLSAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTTENLANV 790

Query: 789  FCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSKLF 848
            FC+L S++  + ++FLSS  +D    S L  ++ KWL+SFE++RGEK+IKENI+ALSKLF
Sbjct: 791  FCYLVSLNPAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALSKLF 850

Query: 849  FLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQYNQ 908
            F  DSR+  I VNGD IPY GD+IITRSMAKS+P+KYTRI+AY+KI+KL V EL FQ +Q
Sbjct: 851  FQADSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQTSQ 910

Query: 909  PDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEG---SXXXX 965
             D +KY+   ++   KT     +N+              VLEYE+LQ +++    S    
Sbjct: 911  TDLEKYIPMSAK---KTECSTIANAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSSDRD 967

Query: 966  XXXXXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                   + N+Q++T ELL  FFKEA  ++I+ FK IY  L+E EKR LS
Sbjct: 968  EEDVIPGIKNVQQSTRELLISFFKEAASQNINDFKTIYDNLSENEKRILS 1017

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
            KAP114Karyopherin, responsible for nuclear import of
            specific proteins; cargoes include Spt15p, Sua7p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear; function is
            regulated by sumoylation
          Length = 1004

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1016 (41%), Positives = 635/1016 (62%), Gaps = 29/1016 (2%)

Query: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72
            MD++ELI+ AQS  K  RE AET LL  C SD   VF +L N+A    A + S+QF L+S
Sbjct: 1    MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLS 60

Query: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132
            +RKLITMYW+ GFESY     V    K+ +RE LLKL L D++N+KI + +SYCIVQI+A
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISA 120

Query: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192
            VDFPD+WP LL  +YDAI++ +S NA+SLL+EI+DDVVSEEMFF+GGIG  T++IVF +L
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVL 180

Query: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLL----GN 248
            +  +S+   K AA+KL  +CLLQ+ S +  +    +S ++Q +  +L I  QLL    GN
Sbjct: 181  NTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGN 240

Query: 249  HNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQIL 308
             ++       L  K+  YENL  +K  F +K F  +L+  FK +A++DL+ +    + + 
Sbjct: 241  VDVISQ----LKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINANVE 296

Query: 309  ASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDL 368
             +  E LL++V + +I I+ FL+S+   +    E+N ++ SL  LC L     +  T+D 
Sbjct: 297  TTESEPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDF 356

Query: 369  NSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMH--LDWEKQESML 426
            N+FVSKETG++  Y +RD+  +F + +       IF+ +   +  + H   ++   ES+L
Sbjct: 357  NTFVSKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVV---SNDIEHSTCNYSTLESLL 413

Query: 427  YLLQSCQGNTEEF--EVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCK 484
            YLLQ    N +E   E   Q L  L+  L+NIL SQ I  L+ +R  +TI ++L+KF+  
Sbjct: 414  YLLQCILLNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDA 473

Query: 485  LENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQV 544
            L +IK +   F+ K+L +A  S    +K+ +LI++  Y  F  L SVLG E C + + +V
Sbjct: 474  LPDIKPLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKV 533

Query: 545  LDIINDIYAEVDDDTPGFLLEVLSGVIASNPES--TNKSLKASELEFVLKLSTSDPYSVQ 602
            + IIN + ++ ++DT G L+EVLS VI+ NP+   + K +  +E   V  +S+ DP +VQ
Sbjct: 534  IRIINQVSSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQ 593

Query: 603  VVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVF 662
            VVV++Q+CL  LL  +  D+Y  Y ELC+PSF++VL ++  + + Y+PL+SL LE +TVF
Sbjct: 594  VVVQSQECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVF 653

Query: 663  LKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQT 722
            LKK P+DGFLP  + +Y+FEPL  ++  S +DE LQL+TEAF++L+ N+    +   L  
Sbjct: 654  LKKKPNDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMD 713

Query: 723  AIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTV 782
             + +LERLL+ + S               T+F+ +IQ ++ ++LEA   RL++  NI T 
Sbjct: 714  IMKVLERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTE 773

Query: 783  ENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIV 842
            +NL+ V C LT  D KQTVDFLSS  +D+    AL L++ KW+++FE+IRGEK+IKENIV
Sbjct: 774  QNLLSVLCFLTCNDPKQTVDFLSSFQIDNTD--ALTLVMRKWIEAFEVIRGEKRIKENIV 831

Query: 843  ALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTEL 902
            ALS LFFLND R+  ++VNG+LIPY+GDLIITRSMAK +PD+Y ++  Y KIIKL V+EL
Sbjct: 832  ALSNLFFLNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSEL 891

Query: 903  MFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGSX 962
             FQ  QP+P++ ++S  ++           +              VL+Y+KL+EYI+   
Sbjct: 892  SFQSKQPNPEQLITSDIKQEVVN-------ANKDDDNDDWEDVDDVLDYDKLKEYIDDDV 944

Query: 963  XXXXXXXXXXMN---NIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                      +    +++E+  +LL +FFKE   KD+SGF  IY  L++ E++ LS
Sbjct: 945  DEEADDDSDDITGLMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLS 1000

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1012

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/1016 (39%), Positives = 639/1016 (62%), Gaps = 21/1016 (2%)

Query: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72
            MD+ +LI  AQS     RE+AE  L S C  +   +F SL+++A DP + ++++QF L++
Sbjct: 1    MDIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLT 60

Query: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132
            IRK ITMYW+ GF+SY     + E  KE +R +LL+L L D+Q++KI +++SYCIVQI+A
Sbjct: 61   IRKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISA 120

Query: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192
            VDFPD+WP LL T+Y AI  ++S NALSLL+EI+DDV+SEEMFF+G IG +T+QI+F LL
Sbjct: 121  VDFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLL 180

Query: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQ-IAQHVNETLHIFLQLLGNHNL 251
            +N +++   K A  KL+++CLLQ +S     S  NR + + + + + L +  QLL  + +
Sbjct: 181  TNNNANLKAKIAGTKLFNACLLQ-MSVVDSSSKHNRKEFVKECIFKALEVLGQLLELYPV 239

Query: 252  ADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASV 311
            ++ S  +L+L+   YEN+ L+  +F +KLF    KG +K  + +DL+     ++  L ++
Sbjct: 240  SNDS-LILNLRTKIYENVVLISNEFSRKLFTQAFKGLYKLQSFRDLEACSNQFNAFLENL 298

Query: 312  DEA---LLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDL 368
             +A   +L+S++E  I+++ FL+S+ + +    E+N +++SL  LC L     +  + D 
Sbjct: 299  SQADNDILESMNECVIHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTLEQWSEDF 358

Query: 369  NSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEK--QESML 426
            N FVSKETG+   +TIRD+  +F+S +   NY N F ++  Q    +  D     +ES+L
Sbjct: 359  NDFVSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGDVNDNLRESLL 418

Query: 427  YLLQSCQGNTE--EFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCK 484
            YLLQ+   N E  + ++N +  V +L +  ++ E+      + SR+ +   K+LEKF+ +
Sbjct: 419  YLLQTLLTNEEDNDHDINIEPSV-ILKQFSSVFENGLQKTFLLSRIILLTPKLLEKFMDQ 477

Query: 485  LENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQV 544
            L+++K +   ++ +TL +A  + N  +K+ S+I++  YS F  L SVLG E C  ++   
Sbjct: 478  LQDVKQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGPELCSIVQENT 537

Query: 545  LDIINDIYAEVDDDTPGFLLEVLSGVIASN-PESTNKSLKASELEFVLKLSTSDPYSVQV 603
            L II+++  E ++DT G L+E L+ +I+ N  E+ +  +  +E   VL +S+ DP +VQV
Sbjct: 538  LKIISELSKEAEEDTNGLLMETLNQIISCNVHENLSPEILQTEFNLVLSISSKDPANVQV 597

Query: 604  VVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFL 663
             VEAQDCL  LL+ + ++ Y++Y ++C+PSF+  + A   + + YTP++SL LE LT+F+
Sbjct: 598  TVEAQDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLSLILEFLTIFM 657

Query: 664  KKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTA 723
            KK P DGFLP S+ ++ F+ L +L+  S +DE LQL+T+AF++++ N++   +   LQ  
Sbjct: 658  KKKPVDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEPSAMVPKLQDI 717

Query: 724  IMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVE 783
            I +L+RLL+ + S               +KF+++IQ ++P +L AA  RL+Q  NI T +
Sbjct: 718  INVLDRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQPLIPTILRAAVGRLIQAQNISTQQ 777

Query: 784  NLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVA 843
            NL+ + C LT  D KQ +D L +   DSD HS    ++ KW +SFE IRGEKKIKENIVA
Sbjct: 778  NLVSLLCFLTCSDPKQVIDLLYN--FDSD-HSTFTKVMNKWFESFETIRGEKKIKENIVA 834

Query: 844  LSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELM 903
            LSKL+F  D R+  ++VNGDLIPYDGDLIITRSMAK +PDKYT+I A+ KI+KL  TEL 
Sbjct: 835  LSKLYFTGDERLGKLIVNGDLIPYDGDLIITRSMAKKMPDKYTQIPAFTKIVKLFTTELG 894

Query: 904  FQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIE---- 959
            FQ  QPD    + S  + +  +N  NK++   A           VL+YEKL+E+++    
Sbjct: 895  FQNKQPDSKILLESDIKNVDTSN--NKTSEEAAGDDDEWEDVDDVLDYEKLREFVDDEDP 952

Query: 960  GSXXXXXXXXXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                         ++ ++ET  ELL +FFK+   +D++GF +IY  L+E EKR L+
Sbjct: 953  ADFGENDSDEITGLDTLKETIPELLVEFFKDVAARDLNGFHNIYNTLSENEKRILT 1008

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (REAL)
          Length = 1004

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1017 (40%), Positives = 627/1017 (61%), Gaps = 31/1017 (3%)

Query: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72
            M++ EL+  AQS  K  RE+AET LL  C S+   +F +L N+A    + + S+QF L+S
Sbjct: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60

Query: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132
            +RKLITMYW+ GFESY     V    K+ +RE LLKL L D++N+KI++ +SYCIVQI+A
Sbjct: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120

Query: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192
            VDFPD+WP LL  +YDAI++ +S NA+SLL+EI+DDVVSEEMFF+GGIG +TVQI+F +L
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180

Query: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLA 252
            +  +S+   K AA+KL+ +CLLQ+ S +  + +  +S I+Q ++ +L    QLL     +
Sbjct: 181  ATDTSTLVAKFAALKLFKACLLQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240

Query: 253  DPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASVD 312
            +     L LK+  YENL L+K  F K  F  DL+  FK V ++DL+ +    +   +   
Sbjct: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300

Query: 313  EALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSFV 372
            E++ ++V + +I I+ FL+S+        EV+ ++ SL  LC +     +   +D N+FV
Sbjct: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360

Query: 373  SKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLYLLQS- 431
            SKETG++  Y +RD+  +FL  +           LL    SV+  D E+      +L+S 
Sbjct: 361  SKETGLAASYNVRDQSSEFLISLSN--------PLLSLIFSVISKDIERNTYDNQILESL 412

Query: 432  ----CQGNTEEFEVNSQGLVE----LLLRLQNILESQNIHCLVWSRLSITIAKILEKFVC 483
                      + E+  Q L E    L+   QN+L S  +  L  +R  + I K+L+KF+ 
Sbjct: 413  LYLLQSVLLNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFID 472

Query: 484  KLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQ 543
             L +IK +  +F+ K+L +A    N  +K+ +LI++  Y  F  L SVLG + C +++ +
Sbjct: 473  VLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGK 532

Query: 544  VLDIINDIYAEVDDDTPGFLLEVLSGVIASNPES--TNKSLKASELEFVLKLSTSDPYSV 601
            V+ IINDI ++ ++DT G ++EVLS VI+ NP+   + + +  +E   V  +S+ DP +V
Sbjct: 533  VIQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANV 592

Query: 602  QVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTV 661
            QVVV++Q+CL  LL ++  D+Y  Y ELC+PSF++VL ++  + + Y+PL+SL LE +TV
Sbjct: 593  QVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITV 652

Query: 662  FLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQ 721
            FLKK P DGFLP  + +Y+FEPL  +++ S ++E LQL+TE+F++L+ N+    +   L 
Sbjct: 653  FLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLM 712

Query: 722  TAIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHT 781
              + +LERLL+ + S               TKF+  IQ ++ ++LEA   RLV+  NI T
Sbjct: 713  DIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNIST 772

Query: 782  VENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENI 841
             +NL+ V C LT  D +QTV+FLS+  +  D  +AL L++ KW+++FE+IRGEK+IKENI
Sbjct: 773  QQNLLSVLCFLTCNDSRQTVEFLSNFRI--DDKNALSLVMQKWMEAFEVIRGEKRIKENI 830

Query: 842  VALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTE 901
            VALS LFFL+D+R+  ++VNGDLIPY+ D+IITRSMAK +PD+Y ++  Y KIIKL V+E
Sbjct: 831  VALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSE 890

