Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_2480na 1ON58658626640.0
ACL135Wna 1ON58854320070.0
SAKL0G14916gna 1ON58153719130.0
KLTH0B01166gna 1ON57753718210.0
Kwal_33.15545na 1ON57654218150.0
KLLA0E16281gna 1ON60554117870.0
Skud_16.12na 1ON60753717790.0
YPL265W (DIP5)na 1ON60853717770.0
TPHA0M00130singletonON61153817770.0
Smik_6.473na 1ON60653717760.0
Kpol_358.3na 1ON57553717720.0
Suva_16.40na 1ON60653717580.0
NCAS0D02260na 1ON59754017350.0
NDAI0I02660na 1ON59454017260.0
CAGL0A01199gna 1ON61354416920.0
KAFR0B06430singletonON59353816850.0
TBLA0A07060na 1ON62552916680.0
KNAG0L02460singletonON58853816130.0
KNAG0L02470singletonON63851715530.0
ZYRO0D17908gna 1ON5185048541e-107
Ecym_80357.44ON5635378521e-106
Smik_5.241.83ON5905138481e-105
TDEL0A08030singletonON5144918361e-104
Ecym_10871.83ON5705138381e-104
NDAI0A006101.83ON5655068361e-104
YEL063C (CAN1)1.83ON5905138361e-103
TDEL0H040707.44ON5775428321e-103
Skud_5.261.83ON5905138331e-103
YOR348C (PUT4)7.44ON6275268341e-103
Suva_5.41.83ON5905138311e-103
KLLA0C02343g1.83ON5815138291e-103
SAKL0C02684gsingletonON5884968281e-102
Kwal_26.69407.44ON5705428261e-102
TPHA0H028507.44ON6015448221e-101
Smik_15.5327.44ON6315268241e-101
CAGL0J08184g1.83ON5725268171e-101
NCAS0A006001.83ON5445358111e-100
Suva_8.4027.44ON6835258201e-100
SAKL0F09790gsingletonON5585308091e-100
SAKL0B10956g7.44ON5725298081e-100
NCAS0E022607.44ON5935348082e-99
TDEL0C061801.83ON5835338063e-99
TBLA0A054501.83ON6064788022e-98
Skud_15.5157.44ON6265268042e-98
CAGL0E05632g7.44ON5985158012e-98
Ecym_10881.84ON5675137983e-98
AFR156W7.44ON5585257922e-97
KNAG0C05920singletonON5995237952e-97
SAKL0C02662g1.83ON5485327893e-97
KNAG0C007901.83ON5795067905e-97
Kpol_2000.641.84ON6105347926e-97
CAGL0J08162g1.84ON5975197872e-96
Kpol_367.77.44ON5845287853e-96
KNAG0E003907.44ON5995377856e-96
Smik_14.671.83ON5735227819e-96
KLTH0F02398g1.83ON5555037772e-95
TPHA0B044801.83ON6034687812e-95
ZYRO0F16654g1.83ON5805127784e-95
SAKL0C02640gsingletonON5485127745e-95
YNL270C (ALP1)1.83ON5735277758e-95
Skud_14.701.83ON5735127741e-94
KLTH0D01474g7.44ON6245367771e-94
TDEL0C061701.84ON5734997722e-94
Skud_14.711.84ON6125157735e-94
NDAI0E038007.44ON6215167728e-94
NCAS0B085701.83ON5325267658e-94
Suva_14.751.84ON6115147701e-93
Kwal_23.4026singletonON5344937632e-93
KLLA0F23419g7.44ON5735467662e-93
TBLA0A054601.84ON6085137682e-93
Kwal_33.134011.83ON5595037633e-93
KAFR0D007001.83ON5745177634e-93
YNL268W (LYP1)1.84ON6115157665e-93
NDAI0F041901.84ON5995177647e-93
AFR668W1.83ON5564847608e-93
Kpol_2000.651.83ON5954857611e-92
Smik_14.681.84ON6115077622e-92
NCAS0A006101.84ON6075117577e-92
KAFR0D039401.83ON5975177551e-91
TPHA0B044701.84ON5995327542e-91
NDAI0F042001.83ON5665347461e-90
SAKL0C02728g1.84ON5624887425e-90
SAKL0F16544gsingletonON5675137418e-90
Suva_14.731.83ON4974857341e-89
KNAG0F004801.84ON5975067411e-89
ZYRO0F16632g1.84ON6075237378e-89
AFR667C1.84ON5635377278e-88
Smik_6.482na 2ON5584877268e-88
Suva_13.517singletonON5474877241e-87
TBLA0C01240singletonON6295337302e-87
Kwal_33.134111.84ON5605247232e-87
KLTH0F02420g1.84ON6215247222e-86
TDEL0E05750singletonON5484877153e-86
KLLA0C02365g1.84ON5795137165e-86
KAFR0C051607.44ON5845577112e-85
ZYRO0C18502g7.44ON5755117103e-85
KLLA0B14685gna 3ON5715277094e-85
KLTH0A00308gsingletonON5414877022e-84
KLTH0F04048gsingletonON5835157034e-84
KLTH0B00154gna 4ON5565036911e-82
Ecym_47895.158ON5885096886e-82
Kwal_8.590na 4ON6294886864e-81
TDEL0D00200singletonON5675266613e-78
SAKL0G14014g5.158ON6055316627e-78
Skud_16.2na 2ON4964556521e-77
SAKL0C01232gsingletonON6135336559e-77
YCL025C (AGP1)1.50ON6335396542e-76
CAGL0K05753g1.50ON6605346518e-76
Kwal_23.2817na 3ON5805296451e-75
Smik_3.531.50ON6335356367e-74
SAKL0D00836gna 5ON6015176339e-74
NDAI0D021605.158ON5875206293e-73
KAFR0D04120na 6ON6485426315e-73
Skud_3.381.50ON6335346281e-72
KAFR0E018505.158ON5605226222e-72
KLLA0A11770g5.158ON5815216232e-72
Kpol_1010.325.158ON5995276242e-72
KAFR0D041401.50ON6375456244e-72
Smik_4.7901.50ON6635416264e-72
Suva_3.1891.50ON6335346235e-72
YDR508C (GNP1)1.50ON6635426255e-72
KAFR0C004003.284ON5825176171e-71
KNAG0G009005.158ON6135196191e-71
Kpol_2000.921.50ON6375406202e-71
AGR319W5.158ON6265456173e-71
NDAI0F043901.50ON6675406194e-71
Smik_16.1155.158ON6035296138e-71
KAFR0D005001.50ON6175356131e-70
Suva_2.6881.50ON6615356142e-70
Skud_7.5255.158ON6035306102e-70
KAFR0D00510na 7ON6175366103e-70
TPHA0A002405.158ON6035186093e-70
SAKL0C01650g1.50ON6135336085e-70
TBLA0B077605.158ON6585396106e-70
Skud_4.7841.50ON6635396091e-69
TPHA0A047005.158ON5694976021e-69
Kpol_543.78singletonON6055066041e-69
YGR191W (HIP1)5.158ON6035026032e-69
ZYRO0D03762g1.244ON6005166023e-69
Suva_11.2731.244ON6015026023e-69
NDAI0B052201.244ON6115306024e-69
KLLA0C01606g1.50ON6205426016e-69
CAGL0B03773g5.158ON6054776007e-69
KNAG0F002701.50ON6345346019e-69
NDAI0C029505.158ON6095095999e-69
SAKL0D04664g1.244ON5935025981e-68
KAFR0D04130na 7ON6445156002e-68
KNAG0C02140singletonON5985175962e-68
Kpol_543.791.244ON6055075962e-68
Ecym_60211.244ON6005025962e-68
Skud_11.2751.244ON6025025953e-68
TBLA0A05190na 6ON6675395993e-68
YBR068C (BAP2)3.284ON6095315954e-68
TBLA0A051801.50ON6765385985e-68
NCAS0A071105.158ON5925115901e-67
NDAI0A006401.50ON6415365922e-67
AFR698C1.50ON6095205902e-67
Ecym_26643.285ON5755445872e-67
TPHA0E036601.50ON6475345904e-67
CAGL0B01012g1.50ON6235315884e-67
TPHA0B010901.244ON6065175867e-67
KNAG0C005901.50ON6345405878e-67
Suva_7.4855.158ON6035235858e-67
TDEL0C00930singletonON5955025831e-66
Kwal_26.9612singletonON5435105773e-66
NCAS0I015303.284ON5955395804e-66
NCAS0D018705.158ON5955025804e-66
KLTH0B02046g5.158ON5895285804e-66
SAKL0D02970g3.284ON6015295804e-66
KAFR0D00520na 6ON5985365804e-66
AGR040C3.285ON5735335785e-66
NDAI0G060301.368ON5995375795e-66
Kwal_33.14276na 5ON5965225795e-66
KAFR0A011203.284ON5925305796e-66
KLTH0F01606gna 6ON6045335797e-66
Kwal_33.132041.50ON6075415781e-65
Suva_4.3073.284ON6095335762e-65
YKR039W (GAP1)1.244ON6025025762e-65
Kwal_27.126811.244ON5935135752e-65
AFR230C1.244ON6045175762e-65
KLLA0F27093gsingletonON5635015732e-65
NCAS0A004201.50ON6795485802e-65
ZYRO0A00308gsingletonON5645015698e-65
Smik_2.2013.284ON6095285719e-65
KNAG0H011503.284ON6175195711e-64
NCAS0J00140na 8ON5585195662e-64
Skud_2.1913.284ON6095315692e-64
AGR039Cna 9ON5865325672e-64
TDEL0C065101.50ON6425445702e-64
NCAS0B085801.50ON6275385692e-64
Kpol_526.103.397ON5805115663e-64
KLTH0F01584g1.50ON5965315664e-64
SAKL0D02926g3.285ON5835065654e-64
AAR038W3.397ON5665185644e-64
YBR132C (AGP2)3.397ON5965085656e-64
KNAG0L00110na 8ON5715305636e-64
Kwal_33.154075.158ON5875335647e-64
NCAS0B079001.244ON6195135658e-64
TDEL0E05700singletonON5845385639e-64
AEL030W1.368ON5825485621e-63
Skud_2.2603.397ON5985065612e-63
Smik_11.3021.244ON5534795582e-63
KLTH0E15642g1.244ON5965315594e-63
TDEL0F02830na 10ON5615135565e-63
KLLA0A06886gsingletonON5875045576e-63
YFL055W (AGP3)na 8ON5585225557e-63
Suva_4.3813.397ON5905225568e-63
Skud_6.2na 8ON5585225531e-62
Smik_2.2723.397ON5975085552e-62
Kwal_33.13215na 6ON5985335542e-62
KAFR0F02250singletonON5545215512e-62
TPHA0B047501.50ON6395365563e-62
CAGL0H08393g3.284ON6125195543e-62
TDEL0F046608.342ON8405915643e-62
NDAI0A056203.284ON5715385514e-62
TPHA0M012003.284ON6075355524e-62
KLLA0A10813g1.368ON5845325515e-62
ZYRO0F17446g1.50ON6335215537e-62
Kpol_1052.163.284ON6135405518e-62
KNAG0J022003.284ON6075285491e-61
NDAI0A074903.284ON5965255481e-61
TBLA0I020103.285ON6284995501e-61
Suva_2.716singletonON6035025482e-61
YLL061W (MMP1)na 11ON5835225472e-61
Smik_13.1singletonON5235055432e-61
ZYRO0F13838g8.342ON8365945582e-61
Kwal_27.105383.284ON6025195463e-61
TDEL0C053403.397ON5755145436e-61
KLTH0C08052gna 12ON5995215437e-61
KLLA0C15873g3.397ON5685145417e-61
SAKL0C13992gsingletonON5525245408e-61
KAFR0K013603.397ON5825175429e-61
Skud_2.1923.285ON6195005431e-60
NCAS0A089201.368ON5995375421e-60
NCAS0A106803.284ON5935145412e-60
SAKL0D04048gna 12ON5865075402e-60
KLTH0F11286g3.397ON5825165392e-60
Suva_16.18na 12ON5835205392e-60
TBLA0G031203.284ON6735315433e-60
KLTH0C05170g3.284ON5985365393e-60
SAKL0B08734g3.397ON5585085355e-60
Kpol_1065.133.284ON5965345376e-60
TDEL0H04510singletonON5845435366e-60
SAKL0D02948gna 9ON5945295368e-60
TBLA0C025203.397ON5805265341e-59
YDR046C (BAP3)3.284ON6045215351e-59
NCAS0I008503.397ON5845135332e-59
AER405Cna 12ON4974895272e-59
SAKL0H15092g8.342ON8505935442e-59
TBLA0C012101.368ON6005345332e-59
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_2480
         (586 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...  1030   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   777   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   741   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   706   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   703   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   692   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   689   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   689   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     689   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   688   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   687   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   681   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              672   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   669   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   656   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   653   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   647   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             625   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             602   0.0  
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   333   e-107
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   332   e-106
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   331   e-105
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            326   e-104
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   327   e-104
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   326   e-104
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   326   e-103
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   325   e-103
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   325   e-103
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   325   e-103
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   324   e-103
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   323   e-103
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   323   e-102
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   322   e-102
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   321   e-101
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   322   e-101
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   319   e-101
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   317   e-100
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   320   e-100
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   316   e-100
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   315   e-100
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     315   2e-99
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   315   3e-99