Query: 902  LMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGS 961
            L FQ  QPDP + ++S         Q + +N  N            VL+YEKL+EYI   
Sbjct: 891  LGFQNKQPDPKQLITSNM-------QHDAANLNNDEDNDDWEDVDDVLDYEKLKEYINDD 943

Query: 962  XXXXXXXXXXXMN---NIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                       +    +++E+  ++L +FFKE   KD+SGF  IY  L++ +++ LS
Sbjct: 944  VDGEDEDDSEDITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLS 1000

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1018

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1018 (40%), Positives = 619/1018 (60%), Gaps = 25/1018 (2%)

Query: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72
             D  +LI  AQS     R SAE  LL L   D   VF+S + +ASD    ++S+QF LVS
Sbjct: 7    FDSQQLIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALVS 66

Query: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132
            +RKLITMYW+ GFESY     + E AKE VR+ LLKL L D + SK++SA++YC+VQI+A
Sbjct: 67   LRKLITMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQISA 126

Query: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192
            VDFPD+WP LL  +YD I   +S +A+SLL EI+DDV+SEEMFF+ GIG +T++IVF ++
Sbjct: 127  VDFPDQWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQIV 186

Query: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLA 252
             + +++   K A   L+H+CL Q+L+     + + +    +   E L ++ + L +H++ 
Sbjct: 187  RDPNTNLEAKLAGFNLFHACLQQILTVDLNSAPKRKEMTVECAKEALTVWGEHLQSHSIT 246

Query: 253  DPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASVD 312
            + S + L +K   YE+L+L+K +  KKL PD L   FK + L DL+T GK Y  I     
Sbjct: 247  EHSLQ-LQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKVYLSISQGFV 305

Query: 313  EAL-LQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSF 371
            E   L  ++E AI+II FL++     ++  EV  ++ +L +LC L          D NS+
Sbjct: 306  EGYRLDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLEDFNSY 365

Query: 372  VSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHL-----DWEKQESML 426
            +S E+G++  Y++RD+  + L+ M G NY  + Q +L +   V HL     +W+ QES L
Sbjct: 366  ISMESGLTASYSVRDQASELLTSMDGRNYSLVCQHILYK---VSHLNEWKQEWKFQESFL 422

Query: 427  YLLQSCQGNTEEFEVNS-QGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKL 485
            +L+Q+   N      N    + E+L  L ++L S+++   V SR+ + + KILEK++  L
Sbjct: 423  FLVQAAALNESLPSGNFINEIREVLSFLGSMLCSEDVVSFVSSRIILLLPKILEKYMDLL 482

Query: 486  ENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVL 545
            ++++++    + K+  +A ++ +  +KA  LI++   S+F  L SVLG E CE  +++VL
Sbjct: 483  DDVRILTSHLLTKSAELALATNDDIIKASVLIAFTYCSNFAELSSVLGQEVCEITQKRVL 542

Query: 546  DIINDIYAEVDDDTPGFLLEVLSGVIASN-PESTNKSLKASELEFVLKLSTSDPYSVQVV 604
             +I  I  + +DDT G L+EVL+ VI  N P   N  +  +E   VLK+S  DP ++Q+V
Sbjct: 543  GLIARISEDAEDDTDGVLMEVLNNVIDCNTPGVPNNEIVQTEFSLVLKISAKDPANIQIV 602

Query: 605  VEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLK 664
            VE+Q+CL  LL+ +  D Y  Y E  +PSF+  +       +AY+PL+SL L+ LT FLK
Sbjct: 603  VESQECLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQFLTTFLK 662

Query: 665  KNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAI 724
            K P+D  LP  +    FEPL  ++++SEDDE +QL+TEAF++ L N+    ++ HL+  +
Sbjct: 663  K-PTDYQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVAPHLEAIV 721

Query: 725  MILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVEN 784
             IL+RLL+ D S               T+F+ +I+++MP +L AAA RL+Q  ++ T +N
Sbjct: 722  AILDRLLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLIQAKHLSTSQN 781

Query: 785  LILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVAL 844
            L+ VFC LTSVD +QTVDFL  L LD+  H+AL  I+  WL+SFE IRGE++ KEN++AL
Sbjct: 782  LLSVFCFLTSVDPRQTVDFLFGLHLDNTEHNALYSIVSIWLESFESIRGERRTKENVIAL 841

Query: 845  SKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMF 904
             KL+ L+D R+  + VN ++IPY+G+ IITRSMAK +PD+Y+++S Y KIIKL V EL F
Sbjct: 842  IKLYLLHDKRLMEMQVNDEIIPYEGEQIITRSMAKKMPDRYSQVSVYTKIIKLFVAELNF 901

Query: 905  QYNQPDPDKYMSS-QSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGSXX 963
            Q  QPDP+++++S  +++    N DN ++S              VL YEKLQEY++ S  
Sbjct: 902  QDKQPDPERFITSDMAKEGNNGNSDNDTDSDGE-----WEDVEDVLNYEKLQEYVDESDQ 956

Query: 964  XXXXXXXXXM--NNIQE----TTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                        + I E    +  ++L  FFKE    +  GF+DIY  L E EK+ LS
Sbjct: 957  DGEGSDSDDFFASAIDEYSNASVRDILVSFFKEVAANNTGGFRDIYNSLTEVEKKILS 1014

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1013

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1028 (39%), Positives = 625/1028 (60%), Gaps = 44/1028 (4%)

Query: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72
            MD+++LI+ AQS     R++AE+ LL  C ++   +F SL+  A D + ++AS+QF L+S
Sbjct: 1    MDINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLS 60

Query: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132
            +RKLITMYW+ GFESY     +N+  KE +RE+LL + L D Q+SKI  +++YC+VQI+A
Sbjct: 61   LRKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISA 120

Query: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192
            VDFPD+WP LL  +YD I+  +S NA+SLL+EI+DDVVSEEMFF+G IG +T+QI+F +L
Sbjct: 121  VDFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVL 180

Query: 193  SNTSSSFGIKDAAMKLYHSCLLQL--LSPHALESDENRSQIAQH-VNETLHIFLQLLGNH 249
            SN       K AA KL+++C+LQ+  L P    S   R ++A+  + +++ +  QLL  +
Sbjct: 181  SNNEGKIEAKIAATKLFNACILQMSVLDP---SSSLKRKKLAEECIPKSIQVLGQLLEYY 237

Query: 250  NLADPSN-----ELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYY 304
             +    +      +L+L++  YEN+ L+K + PK+LF  +L  SFK   LKDL +    Y
Sbjct: 238  TIDTTVDSKMLTSILELRSKIYENVVLIKNELPKRLFQRNLMASFKFQTLKDLSSSCTLY 297

Query: 305  -----SQILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMH 359
                 + I     + L  ++ E +I+++ FL++    + +  EV+ +++ L  LC L   
Sbjct: 298  ETYCLNNIEVVNSDNLHDALSECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVLCCLDND 357

Query: 360  QADDLTNDLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDW 419
              ++L  D N+FVSKETG+   YTIRD+  +FL+ +   NY  I Q ++    S M+   
Sbjct: 358  SQEELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFISTMNQPS 417

Query: 420  EKQ---ESMLYLLQSCQGNTEEF-EVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIA 475
                  ES+LYLLQS   N ++   +N   L+E    L ++ + +  +  + SRL + I 
Sbjct: 418  RNDRILESILYLLQSLMTNEDDVTNINPNILLE---PLSSLFDYETENPFLHSRLILLIP 474

Query: 476  KILEKFVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVE 535
            KILEKF+ ++ N+K++ K+F+ K+L  +    +   K  +LI Y  Y+ F  L SVLG +
Sbjct: 475  KILEKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAELPSVLGRD 534

Query: 536  DCEKLERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASNPESTN-KSLKASELEFVLKLS 594
             C +++  +L +I  +  E ++DT G L+EVL+ VI  NPE    + +  +E   VL +S
Sbjct: 535  VCTQVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPEDIAVQGILETEFYMVLSIS 594

Query: 595  TSDPYSVQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSL 654
            + DP ++QV + +++CL  LL+ V +  Y +Y ++C+PSF++V++      + Y+PL+SL
Sbjct: 595  SKDPANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYKYSPLLSL 654

Query: 655  SLELLTVFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKD 714
             LE +TVF+KK P+DG LP  + E++F+PL +++  S +DE LQL+T+AF++LL N+   
Sbjct: 655  ILEFVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYLLYNTDST 714

Query: 715  DISSHLQTAIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLV 774
             +  HL+  + +L+RLL+ + S               +KF++++Q ++P +L AA  +LV
Sbjct: 715  LMIPHLEEIVAVLDRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTILRAAVTKLV 774

Query: 775  QVNNIHTVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGE 834
            Q  NI T +NLI + C LT  D  QT++FL  L    + HS    ++ KW ++FE+IRGE
Sbjct: 775  QAKNISTQQNLISLLCFLTCTDPLQTIEFLYGL---DETHSTFAAVMNKWFEAFEVIRGE 831

Query: 835  KKIKENIVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKI 894
            KKIKENI+ALSKL+F  D R+ ++LVNGDLIPY+GDLIITRSMAK++PDKYT+I AY KI
Sbjct: 832  KKIKENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYTQIPAYTKI 891

Query: 895  IKLMVTELMFQYNQPDPDKYMSSQSEKLTKTNQDNKS---NSGNAXXXXXXXXXXXVLEY 951
            IKL V+EL FQ          + Q+ + T  N D K                    VL+Y
Sbjct: 892  IKLFVSELSFQ----------TQQTGEPTVLNADLKGIEKEEEEVGDDDEWEDVDDVLDY 941

Query: 952  EKLQEYIE----GSXXXXXXXXXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLN 1007
            +KL+EY++                 + +++ET +ELL +FFKE   KD + F  IY  L+
Sbjct: 942  DKLKEYVDDEDPAEFGEDDKDEITGLADVKETVTELLLEFFKEVTSKDTNNFHAIYNTLS 1001

Query: 1008 EQEKRCLS 1015
            +  K+ LS
Sbjct: 1002 DNGKKILS 1009

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
            complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1005 (39%), Positives = 628/1005 (62%), Gaps = 22/1005 (2%)

Query: 14   DLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSI 73
            D+ +LI  AQSP    RE AE+ LL+ C  D   VF S+I + S+   E++S+ F L+++
Sbjct: 3    DIHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALLTL 62

Query: 74   RKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAV 133
            RKLITMYW+ GFESY     +NE  K   R++LLK+ L DSQ++KI +AS+YC+VQI+AV
Sbjct: 63   RKLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQISAV 122

Query: 134  DFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLLS 193
            DFPD+WP+LL+ VY AI   +S +A+SLL+EI+DDV+SEEMFF+ GIG +T++I+FS+L+
Sbjct: 123  DFPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSVLT 182

Query: 194  NTSSSFGIKDAAMKLYHSCLLQL--LSPHALESDENRSQIAQHVNETLHIFLQLLGNHNL 251
            + ++    K A+ KL+HSCLLQ+  L P ++   + +  + + +++ L I+  LL   N+
Sbjct: 183  DNNTGIAAKIASSKLFHSCLLQMSVLDPQSVH--KRKQLVTECISQILTIWSGLLQKQNV 240

Query: 252  ADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASV 311
             + S+E  +L++  YE+L ++K++FP+KLF  +    F+ + + DL+   K Y+ +L+S 
Sbjct: 241  TEMSSE-FELRSKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDLNIAAKCYNNVLSSE 299

Query: 312  D-EALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNS 370
            + +  +  ++E  I+II FL+++ + +    ++  + +S V L  +  +  +  T D NS
Sbjct: 300  NSDTEMIHINEFVIHIIEFLTAISDFKFSPEDIGTISKSFVTLSCIDRNTEESWTADFNS 359

Query: 371  FVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVM--HLDWEKQESMLYL 428
            F+SKETG+   +TIRD++  F+S++    Y   +  +L +   ++  + DW  QES+LYL
Sbjct: 360  FISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNSDWRTQESVLYL 419

Query: 429  LQSCQGN----TEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCK 484
            LQ    +     E  + N+Q LV     + NI+ +      V  R  +TI K+LEKF+  
Sbjct: 420  LQCIATSETEINESLQCNTQILVT---AIGNIISNPPTQSFVLMRSILTIPKLLEKFMET 476

Query: 485  LENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQV 544
            L ++K   K+ +  +L IA SS +  +++  LI++  Y+SF  L SVLG   C   + +V
Sbjct: 477  LPDVKEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACRVEQEKV 536

Query: 545  LDIINDIYAEVDDDTPGFLLEVLSGVIASN-PESTNKSLKASELEFVLKLSTSDPYSVQV 603
            L +I ++  + ++DT G L+EVL+ VI  N P+  ++++   E +F+L +S  DP ++Q+
Sbjct: 537  LKLIQNLSNDSEEDTNGVLVEVLNNVIDCNSPQHLDETILEVEFDFLLTISVKDPSNIQL 596

Query: 604  VVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFL 663
            +VEAQ+CL  L++ +  + Y  YA   +P  ++V+      G++Y+PL+SL+LE + + +
Sbjct: 597  IVEAQECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALEFINILM 656