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   313   2e-98
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   314   2e-98
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   313   2e-98
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   311   3e-98
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   309   2e-97
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            310   2e-97
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   308   3e-97
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              308   5e-97
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   309   6e-97
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   307   2e-96
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   306   3e-96
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   306   6e-96
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   305   9e-96
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   303   2e-95
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   305   2e-95
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   304   4e-95
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   302   5e-95
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   303   8e-95
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   302   1e-94
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   303   1e-94
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   301   2e-94
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   302   5e-94
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     301   8e-94
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            299   8e-94
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   301   1e-93
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   298   2e-93
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   299   2e-93
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   300   2e-93
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   298   3e-93
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   298   4e-93
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   299   5e-93
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   298   7e-93
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   297   8e-93
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   297   1e-92
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   298   2e-92
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              296   7e-92
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   295   1e-91
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   295   2e-91
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            291   1e-90
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   290   5e-90
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   290   8e-90
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   287   1e-89
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                290   1e-89
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   288   8e-89
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   284   8e-88
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   284   8e-88
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   283   1e-87
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   285   2e-87
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   283   2e-87
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   282   2e-86
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            280   3e-86
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   280   5e-86
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   278   2e-85
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   278   3e-85
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   277   4e-85
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   275   2e-84
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   275   4e-84
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   270   1e-82
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   269   6e-82
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   268   4e-81
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                259   3e-78
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   259   7e-78
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   255   1e-77
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   256   9e-77
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   256   2e-76
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   255   8e-76
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   253   1e-75
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   249   7e-74
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   248   9e-74
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    246   3e-73
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   247   5e-73
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   246   1e-72
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   244   2e-72
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   244   2e-72
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   244   2e-72
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              244   4e-72
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   245   4e-72
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   244   5e-72
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   245   5e-72
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                242   1e-71
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   243   1e-71
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   243   2e-71
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   242   3e-71
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   243   4e-71
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   240   8e-71
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      240   1e-70
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   241   2e-70
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   239   2e-70
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      239   3e-70
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   239   3e-70
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   238   5e-70
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   239   6e-70
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   239   1e-69
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   236   1e-69
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   237   1e-69
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   236   2e-69
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   236   3e-69
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   236   3e-69
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   236   4e-69
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   236   6e-69
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   235   7e-69
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   236   9e-69
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    235   9e-69
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   234   1e-68
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              235   2e-68
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   234   2e-68
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   234   2e-68
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   234   2e-68
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   233   3e-68
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   235   3e-68
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   233   4e-68
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   234   5e-68
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   231   1e-67
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   232   2e-67
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   231   2e-67
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   230   2e-67
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   231   4e-67
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   231   4e-67
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   230   7e-67
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   230   8e-67
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   229   8e-67
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   229   1e-66
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   226   3e-66
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              228   4e-66
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   228   4e-66
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   228   4e-66
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   228   4e-66
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   228   4e-66
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   227   5e-66
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   227   5e-66
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   227   5e-66
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   227   6e-66
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   227   7e-66
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   227   1e-65
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   226   2e-65
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   226   2e-65
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   226   2e-65
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   226   2e-65
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   225   2e-65
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   228   2e-65
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   223   8e-65
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   224   9e-65
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              224   1e-64
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      222   2e-64
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   223   2e-64
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   223   2e-64
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   224   2e-64
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   223   2e-64
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   222   3e-64
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   222   4e-64
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   222   4e-64
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   221   4e-64
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   222   6e-64
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   221   6e-64
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   221   7e-64
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   222   8e-64
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   221   9e-64
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   221   1e-63
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   220   2e-63
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   219   2e-63
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   219   4e-63
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   218   5e-63
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   219   6e-63
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   218   7e-63
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   218   8e-63
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      217   1e-62
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   218   2e-62
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   218   2e-62
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              216   2e-62
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   218   3e-62
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   218   3e-62
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   221   3e-62
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            216   4e-62
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   217   4e-62
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   216   5e-62
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   217   7e-62
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   216   8e-62
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   216   1e-61
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   215   1e-61
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   216   1e-61
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   215   2e-61
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   215   2e-61
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    213   2e-61
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   219   2e-61
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   214   3e-61
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   213   6e-61
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   213   7e-61
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   213   7e-61
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   212   8e-61
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   213   9e-61
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   213   1e-60
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   213   1e-60
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   213   2e-60
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   212   2e-60
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   212   2e-60
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   212   2e-60
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              213   3e-60
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   212   3e-60
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   210   5e-60
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   211   6e-60
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   211   6e-60
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   211   8e-60
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   210   1e-59
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   210   1e-59
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   209   2e-59
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   207   2e-59
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   214   2e-59
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   209   2e-59
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   209   2e-59
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   209   3e-59
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   207   4e-59
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   207   5e-59
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   209   5e-59
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   209   5e-59
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   208   6e-59
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   208   8e-59
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   208   8e-59
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   207   1e-58
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   207   1e-58
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              206   1e-58
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    207   2e-58
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   207   2e-58
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   207   3e-58
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   206   3e-58
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   205   3e-58
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   206   4e-58
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   203   4e-58
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   206   4e-58
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   206   5e-58
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   203   5e-58
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   205   5e-58
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   206   5e-58
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   205   7e-58
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   205   8e-58
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   205   1e-57
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   203   2e-57
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   204   2e-57
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   203   2e-57
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   203   5e-57
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   204   5e-57
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   202   9e-57
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   201   1e-56
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   201   1e-56
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   201   2e-56
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   200   2e-56
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   201   3e-56
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   199   3e-56
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   200   4e-56
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   200   6e-56
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   200   6e-56
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   200   7e-56
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   203   9e-56
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   198   1e-55
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   199   1e-55
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   199   1e-55
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   198   2e-55
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              198   2e-55
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   199   5e-55
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   196   7e-55
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   196   2e-54
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                196   2e-54
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   196   2e-54
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   195   3e-54
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                195   3e-54
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   195   3e-54
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   195   4e-54
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   197   8e-54
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              194   1e-53
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   193   1e-53
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   191   9e-53
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   195   9e-53
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   194   1e-52
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   194   2e-52
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   194   2e-52
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   193   3e-52
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   193   4e-52
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      189   5e-52
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   192   6e-52
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   192   9e-52
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   188   1e-50
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   184   2e-50
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   183   5e-50
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   187   5e-50
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   182   2e-48
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   177   8e-48
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   176   2e-46
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   176   3e-46
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   174   1e-45
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              171   1e-45
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   171   3e-45
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     154   4e-41
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   160   4e-41
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   157   5e-41
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     153   5e-41
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   154   5e-40
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         109   1e-25
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     102   1e-23
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    101   1e-22
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          96   6e-22
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...    95   2e-21
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          71   2e-13
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      54   3e-08
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    49   3e-06
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    50   3e-06
ZYRO0A08844g Chr1 (704383..705783) [1401 bp, 466 aa] {ON} highly...    41   0.007
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              39   0.016
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      38   0.019
NCAS0A04090 Chr1 (825742..827172) [1431 bp, 476 aa] {ON} Anc_2.407     38   0.055
NDAI0E01810 Chr5 (359926..361353) [1428 bp, 475 aa] {ON} Anc_2.407     38   0.058
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              35   0.076
TDEL0A01810 Chr1 (329082..330482) [1401 bp, 466 aa] {ON} Anc_2.4...    37   0.17 
KAFR0F02620 Chr6 complement(511809..513215) [1407 bp, 468 aa] {O...    36   0.30 
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    36   0.35 
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    34   0.87 
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    34   0.97 
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    33   1.6  
CAGL0A03476g Chr1 complement(355620..357035) [1416 bp, 471 aa] {...    32   3.2  
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    33   3.3  
Skud_12.101 Chr12 complement(202336..203757) [1422 bp, 473 aa] {...    32   4.4  
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    32   4.5  
Suva_10.114 Chr10 complement(217404..218825) [1422 bp, 473 aa] {...    32   4.7  
YLR034C Chr12 complement(210512..211933) [1422 bp, 473 aa] {ON} ...    32   6.3  