Query: 664  KKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTA 723
            +  P D  LP  + E +F PL  ++M S++DE LQL+TEAF+FLL NS+ D I  +L+  
Sbjct: 657  RNRPDDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIFPYLEEI 716

Query: 724  IMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVE 783
            I +L RLL+ D S               TKF++Q+Q+++P +L A   + +   NI T +
Sbjct: 717  INVLSRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAKNISTSQ 776

Query: 784  NLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVA 843
            NL+ VFC L   D  +T+DFL +L + +   S+L L++ KWL+SFEIIRGEKKIKENI+A
Sbjct: 777  NLVSVFCLLVCTDPARTIDFLYNLEIGTPPQSSLPLVLTKWLESFEIIRGEKKIKENILA 836

Query: 844  LSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELM 903
            LSK++FL DSRV++I VNGD+IPY GDLIITRSMAKS+PDKYTR+S Y+KI+KL V EL 
Sbjct: 837  LSKIYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKLFVAELG 896

Query: 904  FQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGSXX 963
            FQ  + DP   + S+ ++     Q   +  G             VL+YEKLQEYI+    
Sbjct: 897  FQTKEQDPSDLVDSKLKQELGIPQQMGAAHG-DDDDDDWEDVDDVLDYEKLQEYIDDDDE 955

Query: 964  XX-----XXXXXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIY 1003
                          +  + +TT ELL +FFKEA  KDI+ F++IY
Sbjct: 956  EEYVGGPESQEITGIEEVTQTTKELLIEFFKEAASKDINSFQEIY 1000

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (REAL)
          Length = 1015

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1023 (40%), Positives = 627/1023 (61%), Gaps = 36/1023 (3%)

Query: 10   TTKMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFC 69
            TT MD+++LI+ AQS     RE AE  LL  C SD   +F +L+N A    + + S+QF 
Sbjct: 8    TTDMDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSALQSRQFA 67

Query: 70   LVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQ 129
            L+S+RKLITMYW+ GFESY     V+   KE +RE LLKL L D++N++I + +SYCIVQ
Sbjct: 68   LLSLRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQ 127

Query: 130  IAAVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVF 189
            I+AVDFPD+WP LL  +YD I+  +S NA+ LL+EI+DDVVSEEMFF+GGIG +T +I+F
Sbjct: 128  ISAVDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIF 187

Query: 190  SLLSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLG-N 248
             +L   +SS   K AA+KL  +CLLQ+ S +    +  +  ++Q ++ +L    QLL  N
Sbjct: 188  KVLVAETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLN 247

Query: 249  HNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTL-------- 300
             +  D  ++ L LK+  YENL  +K  F KK F + L+  FK VA++DL  +        
Sbjct: 248  FDNEDVISQ-LKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDD 306

Query: 301  GKYYSQILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQ 360
            G Y         E  +++V + ++ I+ FL+S+        E++ ++ +L  LC +    
Sbjct: 307  GDYPES------ENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDA 360

Query: 361  ADDLTNDLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWE 420
            ++   +D N FVSKETG++  Y IRD+  +F + +       IF  ++ +   +   + +
Sbjct: 361  SELWISDFNEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIF-GVVSKNIDLNTSNHQ 419

Query: 421  KQESMLYLLQSCQGNTEEFEVN--SQGLVELLLRLQNILESQNIHCLVWSRLSITIAKIL 478
              ES+LYLLQ    N +E      +Q L  LL  LQN L S  IH L  +R+ + I K+L
Sbjct: 420  TFESLLYLLQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLL 479

Query: 479  EKFVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCE 538
            +KF+  L +IK +   F+ K+L +A       +K+ +LI++  Y  F  L SVLG + C 
Sbjct: 480  DKFIDVLPDIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCT 539

Query: 539  KLERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASN---PESTNKSLKASELEFVLKLST 595
            +L+ +V+ IIN+I  + ++DT G ++EVL+ VI+ N   P S  + L+A E+  V  +S+
Sbjct: 540  ELQEKVIQIINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQA-EVHLVFTISS 598

Query: 596  SDPYSVQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLS 655
             DP +VQVVV++Q+CL  LL  +  D+Y  Y ELC+PSF++VL A+  + + Y+PL+SL 
Sbjct: 599  KDPANVQVVVQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLV 658

Query: 656  LELLTVFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDD 715
            LE + VFLKK P+DG+LP  + +Y+FEPL  +++ S +DE LQL+TEAF++L+ N+    
Sbjct: 659  LEFIAVFLKKRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQT 718

Query: 716  ISSHLQTAIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQ 775
            + + L   + ILERLL+ + S               T+F+ ++Q ++ ++L+A   RLV+
Sbjct: 719  MQTRLMDIMKILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVK 778

Query: 776  VNNIHTVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEK 835
              NI T +NL+ V C LT  D KQTVDFLSS  +  D   AL L++ KW+++FE+IRGE+
Sbjct: 779  AQNISTQQNLLSVLCFLTCNDTKQTVDFLSSFRI--DDKEALSLVMSKWMEAFEVIRGER 836

Query: 836  KIKENIVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKII 895
            KIKE+IVALSK FFLND R+  ++VNGD+IPY+GDLIITRSMAK +PDKY ++  Y KII
Sbjct: 837  KIKESIVALSKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKII 896

Query: 896  KLMVTELMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQ 955
            KL ++EL FQ  Q DP++ ++S  ++    N D+++                VL+YEKL+
Sbjct: 897  KLFISELGFQAKQLDPEQLVASSIQESANANNDDETGDWE--------DVDDVLDYEKLK 948

Query: 956  EYIEGSXXXXXXXXX---XXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKR 1012
            EYI+                + +++E+  ++L  FF+E   K++S F  IY  L++ E++
Sbjct: 949  EYIDDDVDGEEEDDRDDITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERK 1008

Query: 1013 CLS 1015
             LS
Sbjct: 1009 TLS 1011

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241w KAP114
          Length = 1021

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1013 (39%), Positives = 618/1013 (61%), Gaps = 19/1013 (1%)

Query: 18   LILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLI 77
            LI  AQSP    RE AET LL+ C ++   VF SLI +  +    +AS+ F L+S+RK I
Sbjct: 9    LIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLSLRKFI 68

Query: 78   TMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPD 137
            TMYW+ GFESY G   V  G KE +R+ LLKL L D Q++K+ ++SSYC+VQI+AVDFPD
Sbjct: 69   TMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISAVDFPD 128

Query: 138  EWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLLSNTSS 197
            EWP LL T+Y+AIT ++S NA+SLL+EI+DDV+SEEMFF+GGIG++T+QI+F+LL+N   
Sbjct: 129  EWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLLTNAQV 188

Query: 198  SFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLADPS-- 255
                K +A+KL+ +C+ Q+       S + +  +++ + + L     LL    +      
Sbjct: 189  RLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQALQTIKLLLEQCEIIQSDLT 248

Query: 256  --NELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTL-GKYYSQILASVD 312
              NE L+ K + Y+++  +K  FP+K FP+D+      +A++DLD L G Y      + D
Sbjct: 249  SINETLEFKDNLYDDINSIKENFPRKFFPEDVNLYVTNIAVRDLDQLAGLYQESFKDNFD 308

Query: 313  EALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSFV 372
            E  +   +   I+++ FL++     L    ++N+L + + LC       D   +D N F 
Sbjct: 309  EQSMSIFENCVIHLLDFLAN-PISPLNNELISNILTASITLCEQSALTKDSWESDFNEFA 367

Query: 373  SKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQ-AGSVMHLDWEKQESMLYLLQS 431
            SKETG+S  +TIRDEV + ++          F+ ++   + +  HL  +K ES LYLLQ 
Sbjct: 368  SKETGLSASFTIRDEVAELVNAFEIPQLETSFELIVGYLSNNSSHLSADKIESALYLLQ- 426

Query: 432  CQGNTEEFEVNSQGLVELLLRLQNILESQ-NIHCLVWSRLSITIAKILEKFVCKLENIKL 490
            C  N E+   N+  +  L+  ++++L  Q N+  +   RL + I K L KF+  L N+K 
Sbjct: 427  CLMNVEDDFSNTSLVPSLIEFIKSMLSQQNNLDQMSQIRLLLLIPKTLAKFMDILPNVKQ 486

Query: 491  IVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIIND 550
            +  E + + L++A++S +  +   +LIS+  ++S+  + SVLG +    ++ + L +I +
Sbjct: 487  LTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQTLLVQNKTLHLIQE 546

Query: 551  IYAEVDDDTPGFLLEVLSGVIASNPES-TNKSLKASELEFVLKLSTSDPYSVQVVVEAQD 609
            I  E  +DT G L+EVL+ VI  N ++  N  L   E + +L +S  DP ++QV +E+Q+
Sbjct: 547  ISEESTEDTNGLLMEVLNCVIDCNDKNVANMELFKFEFKLILVISGKDPANIQVSIESQE 606

Query: 610  CLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNPSD 669
            CL  LL  V ++DY+ + ++CIPSF++++++     ++Y+PL+SL LE +TVF+K  P +
Sbjct: 607  CLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSLVLEFITVFMKNKPQE 666

Query: 670  GFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMILER 729
              LP SV EYVF+PL S ++ S ++ELLQ++TEAF++++ NS KD I+  L+T + IL+R
Sbjct: 667  ALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKDVITPKLETIVNILDR 726

Query: 730  LLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLILVF 789
            LL+S+ S               T++++ +  ++P ++ AA R+LV  NNI T +NL+ + 
Sbjct: 727  LLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLVVSNNITTQQNLVTLL 786

Query: 790  CHLTSVDVKQTVDFLSSLILDSDG--HSALQLIIPKWLDSFEIIRGEKKIKENIVALSKL 847
            C L   D KQTVDFL  L + +D     AL +II KWLD+F ++RGE +IKENIVALS+L
Sbjct: 787  CFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVRGENRIKENIVALSQL 846

Query: 848  FFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQYN 907
            F L D RV  + VNG++IPYDGDLIITRSMAKS+PD+YT +SA EKI+K+ + EL FQ  
Sbjct: 847  FLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPEKIVKMFLGELGFQGR 906

Query: 908  QPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGSXXXXXX 967
              +P++ +++   K      + +SN  N            V++YEKLQEYI+        
Sbjct: 907  NKNPEELLTTDDMKGMGLKPNQQSN--NDEGDDDWEDVDDVVDYEKLQEYIDDEDDLDDN 964

Query: 968  X-----XXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                        +I ++  ELL  FF  A  K+++GF++IY  L+E+E++C+S
Sbjct: 965  SVGELETITGQQHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLSEEERKCIS 1017

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] {ON}
            similar to uniprot|P53067 Saccharomyces cerevisiae
            YGL241W
          Length = 1009

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1013 (37%), Positives = 595/1013 (58%), Gaps = 21/1013 (2%)

Query: 14   DLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSI 73
            D   LIL AQSP+ + R+S+E  LL +C  D   VFV  + +A+D   E+ S+QF L+++
Sbjct: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALLTL 62

Query: 74   RKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAV 133
            RKL+TMYW  GFES+ G   V   A+ ++R+ LL+L L + Q SKI + +SY +VQI+AV
Sbjct: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122

Query: 134  DFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLLS 193
            DFPD+WP LL+ VY+AI   +S  A+ LL+EI+DDV+SEEMFF+ GIG++T++IVF +++
Sbjct: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHVMN 182

Query: 194  NTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLAD 253
            +  +++  K AA+ L H C+LQ+ + +   + + +    +   E L +++  L   N   
Sbjct: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242

Query: 254  PSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASVDE 313
                 L   A  Y+ LTLLK +F KK+   D+   F+T+ ++DL+   + Y Q++ +  +
Sbjct: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQ 302

Query: 314  ALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSFVS 373
              L +++E A+NI+ FLSSL +      E+  +L  L +LC L     D    D NSFVS
Sbjct: 303  DQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVS 362

Query: 374  KETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLD--W---EKQESMLYL 428
            KETG+   +TIRD+  + LS     +Y  +   L+ +   +      W   E    +L  
Sbjct: 363  KETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFNESLLYLLQS 422

Query: 429  LQSCQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENI 488
            L   + N+ EF      +  +  +LQ+ILE       V  R+ + I K+LEK +    N+
Sbjct: 423  LLLNEANSLEF---MDAVTRIFTKLQSILEKSLSCVFVNCRIILLIPKLLEKIMDSFPNV 479

Query: 489  KLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDII 548
            + +V+ F+F +L  A S  N  +K+ +LIS+  YS F  L SVLG ++C +++++ L +I
Sbjct: 480  RDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLI 539

Query: 549  NDIYAEVDDDTPGFLLEVLSGVIASNPESTN--KSLKASELEFVLKLSTSDPYSVQVVVE 606
              +Y E +DDT G L+EVL  VI  N E+ +   S+  +E   V  +S+ DP ++Q  +E
Sbjct: 540  AQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIE 599