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/586 (88%), Positives = 516/586 (88%)

Query: 1   MAKEELNQFKSQEAGVVQADVXXXXXXXXXXXXXXXXXXXXXXXVDWGYDGKHKGIRLKK 60
           MAKEELNQFKSQEAGVVQADV                       VDWGYDGKHKGIRLKK
Sbjct: 1   MAKEELNQFKSQEAGVVQADVSSESSSFGRRGSGGGGGDEEGDSVDWGYDGKHKGIRLKK 60

Query: 61  DLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMAAY 120
           DLQARHVSM                    QAGPIAILIAYSIMGWVVFTVMSCLGEMAAY
Sbjct: 61  DLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGEMAAY 120

Query: 121 IPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPGVWI 180
           IPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPGVWI
Sbjct: 121 IPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPGVWI 180

Query: 181 TVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFRYWK 240
           TVFLAVILTINIVGVKFFGEFEFWLSSFK                GGGPSHNRLGFRYWK
Sbjct: 181 TVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNRLGFRYWK 240

Query: 241 DPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIK 300
           DPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIK
Sbjct: 241 DPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIK 300

Query: 301 LTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLPHIFN 360
           LTLYRIVVFYLCTVFLLGLSVAYNDPLLLQ           PYVVAIKNAGIPVLPHIFN
Sbjct: 301 LTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIPVLPHIFN 360

Query: 361 ACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCLAYM 420
           ACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCLAYM
Sbjct: 361 ACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCLAYM 420

Query: 421 NVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQPVTA 480
           NVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQPVTA
Sbjct: 421 NVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQPVTA 480

Query: 481 WIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIKSANV 540
           WIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIKSANV
Sbjct: 481 WIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIKSANV 540

Query: 541 DLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           DLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF
Sbjct: 541 DLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/543 (71%), Positives = 429/543 (79%), Gaps = 1/543 (0%)

Query: 45  VDWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMG 104
           VDW YDGKH+GIRLKKDLQARHVSM                    +AGP +ILIAYSIMG
Sbjct: 46  VDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMG 105

Query: 105 WVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALV 164
           WVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVG+ YLFKYLVLTPNQLTA ALV
Sbjct: 106 WVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALV 165

Query: 165 MQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 224
           +Q+W+   +V+PGVWITV LAVI+ IN VGV+FFGEFEFWLSSFK               
Sbjct: 166 IQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLA 225

Query: 225 XGGGPSHNRLGFRYWKDPGGFKPYSGA-VSIPGGKGKFVSFASVFVYALFAYLGTELCGI 283
            GGGP+H+RLGFRYW DPG FK YS     I GG GKFV+F SVFVYALFAYLGTELCGI
Sbjct: 226 LGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGI 285

Query: 284 VAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPY 343
           VAAECK+PRRNVPRAIKLTLYRIVVFYL T+FLLG+ VAYNDPLL+Q           PY
Sbjct: 286 VAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPY 345

Query: 344 VVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGV 403
           VVAI+NA IPVLP++FNACVLTFVFSACNSDLYVGSRSLYGLAID KAPK+FA+TN WGV
Sbjct: 346 VVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGV 405

Query: 404 PYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQG 463
           PYN+LA CTLFCCLAYM+VS SA T F YFVNVTSIFGL+SW+SILITYI FDRAFR QG
Sbjct: 406 PYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQG 465

Query: 464 IDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCF 523
           I K+TLSY AP QP   W+AL FC+ VAL+KNF  F+G   D  TFITGYIG+P+YI CF
Sbjct: 466 IPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCF 525

Query: 524 VCYKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFG 583
           + YKIVHKTKWI S  VDLFT+K AIDLEEEE   E   +KE+  + G +WK+ YD + G
Sbjct: 526 IGYKIVHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIYDNVLG 585

Query: 584 WIF 586
           WIF
Sbjct: 586 WIF 588

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/537 (69%), Positives = 422/537 (78%), Gaps = 2/537 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGKH GIRLKK+L+ARHVSM                     AGP++ILIAYS +G++V+ 
Sbjct: 47  DGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYI 106

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
           VM+CLGEMA YIPLDGFTSYA+RY DPALGFAVGY+YLFKYL++TPNQLTAAALV+QYWV
Sbjct: 107 VMTCLGEMATYIPLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWV 166

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R KVNPGVWIT+FL +I+TIN+VGVKFFGEFEFWLSSFK                GGGP
Sbjct: 167 SREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGP 226

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           SH+RLGFR++KDPG F+PYS A+S  G KGKFVSF +VFVYALFAYLGTELCGIVAAECK
Sbjct: 227 SHDRLGFRFYKDPGAFRPYSEAIS--GSKGKFVSFVAVFVYALFAYLGTELCGIVAAECK 284

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPRRNVPRAIKLTLYRIVVFYL T+FLLG++VAYNDPLLLQ           P+VVAIKN
Sbjct: 285 NPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKN 344