Query: 607  AQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKN 666
             Q+CL  LL+ V    +I + E+C P  V+V+       F Y+PL+SL+L++L V +K+ 
Sbjct: 600  LQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTLQVLGVLMKRK 659

Query: 667  PSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMI 726
            P D  L  ++   VFEPL +++  S+D+E+LQ +TEA  +L+ N++ + I  HL++ + I
Sbjct: 660  PLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNI 719

Query: 727  LERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLI 786
            L+ LL+                   +KF+++IQ+++P +L+AAA RL Q  NI T +NL+
Sbjct: 720  LDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLL 779

Query: 787  LVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSK 846
             VFC +TS D +QTVDFL +  + +   + L L++ KWL+SF+++RGEK+ KENI+ LSK
Sbjct: 780  SVFCFVTSADAQQTVDFLFNTTISN--QNGLNLVMSKWLESFDVVRGEKRTKENIITLSK 837

Query: 847  LFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQY 906
            LFFLND R+ ++ VNGDLIPY+ D+IITRSMAK +PD+YT++S Y KIIKL  +EL FQ 
Sbjct: 838  LFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQG 897

Query: 907  NQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGSXXXXX 966
               DP   M+      T   + N   + +             LEYE+LQ Y+E       
Sbjct: 898  KHQDPQLLMAG-----TYGIETNTEENQDDDDNDDWEDVEGPLEYERLQHYVEEDETDDR 952

Query: 967  XXXXXXM----NNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                       N    +  +LL  FFKE   K+ISGF+ IY +L++ EK+ LS
Sbjct: 953  GEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILS 1005

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1017 (38%), Positives = 618/1017 (60%), Gaps = 16/1017 (1%)

Query: 14   DLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSI 73
            D+  LI HAQS   + RE+AE+ LL  C  +   VF SLI +A++ +  ++S+QFC++S+
Sbjct: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62

Query: 74   RKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAV 133
            +KLITMYW+ GF+SY G   V E  KE +R++LLKL L   Q+SKI S+SSYCIVQI+A+
Sbjct: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122

Query: 134  DFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLLS 193
            DFPD WP+LL  +Y+AI  D+S  A+SLL+EI+DDV+SEEMFF+GG+G +T++ +F++ +
Sbjct: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAIFT 182

Query: 194  NTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLAD 253
            +  ++   K AA KL HS +LQ+       S + +  ++Q + + L I L +L  H   +
Sbjct: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCITKLLDILLTILP-HLDVN 241

Query: 254  PSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILAS-VD 312
             S + L LK + YE LT +KT+FPKKLF + L  +FK ++LKDL+ +G  Y Q + S   
Sbjct: 242  QSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDAS 301

Query: 313  EALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSFV 372
             + LQ ++E  +++I F+SSL     +  ++  ++ SLV LC L  +  +   +D N+F+
Sbjct: 302  GSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNTFI 361

Query: 373  SKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVM--HLDWEKQESMLYLLQ 430
            SKE G+   YTIRD+  QF SD+    Y   +  +LE+    M  + +W+ QES+LY LQ
Sbjct: 362  SKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYTLQ 421

Query: 431  SCQGNTEEFEVNSQGLVELLLR-LQNILESQNIHCLVWSRLSITIAKILEKFVCKLENIK 489
            S   + EEF     G  E +L  L  +L   + + +V SR  +   K LEKF+     +K
Sbjct: 422  SIISSEEEFNSELLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTAVK 481

Query: 490  LIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIIN 549
             + KE +  +L ++ ++ +  +K+  LI++  Y+S+  L SVLG  DC  +++ +L II 
Sbjct: 482  PMTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKIIK 541

Query: 550  DIYAEVDDDTPGFLLEVLSGVIASNPESTNK-SLKASELEFVLKLSTSDPYSVQVVVEAQ 608
            DI  + ++DT    +E +S VI +N   T    ++ +E   +L++S  DP ++Q+ VE+Q
Sbjct: 542  DIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGNIQLSVESQ 601

Query: 609  DCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNPS 668
            +CL  LL  +    YIYYAE  IP  + ++    +  + Y+PL+SL+L+ L  F+KK P 
Sbjct: 602  ECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKPV 661

Query: 669  DGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMILE 728
            D  LP  + + VF P+  +++SS ++E +QL+TEAF+FL+ NS    + + L+  + +L 
Sbjct: 662  DSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVNVLS 721

Query: 729  RLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLILV 788
            +LL+ + S               +KF+ QIQ+++P +L+A  ++ V   NI T +NL++V
Sbjct: 722  KLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNLLMV 781

Query: 789  FCHLTSVDVKQTVDFLSSLIL-DSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSKL 847
            FC L   D +QTVDFL +L L D    + L L++ KWL+ F+IIRGEK+IKENI+ALSK+
Sbjct: 782  FCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIALSKI 841

Query: 848  FFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQYN 907
            + L D R+  ++VNGD+IPY GD IITRSMAKS+PD++T++  YEKI+KL + EL  Q  
Sbjct: 842  YLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELASQSK 901

Query: 908  QPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEG------- 960
                    S   +KL +  ++      ++           VL+YEKLQEY++        
Sbjct: 902  NISDANLHSIDIQKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVDDDDDELAN 961

Query: 961  --SXXXXXXXXXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
              S           + +I ++ SEL+  FFKE   K+I+ F+DIY+ L+E EK+ L+
Sbjct: 962  YTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLLA 1018

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/1017 (39%), Positives = 611/1017 (60%), Gaps = 27/1017 (2%)

Query: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72
            MD+S LI  AQS     RE+AE  LL  C SD   VF SL ++A      + S+QF L+S
Sbjct: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60

Query: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132
            +RKLITMYW+ GFESY     V+   KE +RE LL L L  ++N+KI + +SYCIVQI+A
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISA 120

Query: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192
            VDFPD+WP LL  +YDAI+  +S NA+SLL+EI+DDVVSEEMFF+GGIG +TV+I+F +L
Sbjct: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180

Query: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLA 252
            +  +S+   K AA+KL+ +CL Q +S H   +DE+R+     +N+ L   LQ LG     
Sbjct: 181  TTEASNLVAKIAALKLFKACLSQ-MSSHDKHNDESRNNF---INQCLSTSLQTLGQLLTL 236

Query: 253  DPSNELL----DLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQIL 308
            D  NE +      ++  YENL  +K  F KK FP + +  FK VA+KDL  +        
Sbjct: 237  DLVNEDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDG 296

Query: 309  ASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDL 368
             + +E  L++V   ++ I+ FL+++        E+  +++SL  LC +          D 
Sbjct: 297  PTENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDF 356

Query: 369  NSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIF----QTLLEQAGSVMHLDWEKQES 424
            N FVSKETG++  Y +RD+V +F + +   N   +F    Q +++   +   L+      
Sbjct: 357  NYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLL 416

Query: 425  MLYLLQSCQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCK 484
               LL   +   +    +SQ L+E    L++ L S  ++ +  +RL + I K+L+KF+  
Sbjct: 417  QCILLNDDEITGQNIIQSSQSLIE---NLRSELVSSELNEVTLARLILIIPKVLDKFIDV 473

Query: 485  LENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQV 544
            L +IK +   F+  +L +A       +++  LI++  Y  F  L SVLG E C ++++ +
Sbjct: 474  LPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVQQNI 533

Query: 545  LDIINDIYAEVDDDTPGFLLEVLSGVIASN---PESTNKSLKASELEFVLKLSTSDPYSV 601
            + IIN+I  + ++DT G ++EVL+ VI+ N   P  + + L+A E   V  +S+ DP +V
Sbjct: 534  IQIINEISDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQA-EFHLVFSISSKDPANV 592

Query: 602  QVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTV 661
            QVVV++Q+CL  LL  +   +Y+ Y ELC+PSF++VL A+  + + YTPL+SL LE +TV
Sbjct: 593  QVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITV 652

Query: 662  FLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQ 721
            FLKK PS  FLP  + +++FEPL  ++  S +DE LQL+TEAF++L+ N+    +   L 
Sbjct: 653  FLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLM 712

Query: 722  TAIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHT 781
              + +LERLL+ + S               T+F+ +IQ ++ ++L+A   RLV+  NI T
Sbjct: 713  DIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNIST 772

Query: 782  VENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENI 841
             +NL  V C LT  D KQTVDFL S  +  D   AL L++PKW++SFE++RGE++IKENI
Sbjct: 773  QQNLFSVLCFLTCNDPKQTVDFLCSFQI--DNMDALSLVMPKWMESFEVVRGERRIKENI 830

Query: 842  VALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTE 901
            +AL KLF L+D+R+  ++VNGDLIPYDGDLIITRSMAK +PDKY ++  Y KIIKL V+E
Sbjct: 831  IALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSE 890

Query: 902  LMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYIEGS 961
            L FQ  QP+P++ +++    + K   +N ++  N            VL+YEKL++YI   
Sbjct: 891  LGFQNKQPNPEQLITTD---IAKDAANNDNDDDNDADNDDWEDVDDVLDYEKLKDYIGDD 947

Query: 962  XXXXXXXXXXXMN---NIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015
                       +    +++E+  ++L  FFKE   KD+SGF  IY  L+E E++ LS
Sbjct: 948  VDGGEEDDSEDITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLS 1004

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1009

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1021 (38%), Positives = 618/1021 (60%), Gaps = 34/1021 (3%)

Query: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAE--VASKQFCL 70
            M++ ELI   QSP    R  AE+ L+++   D   V  SLIN+A + SAE  +  +QF L
Sbjct: 1    MNMDELIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALN-SAEKPLTERQFAL 59

Query: 71   VSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQI 130
            +S+RKLIT YW+  FESY     ++   K+ VR++LL+L L DSQ++KI  ++SYCIVQI
Sbjct: 60   LSMRKLITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQI 119

Query: 131  AAVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFS 190
            +AVDFPDEWP LL+ +Y AIT  +S +A+SLL+EI+DDV+SEEMFF+GGIG +T+QI+F 
Sbjct: 120  SAVDFPDEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQ 179

Query: 191  LLSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVN----ETLHIFLQLL 246
            LLS+ +S+   K AA+ L+H+ LLQ+ +  +  + E R ++ ++      +TL   L+ L
Sbjct: 180  LLSSDASTIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLEGL 239

Query: 247  GNHNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQ 306
             + N A P    L LK   Y++L  +K +FP +LFP      FK  A++DL  L      
Sbjct: 240  ADINSALP----LQLKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDLVALQINQDS 295

Query: 307  ILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTN 366
                 D+ ++++ +E AI++I  +SS+   E    + + +L++L+ L  L  +  +  T 
Sbjct: 296  F---ADDTVVEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLDANTKESWTT 352

Query: 367  DLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVM--HLDWEKQES 424
            D N FVSKETG++  +TIRD+V  +L    G   + +F+ +L+    ++  + D    ES
Sbjct: 353  DFNDFVSKETGLAASFTIRDQVADYLGTPTGAQSQTMFENILQLVSDILSSNADPTTIES 412

Query: 425  MLYLLQSCQGNTEEFEVNS-QGLVELLLRLQNILESQNIH--CLVWSRLSITIAKILEKF 481
             L+LLQS      +F V+S Q LV+L+  L    ++ N H   ++ SR+ +TI KIL+ F
Sbjct: 413  SLFLLQSVLAEDTDFSVSSPQTLVQLISALIGP-QTINTHNDSILRSRIILTIPKILDVF 471

Query: 482  VCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLE 541
            +  L NIK + K+ + KTL  A SS +  +   +LI++  Y  F  L SVLG E C +L+
Sbjct: 472  MDSLPNIKQLTKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPSVLGSESCRELQ 531

Query: 542  RQVLDIINDIYAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYSV 601
              VL I+N + +E ++DT G L+EVL+ VI+ N  ST+  L   EL  +L +S+ DP ++
Sbjct: 532  EAVLGIVNHVASEAEEDTNGLLIEVLNHVISCNVASTDFKLLQKELTAMLSISSKDPSNI 591

Query: 602  QVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTV 661
            +V VE+Q+CL  LL  + ++ Y  +  +C+PSFV++++ +    + Y PL+SL LE + +
Sbjct: 592  EVSVESQECLEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYNPLLSLILEFVRI 651

Query: 662  FLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQ 721
            F+KK P++G LP++  E +   L  ++  SE+DE LQL+T AF+ LL N+    +  HL 
Sbjct: 652  FMKKKPTNGMLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLNNTDPTIVIQHLT 711

Query: 722  TAIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHT 781
              I +L+RLL+   S                K++ ++ +++P +LE+A  RL+   N+ T
Sbjct: 712  VVIKVLKRLLSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESAIYRLIDAKNVTT 771

Query: 782  VENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENI 841
             ENLI + C++T  D  Q V+FL     +S+      L+  KW ++FEI+RGE+KIK+NI
Sbjct: 772  QENLISLICYVTCCDPLQMVNFLFKFS-ESERRDIPSLMFNKWFETFEIVRGERKIKDNI 830