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           AGIPVLPHIFNACVL FVFSACNSDLYV SRSLYGLAID KAPKIFAKTN WGVPYNSL 
Sbjct: 345 AGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLI 404

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           LC LFC LAYMNVSS +  +F+YFVNV SIFGL+SWI+ILITYI FDRA R QG+DK+TL
Sbjct: 405 LCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTL 464

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +Y AP     A+ AL FC ++AL+KNFTVFLG  FDYK FITGYIGIPV+I+CF  YK +
Sbjct: 465 AYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYI 524

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
             TK++K    DL+T+K  IDLEEEEGKL     KE+ +     +K FY+   GWIF
Sbjct: 525 RGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/537 (66%), Positives = 413/537 (76%), Gaps = 2/537 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGKH+GIRLKK L+ARHVSM                     AGP +ILI+YS +G +V+T
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
           VM+CLGEMAA+IPLDGFTSYA+RY DPALGFAVGY YLFKY ++TPNQLTA A+VMQYWV
Sbjct: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R KVNPGVWIT+FL +I+ IN VGV+FFGEFEFWLSS K                GGGP
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           +H+R GFRYW+DPG FKPYS A+S  G KGKFVSFASVF  ALFAY GTELCGIVAAE K
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAIS--GSKGKFVSFASVFALALFAYTGTELCGIVAAEAK 280

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPRR+VPRAIKLTLYRIV+FY+ ++ LLG++VAYNDPLL++           P+VVAIKN
Sbjct: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKN 340

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           AGIPVLPHIFNACVL FVFSACNSDLYV SR+LYGLAID+KAPKIFAKTN WGVPY SLA
Sbjct: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           +  LFC LAYMNVSS +  +F+YFVNV SIFGLLSWISILITY+ F +A   Q  DK+  
Sbjct: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF 460

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           SY APFQP + W++L FC ++ L+KN+TVFLG TFDYKTFI+GYIGIPVY +C+V YK+V
Sbjct: 461 SYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV 520

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           H++K IK  +VDL+T+K AID EEEEGKL  +  KE+ K        FYD   GWIF
Sbjct: 521 HRSKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/542 (64%), Positives = 415/542 (76%), Gaps = 2/542 (0%)

Query: 45  VDWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMG 104
           V  G DGKH+GIRLKK+L+ARHVSM                     AGP++ILI+YS +G
Sbjct: 37  VSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVG 96

Query: 105 WVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALV 164
            +V+TVMSCLGEMAA+IPLDGFTSYA+RY DPA+GFAVGY+YLFKY ++TPNQLTA A+V
Sbjct: 97  LLVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMV 156

Query: 165 MQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 224
           MQ+WV R +VNPGVWIT+FLA+I+ IN VGV+FFGEFEFWLSS K               
Sbjct: 157 MQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIM 216

Query: 225 XGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIV 284
            GGGP+H+R GFR+W+DPG FKPYS A+S  G KGKFVSFASVF  ALFAY GTELCGIV
Sbjct: 217 LGGGPNHDRTGFRFWRDPGAFKPYSEAIS--GSKGKFVSFASVFALALFAYTGTELCGIV 274

Query: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYV 344
           AAE KNPRR+VPRAIKLTLYRIVVFY+ T+ LLG++VAYNDP LL+           P+V
Sbjct: 275 AAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFV 334

Query: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404
           VAI+NA IPVLPHIFN CVL FVFSACNSDLYV SRSLYGLAID KAP+IFA TN WGVP
Sbjct: 335 VAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVP 394

Query: 405 YNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGI 464
           Y SL L  LFC LAYMNVSS +  +F+YFVNV SIFGLLSWI+ILITYI FD+A RVQ  
Sbjct: 395 YYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFG 454

Query: 465 DKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFV 524
           DK++LSY A FQP + ++AL FC ++ L+KN+TVFLG  FDYKTFI+GYIGIPVY++C+V
Sbjct: 455 DKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYV 514

Query: 525 CYKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGW 584
            YK+V++TK IK  +VDL+T+K AID EEEE KL      E  +     +K FY+   GW
Sbjct: 515 GYKVVYRTKLIKPEDVDLYTFKDAIDAEEEEYKLLEKERLENMENSPKNFKWFYETFLGW 574

Query: 585 IF 586
           IF
Sbjct: 575 IF 576

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/541 (63%), Positives = 405/541 (74%), Gaps = 10/541 (1%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           +DGKH GIRLKK L+ARHVSM                     AGP AILIAY+ +G +VF
Sbjct: 70  FDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVF 129

Query: 109 TVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
            VMSCLGEMAAYIPLDGFTSY+TRYADPALGFAVGY YLFKY ++ PNQLTA ALV+QYW
Sbjct: 130 FVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
           V R KVNPGVWIT+ L  I+TIN +GV+FFGE E+++S+ K                GGG
Sbjct: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGG 249

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P+H  LGF+YWK+PG FK YS A++  G KG+FVSFASVFV ALFAYLGTELCGIV +EC
Sbjct: 250 PNHEVLGFKYWKNPGAFKEYSTAIT--GAKGRFVSFASVFVLALFAYLGTELCGIVVSEC 307

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
           KNPR+ VP+AIKLT+YRI+VFYL ++FLLG+ V +NDPLL+            P+VVAI 
Sbjct: 308 KNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIV 367

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           NAGIPVLPHI NAC+L FVFSA NSDLYV SRSLYGLAID KAP+IFAKTN  GVPY SL
Sbjct: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +  LF  LAYMNVSS +  +F+YFVN  SIFGLLSWISILITYI FD+AFRVQGIDK+T
Sbjct: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L+YQ+P QP  AW +L FC+++ L+KNF  FLGDTFDYK+FITGYIGIP YI+ ++ YK+
Sbjct: 488 LAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKL 547

Query: 529 VHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEER----KQHGWTWKQFYDYIFGW 584
            +KTK I S  VDL ++K A+DLEEEEGK+    L EER      HG   K  Y+ IFGW
Sbjct: 548 WYKTKIIPSEEVDLVSFKEAVDLEEEEGKM----LDEERAAHLAAHGKDLKWCYEKIFGW 603

Query: 585 I 585
           +
Sbjct: 604 V 604

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/537 (62%), Positives = 405/537 (75%), Gaps = 2/537 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGK +  RL+KDL+ARH+SM                      GP+A+LIAY+ +G +VF 
Sbjct: 73  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFF 132

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
            M+CLGEMA+YIPLDGFTSYA+RY DPALGFA+GYTYLFKY +L PNQLTAAALV+QYWV
Sbjct: 133 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 192

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R +VNPGVWIT+F+ VI+ IN++GVKFFGEFEFWLSSFK                GGGP
Sbjct: 193 SRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGP 252