Query: 842  VALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTE 901
            +ALSK+FFL+D R+  + VNGDL+PY+GD IITRSMAK +PD+YT+I  Y KI+K+ VTE
Sbjct: 831  IALSKIFFLSDFRLTYVKVNGDLLPYEGDRIITRSMAKEMPDRYTQIDVYSKIVKVFVTE 890

Query: 902  LMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYI--- 958
            L F+  QPD ++ ++S      K + +  +  GN            VL+YEKL+E++   
Sbjct: 891  LQFRNKQPDAERLITSD----IKHSDELAAAEGND--DDGWEDVDDVLDYEKLKEFVDDD 944

Query: 959  ----EGSXXXXXXXXXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCL 1014
                +             ++ + ++ ++LL+ FFKEA+  +++GF+++Y  L+E E+  L
Sbjct: 945  DDREDSVGLGNDADEITGIDAVPQSATQLLTAFFKEAMTNNVNGFQEMYNALSESERTIL 1004

Query: 1015 S 1015
            S
Sbjct: 1005 S 1005

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
            YGL241W
          Length = 1012

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1027 (37%), Positives = 610/1027 (59%), Gaps = 39/1027 (3%)

Query: 14   DLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSI 73
            D+S+LI  AQSP    RE AE  LL  C S+   +F +L ++A + S ++A++QF L+S+
Sbjct: 4    DISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFALLSL 63

Query: 74   RKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAV 133
            RKLIT YW+ GFESY     ++   K  +R  L++L L D+Q+SKI S++SYC+ QI+AV
Sbjct: 64   RKLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQISAV 123

Query: 134  DFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL- 192
            DFPD+WP LL  +Y  IT  YS +A+ LL+EI+DD+VSEEMFF+G IG +T+ IV+ LL 
Sbjct: 124  DFPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQLLE 183

Query: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLA 252
            S  + S   + A + L ++ + Q+ +  +  +++ +  +++ +   L +   +L   +  
Sbjct: 184  SGDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSESIPRALGLLSNILEMSH-R 242

Query: 253  DPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASVD 312
            D S + L      YE L L+K + PKK F    + ++K + L  L  L   Y+ +     
Sbjct: 243  DISTDSLTFIGKIYEILVLIKNELPKKFFSAQTRDAYKRITLNTLSLLQNKYASMTEPA- 301

Query: 313  EALLQSVDESAINIIGFLSSL-HECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSF 371
            E  L+S  E AI+ + FL+SL +       E   +L SL+ LCSL     +    D N F
Sbjct: 302  ETELESFSECAIHTLEFLTSLSYNTNFTEEERTIILNSLLVLCSLDPVTKETWLADFNHF 361

Query: 372  VSKETGVSGVYTIRDEVFQFLSDMIGTNY----RNIFQTLLEQAGSVMHLDWEKQ-ESML 426
            VSKETG+   YTIRD+ F+FL+ +I  N+    ++IFQ       S        Q E+  
Sbjct: 362  VSKETGLLPSYTIRDQSFEFLTSLIDQNFQLILKSIFQYFFTLISSSSPSVDPSQLETTF 421

Query: 427  YLLQSCQGNTEEFE-VNSQGLVELLLRLQNILESQNIH-CLVWSRLSITIAKILEKFVCK 484
            YLLQS   N ++ E VN++ +  +L  L ++L   N+H  L+ SR+ + + KILEKF+  
Sbjct: 422  YLLQSILSNDDDIENVNNEEITSVLRVLPSLL--TNVHDSLMVSRIILALPKILEKFMDD 479

Query: 485  LENIKLIVKEFIFKTLTIA-SSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQ 543
            L ++K +V+ F+ ++  +A   S +  +K+  LIS+  Y  F  L SVLG E C  +++ 
Sbjct: 480  LPDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELPSVLGPELCASIQKS 539

Query: 544  VLDIINDIYAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYSVQV 603
            +L ++  +  E +DDT G L EVL+ +I  N  +T++ +  +E   +  +S+ DP +VQ+
Sbjct: 540  ILTLMKQVSNESEDDTNGLLTEVLNNIIECNSTNTSQEILQTEFSLLFSISSKDPSNVQI 599

Query: 604  VVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFL 663
            VVE+Q+ L  LL  V    Y+ Y ++ +P F++++ A+ T  + Y+PL+SL LE +T+F+
Sbjct: 600  VVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYRYSPLLSLVLEFITIFM 659

Query: 664  KKNPSDG-FLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQT 722
            KK PSD   LP+S++  +F+PL  ++ +S +DE LQL+T+AF +++ N+  + +  +L+T
Sbjct: 660  KKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTYIIYNTDSEKVMPYLET 719

Query: 723  AIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTV 782
             + IL+RLL+ D +               TKF+ QI  ++P +L AA  RL+   NI T 
Sbjct: 720  VVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTILNAAVNRLIDCKNISTQ 779

Query: 783  ENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIV 842
            +NL+ + C L   + ++TVDFL +L       + ++ ++ KW +SFEIIRGEKKIKENI+
Sbjct: 780  QNLVSLLCFLFYSNTQETVDFLFNL----PQQNIVRDVLIKWFESFEIIRGEKKIKENII 835

Query: 843  ALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTEL 902
            AL KL+ L+D ++ +I VNGD+IPY+GDLIITRS AKSLPDKYT+I+ +EKIIKL + EL
Sbjct: 836  ALGKLYCLHDEKLFSIKVNGDIIPYEGDLIITRSRAKSLPDKYTQITIFEKIIKLFIAEL 895

Query: 903  MFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEYI---- 958
             FQ  QP  +  M++++  L  +N+++                  VL+Y+KL+EY+    
Sbjct: 896  GFQNKQPAIENLMTNETTALGDSNENDDEWEDVD----------DVLDYDKLKEYVNDED 945

Query: 959  --EGSXXXXX----XXXXXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKR 1012
              +G                + ++ +T +EL+  FFK+   K+++ F+ IY  L+E EK 
Sbjct: 946  ELDGEDSREYGEGDEEEITGLGDVSQTVTELIIGFFKDVTSKNVNNFQSIYDTLSENEKM 1005

Query: 1013 CLSIYIV 1019
             L+ Y+V
Sbjct: 1006 ILTQYLV 1012

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1022 (36%), Positives = 594/1022 (58%), Gaps = 37/1022 (3%)

Query: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72
            +D+  LI  AQSP    RE AE +LL  C  D  S F +L N+A++ +  ++S+Q+ L++
Sbjct: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSLLA 62

Query: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132
            +RKLITMYW+ GFESY     +NE  K  VR  +L+L L  +Q+SKI  + SYCIVQ++A
Sbjct: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122

Query: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192
            VDFPD WP LL T+Y +I   +S  ALS+L+EI+DD++SEEMFF+ GIG +T++++F++L
Sbjct: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182

Query: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLG----N 248
             + ++    K AA KL++ CL+Q+       S +  + +   + E +  + Q+L     +
Sbjct: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLED 242

Query: 249  HNLADPSNELLDLK--AHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQ 306
              L  P   +L+ K     YE L  + + F KK+ P +    F+  +L+DL      Y  
Sbjct: 243  ALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYIN 302

Query: 307  ILASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTN 366
            +++  D     ++++  I+I  +LS++     E  E+  +LES+ +LC L     +   +
Sbjct: 303  MISG-DNIAFNALNKYIIHIFEYLSNISRANYEREELILILESIYKLCCLDNLIVETWNS 361

Query: 367  DLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHL-DWEKQESM 425
            + N FVSKE G+   Y++RD++  FL  +   N+  IF+  +    + + + DW + ESM
Sbjct: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLESM 421

Query: 426  LYLLQSCQGNTEEFEVNSQGLVELLLRLQNILES--QNIH-----CLVWSRLSITIAKIL 478
            LY+ QS   N E+  +N        L ++N+L S  +N H      +++SRL + I KIL
Sbjct: 422  LYIFQSLLINDEDI-LNVAN-----LNIENLLSSLAKNFHHYITNTILFSRLILLIPKIL 475

Query: 479  EKFVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCE 538
            EKF+  +ENIKLI  EF+ ++L I   + N+ +K+  L+    Y SF  L +VLG + C+
Sbjct: 476  EKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQ 535

Query: 539  KLERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASN-PESTNKSLKASELEFVLKLSTSD 597
            ++++  L II  I  + +DDT G ++EV++ +I  N P      +   E   +L +++ D
Sbjct: 536  EVQQITLKIILQILDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRD 595

Query: 598  PYSVQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLE 657
            P +VQ+ VE+Q+CL  LL+ + + +Y +Y E+C PS V VL       + Y+ L+SL+LE
Sbjct: 596  PSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALE 655

Query: 658  LLTVFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDIS 717
             +T+F+KK P+DG+LP  + +++F PL  +++ S +DE LQLS++AF++L+ N+    + 
Sbjct: 656  FITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMV 715

Query: 718  SHLQTAIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVN 777
              L   + +++RLL+ D +               T F ++I+  M ++L    +RL+Q  
Sbjct: 716  ESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAK 775

Query: 778  NIHTVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKI 837
            NI T++NLI V C+L   + + T++ LS L  + D    L+L++ KW+ +FEIIRGE++I
Sbjct: 776  NISTIQNLISVICYLICSNTEDTINLLSRLGTEGD---ILKLVLNKWISNFEIIRGERRI 832

Query: 838  KENIVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKL 897
            K+NI+AL+KL+ LN+S + +I+V+ +LIPYDGD IITRSMAK +PD+YT+I  Y KIIKL
Sbjct: 833  KQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKL 892

Query: 898  MVTELMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNAXXXXXXXXXXXVLEYEKLQEY 957
             + EL  Q  QP+ +  +    E +   N         A           VL+YEKLQEY
Sbjct: 893  FIQELSEQMKQPEHNLKIEETVETIGDGNA--------AAADDDWEDVEDVLDYEKLQEY 944

Query: 958  IEGSXXXXXXXX----XXXMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRC 1013
            ++                   +I+    ELL +  KE   K++S F  IYT L+E EKR 
Sbjct: 945  VDDEDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRI 1004

Query: 1014 LS 1015
            LS
Sbjct: 1005 LS 1006

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
           uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
           Karyopherin, responsible for nuclear import of Spt15p,
           histones H2A and H2B, and Nap1p; amino terminus shows
           similarity to those of other importins, particularly
           Cse1p; localization is primarily nuclear
          Length = 952

 Score =  383 bits (983), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 264/853 (30%), Positives = 437/853 (51%), Gaps = 26/853 (3%)

Query: 13  MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72
           M +  L+   QSP K++RE AE +LL  C++DP   F+ LI+ A++ +A  +++Q  L+ 
Sbjct: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60

Query: 73  IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132
           +RK  TMYW+AGF S+ GPPGV E  K++VR  LL L+  +    K++S  +YCIVQI A
Sbjct: 61  LRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120

Query: 133 VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192
           VDFPDEWP LLD + + I   +S NA+SLL E+  D+++ EMFF    G K V  V   L
Sbjct: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180

Query: 193 SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQ-IAQH---VNETLHIFLQLLGN 248
           ++ +     K   ++LYH C+ QL +     + E  S+ +  H   +N+ +   L+  GN
Sbjct: 181 NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240

Query: 249 HNLADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFK-TVALKDLDTLGKYYSQI 307
           +      +E++ LK   +  L+ L     + +   +   S++  + L  + +    Y++ 
Sbjct: 241 NM----ESEVIGLKGELFMALSKL-FDLNQSILGSNGDLSYRLRITLDAIKSNANSYARA 295

Query: 308 LASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTND 367
           L + DE  L+ ++ S IN + +L+ +    +E P + +  E  ++LC LP        +D
Sbjct: 296 LTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFK--LSD 353

Query: 368 LNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLY 427
            N F+SKETG+S  Y  RDE+ Q++S      YR+I  ++L++   V   + + QE+ L+
Sbjct: 354 FNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQEACLF 413

Query: 428 LLQSCQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLEN 487
           L Q    N  E  +N     + L     IL+       V SR  +TI K  E  +  L  
Sbjct: 414 LFQELCSN--ETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFENNMETLPE 471

Query: 488 IKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDI 547
           IK +V++F+ KT+    S+ +  + A  +IS+  Y+SF  LGS+L  +    L++ +L  
Sbjct: 472 IKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMILQQSLLKA 531

Query: 548 INDIYAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYSVQVVVEA 607
           I  +Y + ++D+ G LLE +  ++ +     +   K   L  +LKLS+S+P +V++V E+
Sbjct: 532 IKTLYVDSEEDSLGLLLEAMHEIVKTWHFQQDLHTKQEILNLLLKLSSSEPSNVRIVFES 591

Query: 608 QDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNP 667
              L  LL+ +   DY    E C PSF+  +         Y+PLV L+LE L+VFLK  P
Sbjct: 592 VRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLSVFLKNPP 651

Query: 668 SDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKK---DDISSHLQTAI 724
               +   V EYV  P+   I    D+ + + + +AF +L  NS      D    L + +
Sbjct: 652 VGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWKDSMFDLCSLV 711

Query: 725 MILERLLASDTSYX-XXXXXXXXXXXXXTKFADQIQDIMPKLLEAAARRLVQVNNIHTVE 783
              ER L                      +F  QI       +E    +LV  N +H V+
Sbjct: 712 FDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQI-------MEYTISKLVDPNKLHPVD 764

Query: 784 NLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVA 843
           + I++ C +   D++  + ++ S+ + ++  S    +I +  D FE  R +  +KE  ++
Sbjct: 765 SFIIISCEVILKDIQSFLAYIFSIPISAE-ESIPNKLIRELFDCFEENRSKNMLKEVALS 823

Query: 844 LSKLFFLNDSRVA 856
           LS+LFF ND R+ 
Sbjct: 824 LSELFFSNDQRLT 836

>Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {ON}
           YPL125W (KAP120) - karyopherin [contig 67] FULL
          Length = 1034

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 69  CLVSIRKLITMYWNAGFESYCGPPGVNEGAKE---VVRENLLKLVLGDSQNSKIVSASSY 125
           C +++R L  + +  G E +     VN   KE    +R  L  L+  D +N+++   +S 
Sbjct: 59  CPLNVRWLAIIQFKNGVEKFWRSTRVNAIRKEEKVSIRTRLFDLI--DEKNNQLCIQNSQ 116

Query: 126 CIVQIAAVDFPDEWPSLLDTVYDAITYD 153
              +IA +DFP EWP L D +   ++YD
Sbjct: 117 ATARIARLDFPGEWPGLFDQLEKLLSYD 144

>SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1032

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 69  CLVSIRKLITMYWNAGFESYCGPPGVNEGAKE---VVRENLLKLVLGDSQNSKIVSASSY 125
           C + IR L  + +  G E Y     VN  +K+    +R  L  ++  D QN+++   ++ 
Sbjct: 60  CSLQIRWLAIIQFKNGIERYWRSTRVNAISKDEKASIRSRLFDMI--DEQNNQLCIQNAQ 117

Query: 126 CIVQIAAVDFPDEWPSLLD 144
              +IA +DFP+EWP+L +
Sbjct: 118 ASARIARLDFPNEWPNLFE 136

>CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125w KAP120 nuclear transport factor
          Length = 1027

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 69/140 (49%), Gaps = 10/140 (7%)

Query: 9   LTTKMDLSELILHA--QSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASK 66
           + T+++L E++  A     +  +R+    + L    + PG  F+ L +I  D S  +  +
Sbjct: 5   MLTELNLVEVLQQASDMQHMGTERQRMAESQLKAWETQPGFHFL-LQSIYLDLSNGLHVR 63

Query: 67  QFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYC 126
              ++  +  +  YW A   +     G +E A   +R+ L  +V  D QN+++   ++  
Sbjct: 64  WLAVIQFKNGVEKYWRA---TRINSIGKDEKAS--IRKRLFDVV--DEQNNQLCIQNAQA 116

Query: 127 IVQIAAVDFPDEWPSLLDTV 146
             +I+ +DFP EWP+L +++
Sbjct: 117 TARISRIDFPVEWPNLFESI 136

>ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL125W
           (KAP120)
          Length = 1025

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 6/91 (6%)

Query: 69  CLVSIRKLITMYWNAGFESYCGPPGVN---EGAKEVVRENLLKLVLGDSQNSKIVSASSY 125
           C + IR L  + +  G + Y     VN   +  K+ +R  L ++V  D QN+++   +++
Sbjct: 57  CSLQIRWLAIIQFKNGLDKYWRATRVNAISKDEKQSIRARLFEMV--DEQNNQLCIQNAH 114

Query: 126 CIVQIAAVDFPDEWPSLLDTVYDAITYDYSA 156
              +IA  D+P +WP L +    A+  DY A
Sbjct: 115 ACARIARSDYPHDWPDLFEYFEKALG-DYDA 144

>NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 8/100 (8%)

Query: 45  PGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRE 104
           PG  +  L +I  D S  + S+    +  +  +  YW +          +N+  K  +R 
Sbjct: 44  PGYHYY-LQSIYLDLSNTLQSRWLAAIQFKNGVDRYWRSS-----RVHAINKDEKASIRA 97

Query: 105 NLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPSLLD 144
            L +L+  D QN+++    +  I +IA +DFP EWP L +
Sbjct: 98  RLFELI--DEQNNQLGIQYAQAIAKIARLDFPAEWPDLFE 135

>NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 58  DPSAEVASKQFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNS 117
           D S  + ++   ++  +  +  YW +    +C    +N+  K  +R  L  ++  D QN+
Sbjct: 56  DLSNSLQTRWLAVIQFKNGVDKYWRST-RVHC----INKDEKASIRTRLFDMI--DEQNN 108

Query: 118 KIVSASSYCIVQIAAVDFPDEWPSLLDTVYDAITYDY 154
           ++    +    +IA +DFP EWP+L +T+   +  D+
Sbjct: 109 QLGIQYAQATARIARLDFPVEWPNLFETLKSLLENDH 145

>Suva_4.521 Chr4 (902071..904143) [2073 bp, 690 aa] {ON} YBR259W
           (REAL)
          Length = 690

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 73/154 (47%), Gaps = 24/154 (15%)

Query: 329 FLSSLHEC---ELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSFVSKETGVSGV---Y 382
           F + L EC     EG ++ N ++ LV+L   P  +A    N ++SF  +ET +SG    +
Sbjct: 188 FQTKLIECLKKFYEGYDLQNSMDPLVKLIR-PWERAVFAANIIDSFTGEETRISGAELFW 246

Query: 383 TIRDEVFQFLSD--MIGTNYRNIFQ--------TLLEQAGSVMHLDWEKQESMLYLLQSC 432
           T RD VF  +S   +  ++ +NIF         TL++    V  L W K +++  L+++ 
Sbjct: 247 TFRDLVFSSISSFALRLSDLQNIFSTFKPYGKATLIQDFADVRSLKWRKDDTIERLVRAL 306

Query: 433 QGNT-------EEFEVNSQGLVELLLRLQNILES 459
             N        E+ E    G++ L L  +N  ES
Sbjct: 307 IFNDMFPYFTLEQVERFGDGIMFLRLLRKNFQES 340

>TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1031

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 71  VSIRKLITMYWNAGFESYCGPP---GVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCI 127
           + IR L  + +  G E Y        +N+  K  +R  L  L+  D QN+++   ++   
Sbjct: 61  LQIRWLAVIQFKNGVEKYWRSTRINAINKDEKISIRGRLFDLI--DEQNNQLSIQNAQAA 118

Query: 128 VQIAAVDFPDEWPSLLDTVYDAITYDY 154
            +IA +DFP EWP+L + +   ++ D+
Sbjct: 119 AKIARLDFPVEWPNLFEQLEQLLSNDH 145

>Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVN---EGAKEVVRENLLKLVLGDSQNSKIVSASSYCI 127
           + IR L  + +  G + Y     +N   +  K  +R  L +++  D QN+++   ++   
Sbjct: 59  LQIRWLAVIQFKNGVDKYWRSTRINAIPKDEKASIRGRLFEMI--DEQNNQLCIQNAQAA 116

Query: 128 VQIAAVDFPDEWPSLLDTVYDAITYDYSANALSLLHEI 165
            +IA +DFP +WP+L + + + +  D   N  + +H I
Sbjct: 117 ARIARLDFPVDWPNLFEDLENLLNNDTIRNDSTKVHNI 154

>KLTH0D10010g Chr4 complement(830376..833480) [3105 bp, 1034 aa]
           {ON} similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1034

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 69  CLVSIRKLITMYWNAGFESYCGPPGVN---EGAKEVVRENLLKLVLGDSQNSKIVSASSY 125
           C + +R L  + +  G E Y     +N   +  K  +R  L  L+  D  N+++   +S 
Sbjct: 60  CPLDVRWLAIIQFKNGVEKYWRSTRINAIGKDEKASIRARLFDLI--DENNNQLGIQNSQ 117

Query: 126 CIVQIAAVDFPDEWPSLLD 144
              +IA +DFP +WP+L +
Sbjct: 118 AAARIARLDFPGDWPTLFE 136

>KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8.624
           YPL125W
          Length = 1041

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVNEGAKE---VVRENLLKLVLGDSQNSKIVSASSYCI 127
           + +R L  + +  G + Y     V+  +KE   ++R  L +L+  D QN+++   ++   
Sbjct: 62  LQVRWLAVIQFKNGIDKYWRSTRVHAISKEEKSLIRSRLFELI--DEQNNQLTIQNAQAA 119

Query: 128 VQIAAVDFPDEWPSLLD 144
            +I+ +DFP EWP+L +
Sbjct: 120 SKISRLDFPGEWPNLFE 136

>Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {ON}
           YPL125W (REAL)
          Length = 1032

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVN---EGAKEVVRENLLKLVLGDSQNSKIVSASSYCI 127
           + IR L  + +  G + Y     VN   +  K  +R  L +++  D QN+++   ++   
Sbjct: 59  LQIRWLAVIQFKNGVDKYWRSSRVNAIPKDEKASIRGRLFEMI--DEQNNQLCIQNAQAA 116

Query: 128 VQIAAVDFPDEWPSLLD 144
            +IA +DFP EWP+L +
Sbjct: 117 ARIARLDFPVEWPNLFE 133

>Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVNEGAKE---VVRENLLKLVLGDSQNSKIVSASSYCI 127
           + IR L  + +  G + Y     +N  +K+    +R  L +++  D QN+++   ++   
Sbjct: 59  LQIRWLAVIQFKNGVDKYWRSTRINAISKDEKASIRGRLFEMI--DEQNNQLCIQNAQAA 116

Query: 128 VQIAAVDFPDEWPSLLD 144
            +IA +DFP EWP+L +
Sbjct: 117 ARIARLDFPVEWPNLFE 133

>KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa]
           {ON} similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1023

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVN---EGAKEVVRENLLKLVLGDSQNSKIVSASSYCI 127
           + +R L  + +  G + Y     +N   +  K+ +R  L  ++  D  N K+   ++   
Sbjct: 59  LQVRWLAIIQFKNGLDKYWRSTRINAITKDEKQQIRNRLFGMI--DEPNDKLAIQNAQAT 116

Query: 128 VQIAAVDFPDEWPSLLDTV 146
            ++A +DFP EWP L + V
Sbjct: 117 ARVARIDFPVEWPHLFEQV 135

>ZYRO0F06160g Chr6 complement(509916..513005) [3090 bp, 1029 aa]
           {ON} highly similar to uniprot|Q02932 Saccharomyces
           cerevisiae YPL125W KAP120 Karyopherin with a role in the
           assembly or export of 60S ribosomal subunits
          Length = 1029

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 65/147 (44%), Gaps = 23/147 (15%)

Query: 9   LTTKMDLSELIL-----------HAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIAS 57
           +T+ + L+EL L           HA S V+   E      LS   + PG  + +L +I  
Sbjct: 1   MTSSVTLNELTLVETLEQASNPQHAGSEVQRLAERQ----LSEWQTQPGFHY-TLQSIYL 55

Query: 58  DPSAEVASKQFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNS 117
           D S  +  +   ++  +  +  YW +          +++  K  +R  L  L+  D QN+
Sbjct: 56  DLSNSLQIRWLSVIQFKNGVDKYWRS-----TRLHAISKEEKSSIRARLFDLI--DEQNN 108

Query: 118 KIVSASSYCIVQIAAVDFPDEWPSLLD 144
           ++   ++    +IA  DFP EWP+L +
Sbjct: 109 QLCIQNAQATARIARYDFPVEWPNLFE 135

>YPL125W Chr16 (313388..316486) [3099 bp, 1032 aa] {ON}
           KAP120Karyopherin responsible for the nuclear import of
           ribosome maturation factor Rfp1p
          Length = 1032

 Score = 39.3 bits (90), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVN---EGAKEVVRENLLKLVLGDSQNSKIVSASSYCI 127
           + IR L  + +  G + Y     +N   +  K  +R  L +++  D QN+++   ++   
Sbjct: 59  LQIRWLAVIQFKNGVDKYWRSTRINAIPKDEKASIRGRLFEMI--DEQNNQLCIQNAQAS 116

Query: 128 VQIAAVDFPDEWPSLLD 144
            +IA +DFP EWP+L +
Sbjct: 117 ARIARLDFPVEWPTLFE 133

>KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1053

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVN---EGAKEVVRENLLKLVLGDSQNSKIVSASSYCI 127
           + +R L  + +  G E Y     VN   +  K  +R  L  L+  D QN+++   ++   
Sbjct: 62  LQVRWLAVIQFKNGIERYWRSTRVNAIRKDEKASIRARLFDLI--DEQNNQLCIQNAQAT 119

Query: 128 VQIAAVDFPDEWPS 141
            +IA +DFP EWP+
Sbjct: 120 SKIARLDFPAEWPN 133

>Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON}
           (33954..37046) [3093 nt, 1031 aa]
          Length = 1030

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%), Gaps = 8/100 (8%)

Query: 45  PGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRE 104
           PG  ++ L  I  D S  +  +   ++  +  I  +W +   +      + +  K  +R 
Sbjct: 41  PGYHYL-LQTIYLDLSNSLQIRWMAVIQFKNGIEKFWRSSRTN-----AIKKDEKASIRA 94