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
            H+RLGFRYW+DPG FK YS A+   GGKGKFVSF +VFVY+LF+Y G EL GIV +E +
Sbjct: 253 DHDRLGFRYWRDPGAFKEYSAAIG--GGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQ 310

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR++VP+AIKLT+YRI+VFYLCTVFLLG+ VAYNDP L+            P+VVAI+N
Sbjct: 311 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQN 370

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           +GI VLPHIFNACVL FVFSACNSDLYV SR+LY LAID KAPKIF+KTN WGVPYN+L 
Sbjct: 371 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALI 430

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
              LFCCLAYMNVS+ +  +F+YFVNV S+FG+LSWI+ILI YI FD+A R QGIDK+  
Sbjct: 431 FSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 490

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +Y AP Q   A+ AL FC+ +AL+KNFTVFLG  FDYKTFITGYIG+PVY+  +V YK++
Sbjct: 491 AYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLI 550

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           +KTK IKS +VDL+T+K   D EEE+GK+E    +E  K++G   + FY+   G IF
Sbjct: 551 YKTKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEWFYEKFLGHIF 607

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/537 (62%), Positives = 407/537 (75%), Gaps = 2/537 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGK +  RL+KDL+ARH+SM                      GP+A+LIAY+ +G +VF 
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
            M+CLGEMA+YIPLDGFTSYA+RY DPALGFA+GYTYLFKY +L PNQLTAAALV+QYW+
Sbjct: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R +VNPGVWIT+FL VI+ IN+VGVKFFGEFEFWLSSFK                GGGP
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           +H+RLGFRYW+DPG FK YS A++  GGKGKFVSF +VFVY+LF+Y G EL GIV +E +
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAIT--GGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR++VP+AIKLT+YRI+VFYLCTVFLLG+ VAYNDP LL            P+VVAI+N
Sbjct: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           +GI VLPHIFNACVL FVFSACNSDLYV SR+LY LAID KAPKIFAKT+ WGVPYN+L 
Sbjct: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           L  LFC LAYMNVSS +  +F+YFVNV S+FG+LSWI+ILI YI FD+A R QGIDK+  
Sbjct: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +Y AP Q   A+ AL FC+++AL+KNFTVFLG  FDYKTFITGYIG+PVYI+ +  YK++
Sbjct: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           +KTK IKS +VDL+T+K   D EEEEG+++    +E  K +G   + FY+   G IF
Sbjct: 552 YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/538 (62%), Positives = 405/538 (75%), Gaps = 5/538 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGK  G RLKKDL+ARH+SM                     AGP +ILIAY+ +G +VF 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
            M+ LGEMAAYIPLDGFTSYA+RY DPALGFAVGY+YLFKY ++TPNQLTAAALV+QYWV
Sbjct: 134 TMAALGEMAAYIPLDGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWV 193

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R  VNPGVWIT+FL VI+ IN +GVK+FGEFEFWLSSFK                GGGP
Sbjct: 194 DRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGP 253

Query: 230 SHNRLGFRYWKDPGGFKPYSGAV-SIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           +H+RLGFRYWK PG FKPYS +V +I G  GKFV+F +VFVYALFAYLG EL GIVAAE 
Sbjct: 254 NHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEA 313

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
           +NPRRN+PRAIKLT++RI+ FY+ T+FLLG+ VAY+DPLLL            P+VVAI+
Sbjct: 314 ENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQ 373

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G+ VLPHIFN CVL FVFSACNSDLYVG+RSLY LA+D KAPKIFAKTN WGVPYN++
Sbjct: 374 NSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAM 433

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
             C LFC LAYMNVSS +  +F+YFVNV SIFG+LSW SILIT+I FDRA R QGID++T
Sbjct: 434 GGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRST 493

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
            +Y APFQP  ++ AL FC+++AL+KNF+VFLG+ FDYKTFITGYIG+PVY   F+ YK+
Sbjct: 494 FAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKL 553

Query: 529 VHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMM----RLKEERKQHGWTWKQFYDYIF 582
            +KTK +K    DL +YK A+D EEEEGK++      RLK  +K   W ++++   IF
Sbjct: 554 YYKTKTVKPHEADLNSYKAAVDREEEEGKIKEAERKERLKHGKKDLEWFYEKYISSIF 611

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/537 (62%), Positives = 405/537 (75%), Gaps = 2/537 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGK +  RLKK+L+ARH+SM                      GP+A+LIAY+ +G +VF 
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
            M+CLGEMA+YIPLDGFTSYA+RY DPALGFA+GYTYLFKY +L PNQLTAAALV+QYW+
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R +VNPGVWIT+FL VI+ INIVGVKFFGEFEFWLSSFK                GGGP
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
            H+RLGFRYW+DPG FK YS A++  G  GKF SF +VFVY+LF+Y G EL GIV +E +
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAIT--GSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR++VP+AIKLT+YRI+VFYLCTVFLLG+ VAYNDP LL            P+VVAI+N
Sbjct: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           +GI VLPHIFNACVL FVFSACNSDLYV SR+LY LAID KAPKIFAKT+ WGVPYN+L 
Sbjct: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           L  LFCCLAYMNVSS +  +F+YFVNV S+FG+LSWI+ILI YI FD+A R QGIDK+  
Sbjct: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +Y AP Q   A+ AL FC+++AL+KNFTVFLG  FDYKTFITGYIG+PVYIL +  YK++
Sbjct: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           +KTK IKS +VDL+T+K   D EEEEG+++    +E  +++G   + FY+   G IF
Sbjct: 550 YKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/537 (62%), Positives = 404/537 (75%), Gaps = 3/537 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGK  G+RLKK+L+ARH+SM                      GP +ILIAYS +G +VF 
Sbjct: 42  DGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFF 101

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
           VM+CLGEMA YIPLDGFTSYATRY DPALGFAVGY YLFKY ++TPNQLTA ALV+QYW+
Sbjct: 102 VMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWI 161

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R  VNPGVWIT+FL VI+ IN VGV++FGEFEFWLSSFK                GGGP
Sbjct: 162 DRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGP 221

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           +H+RLGFRYWK+PG FKPYS   SI G KGKFVSF +VFVYALFAYLG EL GIVAAE +
Sbjct: 222 NHDRLGFRYWKNPGAFKPYSE--SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAE 279

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPRRN+PRAIKLT+YRI++FY+ T+FLLG+ VAYNDP LL            P+VVAI+N
Sbjct: 280 NPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQN 339

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           +G+  LPHIFN CVL FVFSACNSDLYVG+RSLY LAID KAPK+FAKTN WGVPYN+L 
Sbjct: 340 SGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALF 399