Query: 105 NLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPSLLD 144
            L +L+  D QN+++   +S    +IA +DFP +WP+L +
Sbjct: 95  RLFELI--DEQNNQLAIQNSQAAAKIARLDFPVDWPNLFE 132

>TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.624
           YPL125W
          Length = 1036

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVNEGAKE---VVRENLLKLVLGDSQNSKIVSASSYCI 127
           + +R L  + +  G E Y     +N  +K+    +R  L +++  D QN+++   ++   
Sbjct: 62  LQVRWLAVIQFKNGVERYWRSTRINAISKDEKASIRNRLFEVL--DEQNNQLCIQNAQAT 119

Query: 128 VQIAAVDFPDEWPSLLDTV 146
            +IA +DFP +W +L +T+
Sbjct: 120 ARIARLDFPSDWTNLFETI 138

>TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1031

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPP---GVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCI 127
           + IR +  + +  G E Y        +N+  K  +RE L  LV  + +N+++   ++   
Sbjct: 58  LQIRWISIIQFKNGIEKYWRSTRSNAINKNEKLKIRERLFNLV--NEKNNQLSIQNAQAT 115

Query: 128 VQIAAVDFPDEWPSLLDTV 146
            +IA  DFP  WP L + +
Sbjct: 116 AKIARFDFPGHWPDLFENL 134

>CAGL0H07821g Chr8 (761870..764755) [2886 bp, 961 aa] {ON} highly
           similar to uniprot|P33307 Saccharomyces cerevisiae
           YGL238w CSE1
          Length = 961

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 67/149 (44%), Gaps = 13/149 (8%)

Query: 22  AQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYW 81
           A+S V    + AE  L  L + D     ++L++I +  +  +A++    V  +  I   W
Sbjct: 12  AESVVASTSKIAEKNLKQLENED--GFGLTLLHIVASSNLPIATRLAGAVFFKNFIKRKW 69

Query: 82  -NAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWP 140
            +        P  V     E+++  ++ L++    N ++    S  +  IA  DFP+ WP
Sbjct: 70  IDENGVHLLSPSNV-----ELIKNEIVPLMIALPGNLQVQIGESISV--IADSDFPERWP 122

Query: 141 SLLDTVYDAITYD---YSANALSLLHEIF 166
           +LLD +   ++ D    +   L++ H IF
Sbjct: 123 TLLDDLVSKLSTDDMVTNKGVLTVAHSIF 151

>Kpol_460.18 s460 complement(33770..36640) [2871 bp, 956 aa] {ON}
           complement(33770..36640) [2871 nt, 957 aa]
          Length = 956

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 116/266 (43%), Gaps = 26/266 (9%)

Query: 22  AQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYW 81
           ++S V    +SAE +L  L + D     ++L+++ +  +  ++++    +  +  I   W
Sbjct: 12  SESVVASTAKSAERSLRELENQD--GFGLTLLHVVASTNLPISTRLAGALFFKNFIRRKW 69

Query: 82  NAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPS 141
                +Y  P        +++++ ++ L++    N ++    +  I  IA  DFP+ WP+
Sbjct: 70  VDEDGNYLIP----LNNVDLIKKEIVPLMITLPNNLQVQIGEAISI--IADSDFPNNWPT 123

Query: 142 LLDTVYDAITYD---YSANALSLLHEIFDD----VVSEEMFFQGGIGWKTVQIVFSLLSN 194
           LL+ +   ++ D    +   L++ H IF        S+E+F +  +   T  I F  L  
Sbjct: 124 LLNDLTSRLSADDMVTNKGVLTVAHSIFKRWRPLFRSDELFLEIKLVLDTFAIPFLNLLK 183

Query: 195 TSSSFGIKD-----AAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNH 249
           T     IK+     AA+ L    LL L     L  D N   I +   + +++ + +L  H
Sbjct: 184 TVDE-KIKENRNNAAALSLLFDVLLVL---TKLYYDLNCQDIPEFFEDNINVGMGIL--H 237

Query: 250 NLADPSNELLDLKAHTYENLTLLKTQ 275
              + +N L+D    T E   L K +
Sbjct: 238 GYLEYTNPLVDDPDETDEASILAKVK 263

>NDAI0A00370 Chr1 (62290..64200) [1911 bp, 636 aa] {ON} Anc_1.37
          Length = 636

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 7/93 (7%)

Query: 225 DEN----RSQIAQHVNETLHIFLQLLGNH--NLADPSNELLDLKAHTYENLTLLKTQFPK 278
           DEN    R+Q  + +++T+ I+L+ +G +  N+A  SNE+L +K   YE    LK   P 
Sbjct: 172 DENENGHRNQYNKLLHDTIEIYLKRIGRNFENIAKESNEILHIKIEKYEKEWELKNGGPL 231

Query: 279 KLFPDDLKGSFKTVALKDLDTLGKYYSQILASV 311
              P  ++      ALK   TL +Y  ++L  +
Sbjct: 232 SDIPKQIEIEV-IKALKQKKTLEEYDEELLKKI 263

>Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]
           {ON} YGL238W (CSE1) - (putative) kinetochore protein
           [contig 344] FULL
          Length = 959

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 11/148 (7%)

Query: 22  AQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYW 81
           +QS      ++AE  L SL  + PG   V+L+++ +  +  VA++    +  +  I   W
Sbjct: 12  SQSIEASNSKNAEAHLKSL-ETQPGFA-VTLMHVIASSNLPVATRLAGALFFKNFIKRKW 69

Query: 82  NAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPS 141
                 Y     + E     V+  ++ L++    N ++    +  +  IA  DFP  WP 
Sbjct: 70  INENGVYM----IAESDVAAVKREIVPLMIALPSNLQVQIGEAISV--IADSDFPHRWPD 123

Query: 142 LLDTVYDAITYD---YSANALSLLHEIF 166
           LLD +   ++ D    +   L++ H IF
Sbjct: 124 LLDILIGKLSTDDLVTNRGVLTVAHSIF 151

>NCAS0B08930 Chr2 complement(1715878..1717368) [1491 bp, 496 aa]
           {ON} Anc_1.33
          Length = 496

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 15/118 (12%)

Query: 264 HTYENLTLLKTQFPKKLFPDDLKGS---FKTVALKDLDTLGKYYSQILASVDEA------ 314
           HTY N+  +K + P +L  DD   S   F  +A + L  + K++ +IL   D A      
Sbjct: 99  HTY-NMEQMKAKIPDELLDDDTATSEQLFGFLARRTLAFMKKFHPEILEQGDAAKPVKLG 157

Query: 315 --LLQSVDESAIN---IIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTND 367
                 VD++++N   +I +       +  G +V  L ++ ++   LPM     LTND
Sbjct: 158 FTFSYPVDQTSLNSGTLIRWTKGFKIPDTVGKDVVELYQTALKKAGLPMVNVVALTND 215

>AFR273W Chr6 (923039..925948) [2910 bp, 969 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL238W (CSE1)
          Length = 969

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 76/174 (43%), Gaps = 17/174 (9%)

Query: 1   MKDTTSRWLTTKMDLSEL--ILH--AQSPVKDQRESAETALLSLCSSDPGSVFVSLINIA 56
           M  ++ + L    D+S+L  + H   QS +     SAE  L  L S +     ++L+++ 
Sbjct: 1   MVSSSPQRLAFARDMSDLTTVAHYLGQSVIASTARSAEQQLRGLESQE--GFALTLLHVV 58

Query: 57  SDPSAEVASKQFCLVSIRKLITMYW-NAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQ 115
           +  +   +++    +  +  I   W +   E       V    KE+V    L + LG   
Sbjct: 59  ASNNLAASTRLAGALFFKNFIRRRWVDENGEHLLSARDVELVKKEIVP---LMIQLGSHL 115

Query: 116 NSKIVSASSYCIVQIAAVDFPDEWPSLLDTVYDAITYD---YSANALSLLHEIF 166
             +I  +    I  IA  DFP+ WP+LLD + D ++ +    +   L++ H IF
Sbjct: 116 QVQIGES----IAVIADSDFPERWPTLLDDLVDKLSAEDMVTNKGVLTVAHSIF 165

>KLLA0F20119g Chr6 (1874062..1877319) [3258 bp, 1085 aa] {ON}
           similar to uniprot|Q06156 Saccharomyces cerevisiae
           YLR272C YCS4 Protein required for accurate sister
           chromatid segregation
          Length = 1085

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 364 LTNDLNSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYR-----NIFQTLLEQAGSVMHLD 418
           LT  L+SF S +    G           ++D++  N        IF+TL +   S +HL+
Sbjct: 6   LTEYLSSFQSTDKSSYGALEAPGSTLNQVTDVLALNSEYEIADEIFETLTDLTHSYLHLN 65

Query: 419 WEKQESMLYLLQSCQGN-----TEEFEVNSQGLVELLLRLQNI 456
           +  ++ ++YL+ SC  N        F+V+ + L+   + LQ +
Sbjct: 66  YNVKQQLVYLVSSCLSNLSALIQSNFQVDEEVLLSWKINLQKL 108

>Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {ON}
           similar to Ashbya gossypii AFR273W
          Length = 955

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 70/148 (47%), Gaps = 11/148 (7%)

Query: 22  AQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYW 81
           AQS V     S+E +L +L + D  ++   L++I +  +   +++    +  +  I   W
Sbjct: 12  AQSVVAATARSSEHSLKALENQDGFALM--LLHIVASTNLPASTRLAGALFFKNFIKRKW 69

Query: 82  NAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPS 141
                +  G   ++E   E+V++ +L L++    N +     S  I  IA  DFPD+W +
Sbjct: 70  ----VNENGDHILSENDVELVKKEILPLMIKLPGNLQAQVGESISI--IADSDFPDKWTN 123

Query: 142 LLDTVYDAITYD---YSANALSLLHEIF 166
           LL+   + ++ D    +   L++ H IF
Sbjct: 124 LLEEFVNQLSLDDMVTNKGVLTVAHSIF 151

>TDEL0D06290 Chr4 complement(1129171..1132044) [2874 bp, 957 aa]
           {ON} Anc_3.561 YGL238W
          Length = 957

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 85/206 (41%), Gaps = 28/206 (13%)

Query: 3   DTTSRWLTTKMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAE 62
           DTT+R L            A+S V    ++AE +L SL   D     ++L+++ +  +  
Sbjct: 5   DTTARLL------------AESVVASTSKNAEKSLKSLEDQD--GFGLTLLHVVASSNLP 50

Query: 63  VASKQFCLVSIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSA 122
             ++    +  +  I   W     ++   PG      E+++  ++ L++    N +I   
Sbjct: 51  TPTRLAGALFFKNFIKRKWIDEDGNHLLTPG----NVELIKNEIVPLMITLPNNLQIQIG 106

Query: 123 SSYCIVQIAAVDFPDEWPSLLDTVYDAITYD---YSANALSLLHEIFDD----VVSEEMF 175
            +  +  IA  DFP  WPSLL  +   ++ D    +   L++ H IF        S+E+F
Sbjct: 107 EAISV--IADSDFPHAWPSLLQDLASRLSTDDMVTNKGVLTVAHSIFKRWRPLFRSDELF 164

Query: 176 FQGGIGWKTVQIVF-SLLSNTSSSFG 200
            +         + F +LL N     G
Sbjct: 165 LEIKAVLDAFAVPFLNLLKNVDEQIG 190

>KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {ON}
           similar to uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
           mediated Activation Ty1 enhancer activator and to
           YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
           CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
           binuclear cluster domain; DNA-binding transcriptional
           activator or CHA1
          Length = 727

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 436 TEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSI----TIAKI--LEKFVCKLENIK 489
           TE+F   SQ ++++   L+N++    I  +  S++ I    T  +I  L+KF  K+ N +
Sbjct: 459 TEDFRYESQTVLQVSQPLKNLMILSRIIQIFTSKIFIEPNTTSRRIEYLKKFNLKVSNWR 518

Query: 490 LIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIIN 549
             + EF+  + ++  S   ST    S   Y  Y   +       +EDCE+ +  +L+I+ 
Sbjct: 519 QSLPEFLKWSKSLVQSVDMSTDPTISYFWYHYYIVLITFNKPF-MEDCEESKTVILEILG 577

Query: 550 DI 551
           D+
Sbjct: 578 DL 579

>Smik_7.22 Chr7 (44367..47249) [2883 bp, 960 aa] {ON} YGL238W (REAL)
          Length = 960

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query: 100 EVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPSLLDTVYDAITYD---YSA 156
           E++++ ++ L++    N ++    +  I  IA  DFPD WP+LL+ +   ++ D    + 
Sbjct: 84  ELIKKEIVPLMISLPNNLQVQIGEA--ISGIAESDFPDRWPTLLNDLASRLSNDDMVTNK 141