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
            C LFC LAYMNVSS +  +F+YFVNV SIFG+LSWISILITYI F RA   Q +D+N+ 
Sbjct: 400 GCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSF 459

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +Y+APFQP  A+I L FC+++A +KNFTVF+G+ FDYK+FITGYIG+P+Y++ +  YKI+
Sbjct: 460 AYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKII 518

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           +KTK +K+   DL+++K AID EE EGK++    KE  K    + K FY+   G+IF
Sbjct: 519 YKTKLVKAEEADLYSFKEAIDREEAEGKIKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/537 (61%), Positives = 404/537 (75%), Gaps = 2/537 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGK +  RL+KDL+ARH+SM                      GP+++LIAY  +G +VF 
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
            M+CLGEMA+YIPLDGFTSYA+RY DPALGFA+GYTYLFKY +L PNQLTAAALV+QYWV
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R +VNPGVWIT+FL VI+ INIVGV+FFGEFEFWLSSFK                GGGP
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
            H+RLGFRYW+DPG FK YS A++  G KGKFV+FASVFVY+LF+Y G EL GIV +E K
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAIT--GSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAK 309

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR++VP+AIKLT+YRI+VFYLCTVFLLG+ VAYNDP LL            P+VVAI+N
Sbjct: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQN 369

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           +GI VLPHIFN CVL FVFSACNSDLYV SR+LY LAID KAPKIFAKT+ WGVPY +L 
Sbjct: 370 SGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALM 429

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           +  LFCCLAYMNVS+ +  +F+YFVNV S+FG+LSWI+ILI YI FDRA R QG+DK+  
Sbjct: 430 VSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKF 489

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +Y AP Q   A+ AL FC+++AL+KNFTVFLG TFDYKTFITGYIG+P+Y+  +V YK++
Sbjct: 490 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLI 549

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           +KTK +K A+ DL+T K   D EEE+GKL+    +E  +++G   + FY+   G IF
Sbjct: 550 YKTKVVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNGKNLEWFYEKFLGNIF 606

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/540 (61%), Positives = 398/540 (73%), Gaps = 2/540 (0%)

Query: 47  WGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWV 106
           +  DGK +G RLKK L+ R VSM                     AGP+++LIAY+ +G +
Sbjct: 60  YNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLL 119

Query: 107 VFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQ 166
           VF  M+ LGEMA+YIPLDGFTSYATRYADPALGFAVGY YLFKY +L PNQLTAAALV+Q
Sbjct: 120 VFFTMASLGEMASYIPLDGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQ 179

Query: 167 YWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
           YW+ R KVNPGVWIT+FL VI+ IN +GV+FFGEFEFWLSSFK                G
Sbjct: 180 YWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLG 239

Query: 227 GGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286
           GGP+H+RLGFR+WK PG F  YS A++  G  GKFV+F SVFVYA FAYLGTEL GIV  
Sbjct: 240 GGPNHDRLGFRHWKHPGAFNNYSPAIT--GDTGKFVAFVSVFVYATFAYLGTELVGIVVG 297

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVA 346
           E +NPR++VP+AIKLT+YRI++FYL ++ LLG+ V Y+DPLLL+           P+VVA
Sbjct: 298 EARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVA 357

Query: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYN 406
           I N+GI VLPHIFNACVL FVFSACNSDLYV SRSLY LAID KAPKIFA+TN WG+PY 
Sbjct: 358 IVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYY 417

Query: 407 SLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDK 466
           SL L  LFC LAYM+VSS +  +F+YFVNV SIFGLLSWI IL+TY++FDRA R QGIDK
Sbjct: 418 SLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDK 477

Query: 467 NTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCY 526
           +T SY AP Q   A+ AL FC ++AL+KNFTVFLG  FDYKTFITGYIGIPV+ + +  Y
Sbjct: 478 STFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGY 537

Query: 527 KIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           K+++KTK I    VDL+T+K AID EEE+GKLE +  KE  K +G  ++ FYD     IF
Sbjct: 538 KLIYKTKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFYDKFLSNIF 597

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/540 (61%), Positives = 397/540 (73%), Gaps = 2/540 (0%)

Query: 47  WGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWV 106
           +  DGK +G RLKK L+ARHVSM                     AGP++ LIAY+ +G +
Sbjct: 57  YNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLL 116

Query: 107 VFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQ 166
           VF  M+CLGEMA YIPLDGFTSYA+RY DPALGFAVGY YLFKY +L PNQLTAAALV+Q
Sbjct: 117 VFFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176

Query: 167 YWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
           YWV + KVNPGVW+T+FL VI++IN+ GV+FFGEFEFWLSSFK                G
Sbjct: 177 YWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLG 236

Query: 227 GGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286
           GGP H+RLGFRYW+ PG FK YS   +I G  G+FV+F SVFVYA +AYLG EL GIVAA
Sbjct: 237 GGPDHDRLGFRYWRHPGSFKEYSE--TITGDTGRFVAFVSVFVYATYAYLGIELTGIVAA 294

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVA 346
           E +NPR+++P+AIKLT+YRIV+FYL ++FLLG+ VAY+DPLL++           P+VVA
Sbjct: 295 EAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVA 354

Query: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYN 406
           I N+GI  LPHI NACVL FVFSACNSDLYV SRSLY LAID KAPKIFAKTN WG+PY 
Sbjct: 355 IINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYY 414

Query: 407 SLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDK 466
           +L++  LFC LAYM VSS++  +F+YFVNV SIFG+LSWISILITYI FDRA R QG+DK
Sbjct: 415 ALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDK 474

Query: 467 NTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCY 526
           +T +Y APFQP  AW +L FC ++AL+KNFTVFL   FDYK FITGYIG+PV+  C+  Y
Sbjct: 475 STFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGY 534

Query: 527 KIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           K  +KTK I    VDL+T+K AID EEE+GK+      E  KQ+G  ++ FYD   G IF
Sbjct: 535 KFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/544 (59%), Positives = 395/544 (72%), Gaps = 7/544 (1%)

Query: 46  DWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGW 105
           D+  DGK +  RL+KDL+ARH+SM                     AGP+++ IAY+ +G 
Sbjct: 74  DYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGV 133

Query: 106 VVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVM 165
           +VF  M+ LGEMA+YIPLDGFTSYA+RY DPALGFAVGY YL KYL+L PNQLTAAALV+
Sbjct: 134 LVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVI 193

Query: 166 QYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 225
           QYW+ R +VNPGVWIT+FL +I+ +N +GVKFFGEFEFWLS+FK                
Sbjct: 194 QYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIML 253