Query: 157 NALSLLHEIF 166
             L++ H IF
Sbjct: 142 GVLTVAHSIF 151

>SAKL0F00968g Chr6 (84333..87218) [2886 bp, 961 aa] {ON} highly
           similar to uniprot|P33307 Saccharomyces cerevisiae
           YGL238W CSE1 Nuclear envelope protein that mediates the
           nuclear export of importin alpha (Srp1p) homolog of
           metazoan CAS protein required for accurate chromosome
           segregation
          Length = 961

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 71/150 (47%), Gaps = 11/150 (7%)

Query: 20  LHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLITM 79
           L AQS V    + AE  L SL + +  S  ++L++I +  +  ++++    +  +  I  
Sbjct: 10  LLAQSVVASTAKVAEQNLKSLENQE--SFPLTLLHIVASTNLPISTRLAGALFFKNFIKR 67

Query: 80  YWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEW 139
            W        G   ++    E++++ ++ L++    N ++    +  +  IA  DFP +W
Sbjct: 68  KW----VDENGNHMISSNDVELLKKEIIPLMISLPNNLQLQIGEAISV--IADSDFPHKW 121

Query: 140 PSLLDTVYDAITYD---YSANALSLLHEIF 166
           P+LLD +   ++ +    +   L++ H IF
Sbjct: 122 PTLLDDLISKLSAEDMVTNKGVLTVAHSIF 151

>KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {ON} 
          Length = 421

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 91  PPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYC 126
           P   N G  +VVR NLL+  L  S   +I +  SYC
Sbjct: 381 PSAYNRGPSDVVRNNLLQFQLNVSTQQRIPNTVSYC 416

>Suva_7.22 Chr7 (44148..47030) [2883 bp, 960 aa] {ON} YGL238W (REAL)
          Length = 960

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query: 100 EVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPSLLDTVYDAITYD---YSA 156
           E++++ ++ L++    N ++    +  I  IA  DFPD WP+LL+ +   ++ D    + 
Sbjct: 84  ELIKKEIVPLMITLPNNLQVQIGEA--ISSIADSDFPDRWPTLLNDLASRLSNDDMVTNK 141

Query: 157 NALSLLHEIF 166
             L++ H IF
Sbjct: 142 GVLTVAHSIF 151

>Skud_7.28 Chr7 (53753..56635) [2883 bp, 960 aa] {ON} YGL238W (REAL)
          Length = 960

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query: 100 EVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPSLLDTVYDAITYD---YSA 156
           E++++ ++ L++    N ++    +  I  IA  DFPD WP+LL+ +   ++ D    + 
Sbjct: 84  ELIKKEIVPLMITLPNNLQVQIGEA--ISSIADSDFPDRWPTLLNDLASRLSNDDMVTNK 141

Query: 157 NALSLLHEIF 166
             L++ H IF
Sbjct: 142 GVLTVAHSIF 151

>Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON}
           similar to Ashbya gossypii ACR159C
          Length = 1027

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 71  VSIRKLITMYWNAGFESYCGPPGVN---EGAKEVVRENLLKLVLGDSQNSKIVSASSYCI 127
           + +R L  + +    + +  P  +N   +  K  +R+ L  +V  + +N+++   +++  
Sbjct: 59  LQVRWLAIIQFKNSTDKFWRPTRMNCISKDEKSSIRDRLFHMV--NEENNQLAIQNAHAT 116

Query: 128 VQIAAVDFPDEWPSLLD 144
            +IA +D+P  WP++ +
Sbjct: 117 AKIARLDYPQNWPNMFE 133

>KLTH0A00726g Chr1 complement(72979..77517) [4539 bp, 1512 aa] {ON}
           highly similar to uniprot|O93808 Saccharomyces
           cerevisiae YPR184W GDB1 Glycogen debranching enzyme
           containing glucanotranferase and alpha-1 6-
           amyloglucosidase activities required for glycogen
           degradation
          Length = 1512

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 6/53 (11%)

Query: 124 SYCIVQIAAVDFPDE-WPSLLDTVYDAITYDYSAN-----ALSLLHEIFDDVV 170
           S+C   I +V   DE +P LLD V +A TYD +AN     A + LH+I D++ 
Sbjct: 681 SFCSSAIGSVYGYDECFPYLLDVVGEARTYDVTANDGISVARAQLHKIRDEIA 733

>KLTH0B09768g Chr2 (805761..809039) [3279 bp, 1092 aa] {ON} similar
           to uniprot|P32337 Saccharomyces cerevisiae YMR308C PSE1
           Karyopherin/importin that interacts with the nuclear
           pore complex acts as the nuclear import receptor for
           specific proteins including Pdr1p Yap1p Ste12p and Aft1p
          Length = 1092

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 94  VNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPSLLDTVYDAI 150
           ++E A   +RE LLK  + + Q   I    S  I + A  D P EWP+LL  +++AI
Sbjct: 94  ISESALNQIRETLLKGFVTERQGG-IRHKLSDAIAECAQEDLP-EWPALLQGLFEAI 148

>YGL238W Chr7 (49552..52434) [2883 bp, 960 aa] {ON}  CSE1Nuclear
           envelope protein that mediates the nuclear export of
           importin alpha (Srp1p), homolog of metazoan CAS protein,
           required for accurate chromosome segregation
          Length = 960

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 100 EVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPSLLDTVYDAITYD---YSA 156
           E++++ ++ L++    N ++       I  IA  DFPD WP+LL  +   ++ D    + 
Sbjct: 84  ELIKKEIVPLMISLPNNLQVQIGE--AISSIADSDFPDRWPTLLSDLASRLSNDDMVTNK 141

Query: 157 NALSLLHEIF 166
             L++ H IF
Sbjct: 142 GVLTVAHSIF 151

>NCAS0E00290 Chr5 (43508..46384) [2877 bp, 958 aa] {ON} Anc_3.561
           YGL238W
          Length = 958

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 69/148 (46%), Gaps = 11/148 (7%)

Query: 22  AQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYW 81
           +QS V +  + AE +L S+ + +     ++L+++ S  +  ++++    +  +  I   W
Sbjct: 12  SQSVVANTSKFAERSLKSIENQE--GFGLTLLHVVSSTNLPISTRLAGALFFKNFIKRKW 69

Query: 82  NAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPS 141
                ++  PP        ++++ ++ L++    N ++    +  +  IA  DFP  WP+
Sbjct: 70  IDENGNHLLPPN----DVMLIKKEIVPLMISLPGNLQVQIGEAISV--IADSDFPQNWPT 123

Query: 142 LLDTVYDAITYD---YSANALSLLHEIF 166
           LL  +   +T D    +   L++ H IF
Sbjct: 124 LLQDLATRLTNDDMITNKGVLTVAHSIF 151

>NCAS0A03530 Chr1 complement(698730..701312) [2583 bp, 860 aa] {ON}
           Anc_4.180 YLR347C
          Length = 860

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 126/289 (43%), Gaps = 39/289 (13%)

Query: 343 VNNLLESLVQLCSLPMHQ-----ADDLTNDLNSFVSKETGVSGVYTIRDEVFQFLSDMIG 397
           V NL+E+L  L   P++       D L    N   ++ +  +  ++    + ++ +D + 
Sbjct: 476 VINLVENLAPLEPSPIYNFYPSLVDGLIKAANRSDNEYSARASAFSALTTLVEWANDAVS 535

Query: 398 TNYRNIFQTLLEQAGSVMHLDWEKQESM--LYLLQSCQGN------------TEEFEVNS 443
               +I   ++++ G  M ++ E Q SM  L  LQ  Q N            +E  +  +
Sbjct: 536 ETLASISSFVMDKLGQTMQVN-ETQLSMEDLQNLQELQSNILTVLAAAIRKNSENIDSVA 594

Query: 444 QGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENIKLIVKEFIFKTLTIA 503
             L++L +RL +  +S  I   V+  +S   A + +KF   LE    +   ++ K LT  
Sbjct: 595 DMLMDLFMRLLDKKDSSYIEDDVYYAISALSASMGKKFEKYLE----LFSPYLVKALTQT 650

Query: 504 SSSPNSTMKAGSLIS---------YKCYSSFV--ALGSVLGVEDCEK-LERQVLDIINDI 551
            S+ + T  A   I+         +K Y++     LG ++   +  K L+  +L +  DI
Sbjct: 651 ESTISVT--AVGFIADLSNSLEDDFKKYTTVFMSVLGQMMTNPNARKELKPALLSVFGDI 708

Query: 552 YAEVDDDTPGFLLEVLSGVIAS-NPESTNKSLKASELEFVLKLSTSDPY 599
            A +  D   +L EV+   +AS N +  N +++A + +  +  S  D Y
Sbjct: 709 AANIGPDFIMYLDEVMGLCLASQNMKPENGTIEALDYQATVLESVLDAY 757

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 69/167 (41%), Gaps = 35/167 (20%)

Query: 668 SDGFL----PQSVVEYVF------EPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDIS 717
           SD FL    PQ  +E VF      +P T +I S        L+ + +  LL  S+ D+IS
Sbjct: 528 SDSFLNSEFPQQYMESVFSDLPDADPYTVMIHS--------LTFKRYQLLLMMSELDEIS 579

Query: 718 SH-------------LQTAIMILERLLASDTSYXXXXXXXXXXXXXXTKFADQIQDIMP- 763
            H             L+     LER + SD +                +  D+I DIM  
Sbjct: 580 IHSRYRLPLGRIESQLENVRNFLEREVPSDLTDFENESEFLKLSSLSGR--DEIADIMKI 637

Query: 764 -KLLEAAARRLVQVNNIHTVENLILVFCHLTSVDVKQTVDFLSSLIL 809
            K++   A  + +++ + TV NL+L F  LTS   K+ + +     L
Sbjct: 638 KKVVFMQAYMITRLSVVRTVINLMLYFERLTSESGKEYMPYFQKYFL 684

>KLTH0G00858g Chr7 (59340..62219) [2880 bp, 959 aa] {ON} similar to
           uniprot|P33307 Saccharomyces cerevisiae YGL238W CSE1
           Nuclear envelope protein that mediates the nuclear
           export of importin alpha (Srp1p) homolog of metazoan CAS
           protein required for accurate chromosome segregation
          Length = 959

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 63/139 (45%), Gaps = 11/139 (7%)

Query: 31  ESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYWNAGFESYCG 90
           +SAE A L    + PG V ++L+++ +  +   A++    +  +  +   W     +Y  
Sbjct: 21  KSAE-ANLKAVENQPGFV-LTLMHVVASRNLPAATRLAGSLFFKNFVKRKWIDENGAYLI 78

Query: 91  PPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPSLLDTVYDAI 150
           P    E     V+  ++ L++    N ++    +  +  IA  DFP  WP LLD +   +
Sbjct: 79  P----EDDVVAVKREIVPLMIALPGNLQVQIGEAISV--IADSDFPHRWPDLLDELIARL 132

Query: 151 -TYDYSAN--ALSLLHEIF 166
            T D+  N   L++ H IF
Sbjct: 133 STDDFVTNRGVLTVAHSIF 151

>NDAI0I03210 Chr9 complement(754542..757418) [2877 bp, 958 aa] {ON}
           Anc_3.561 YGL238W
          Length = 958

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/148 (18%), Positives = 69/148 (46%), Gaps = 11/148 (7%)

Query: 22  AQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSIRKLITMYW 81
           +QS +    +SAE +L SL   +     ++L+++ +  +  ++++    +  +  +   W
Sbjct: 12  SQSVIAGTAKSAERSLRSL--ENQNGFGLTLLHVVASTNIPISTRLAGALFFKNFVKRKW 69

Query: 82  NAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAVDFPDEWPS 141
                   G   ++    E++++ ++ L++    N ++    +  +  IA  DFP+ WP+
Sbjct: 70  ----IDENGNHIISSNDVELIKKEIVPLMITLPGNLQVQIGEAVSV--IADSDFPNNWPT 123

Query: 142 LLDTVYDAITYD---YSANALSLLHEIF 166
           LL  +   ++ D    +   L++ H IF
Sbjct: 124 LLSDMASRLSTDDMVTNKGVLTVAHSIF 151

>NDAI0I01430 Chr9 (341557..343590) [2034 bp, 677 aa] {ON} Anc_6.145
           YGL110C
          Length = 677

 Score = 32.0 bits (71), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 46/93 (49%), Gaps = 8/93 (8%)

Query: 774 VQVNNIHTVENL---ILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEI 830
            Q+N IH ++     I+   + T VD+K     LS   L  +  S  Q + P W+++ E+
Sbjct: 158 AQLNRIHQLQQQLKHIIESGNFTRVDLKAFQALLSKKSLKPNKFSE-QFLTPSWVETIEL 216

Query: 831 IRGEKKIKENIVA----LSKLFFLNDSRVANIL 859
           +  + K + N++A    ++ L  +    +AN++
Sbjct: 217 LWAKGKGRANVIARQLLITTLLSVPAKSIANVM 249

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,464,157
Number of extensions: 4244156
Number of successful extensions: 14322
Number of sequences better than 10.0: 93
Number of HSP's gapped: 14562
Number of HSP's successfully gapped: 97
Length of query: 1019
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 899
Effective length of database: 39,721,479
Effective search space: 35709609621
Effective search space used: 35709609621
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)