Query: 226 GGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVA 285
           GGGP+H+RLGFR++  PG FKPYS   SI G KGKFV+F +V VYALFAYLG EL GIVA
Sbjct: 254 GGGPTHDRLGFRFYDHPGAFKPYSK--SIDGSKGKFVAFVAVLVYALFAYLGIELTGIVA 311

Query: 286 AECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVV 345
           AE  NPR+++P+AIKLT+YRI+VFYL T+FLLG+ VAY+DPLL +           PYVV
Sbjct: 312 AEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVV 371

Query: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405
           AI N+GI  LPHIFNACVL FVFSACNSDLYV SR+LYGLAID KAPKIFA TN WGVPY
Sbjct: 372 AIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPY 431

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
            SL + + FC LAYM+VSS +  +F+YFVNV SIFGLLSWISILITY+ F RA + Q +D
Sbjct: 432 YSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVD 491

Query: 466 KNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVC 525
           ++  +Y+APFQP  ++  L FC+++A +KNFTVFL   FDYK FITGYIGIPV+++ +  
Sbjct: 492 RSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFG 551

Query: 526 YKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE---RKQHGWTWKQFYDYIF 582
           YK V KTK  K   VDL+T+K AID EEE+GK+     +E     K  GW W  FY+ + 
Sbjct: 552 YKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDW--FYEKVL 609

Query: 583 GWIF 586
           G IF
Sbjct: 610 GNIF 613

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/538 (60%), Positives = 388/538 (72%), Gaps = 1/538 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGK +G RLKK+L+ARHVSM                     AGP ++ I YS +G +VF 
Sbjct: 56  DGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFF 115

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
            MSCLGEMAA+IPLDGFTSYA+RY DPALGFAVGY+YL KYL+L  NQLTA A+V+QYWV
Sbjct: 116 TMSCLGEMAAFIPLDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWV 175

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R  +NPGV+IT+FL +I+TINI GVK FGEFEFWLSSFK                GGGP
Sbjct: 176 DRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGP 235

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGG-KGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           +H+RLGFRYW+DPG FKPYS ++    G  GKFVSF S FVYALF YLG EL GIVAAE 
Sbjct: 236 NHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEA 295

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
           +NPR+N+P+AIKLT+YRI++FY+ T+ LL + VAYNDPLLL+           P+VVAI+
Sbjct: 296 QNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIE 355

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+GI +LPHIFN CVL FV SA NSDLYV SRSLY LAID KAPK F KTN WG+PY SL
Sbjct: 356 NSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSL 415

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
           A  T F CLAYMNVSSSA  +F+YFVN  SIFG++SWI IL+TYI FD+A + QG+DK+ 
Sbjct: 416 AFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSN 475

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
            +Y AP+QP  A+ AL FC ++ALVKNFTVFLG  FDYK FITGYIGIPV+ +CFV YKI
Sbjct: 476 FTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKI 535

Query: 529 VHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           V+KTK  +   VDL T K  ID EEE+GK+E    +E  K     W  FYD   G IF
Sbjct: 536 VYKTKTHRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/529 (60%), Positives = 386/529 (72%), Gaps = 6/529 (1%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LKK+LQARHVSM                     AGP ++ IAYS +G +VF  M+ +GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 118 AAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
           A+YIP+DGFTSYA+RY DPALGFAVGY YLFKYL+L PNQLTAA+LV+QYW+ R  VNPG
Sbjct: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           VWIT+FL VI+ IN+ GVKFFGEFEFWLSSFK                GGGP H+RLGFR
Sbjct: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGFR 278

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
           YW+ PG FKPYS A  I G  GKFV+F SVFVYALFAYLG EL GIVAAE  NPR++VPR
Sbjct: 279 YWQHPGAFKPYSDA--IDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLPH 357
           A+KLT++RIV+FYL T+FLLG+ VAYNDP LL            P+VVAI+N+GI VLPH
Sbjct: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPH 396

Query: 358 IFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCL 417
           IFNACVL FVFSACNSDLYVGSRSLY LA+D KAP IF +T SWG+P+ SL +C LF  L
Sbjct: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456

Query: 418 AYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQP 477
           AYMNVSS +  +F+YFVNV SIFGLLSWI I ITYI F RA +VQG+D++  +Y APFQP
Sbjct: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516

Query: 478 VTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIKS 537
              + +L +C+ +A +KNFTVFLG +FDYK FITGYIG+PV+++ +  YK + KTK +KS
Sbjct: 517 YGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKS 576

Query: 538 ANVDLFTYKTAIDLEEEEGKL----EMMRLKEERKQHGWTWKQFYDYIF 582
             VDLFT K   D +E EGK+    + +RL+E +    W +++F   IF
Sbjct: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/538 (60%), Positives = 393/538 (73%), Gaps = 2/538 (0%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           +DGK    RLKKDL+ARHVSM                     AGP+++LI+YS +G +VF
Sbjct: 53  FDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVF 112

Query: 109 TVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
            VMSC+GEMAAYIPLDGFTSYA+RY DPALGFAVGY YL KY +L PNQLTAAALV+QYW
Sbjct: 113 FVMSCIGEMAAYIPLDGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYW 172

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
           + R KVNPGVWIT+ L VI+ IN  GVKFFGEFEFWLSSFK                GG 
Sbjct: 173 IPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGT 232

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P+H+RLGFRYWK PG FK YS   SI G  G+FVSF S FVY LF YLG EL GIVAAE 
Sbjct: 233 PTHDRLGFRYWKHPGAFKEYSK--SIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEA 290

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
           +NPR+N+P+AIKLT++RI++FY+ T+FLLG+ V+ NDPLLL+           P+VVAI 
Sbjct: 291 ENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIV 350

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+GI  LPHIFNACVL FVFSACNSDLYV SR+LY LAID KAPKIFAKTN +G+PYNSL
Sbjct: 351 NSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSL 410

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +  LFC LAYM+VSS +  +F+YFVNV SI G+L+WISILITYI FDRA R QGIDK+T
Sbjct: 411 GVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKST 470

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
            +Y AP QP  A+ +L FC ++AL+KNFTVFL   FDY+ FITGYIG+P++ +C+  YK 
Sbjct: 471 FAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKF 530

Query: 529 VHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586
           V KTK  K   VDLF++K AID EEE+G+++     E  K++G  W+ FY+   G IF
Sbjct: 531 VKKTKIRKPEEVDLFSFKAAIDQEEEDGRIKDAATAERIKKNGKNWEWFYETYLGKIF 588

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/517 (58%), Positives = 367/517 (70%), Gaps = 5/517 (0%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DGK++GIRLKK L++RH+SM                     AGP++ LIAY+ +G +VF 
Sbjct: 57  DGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFF 116

Query: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
            M+CLGEMA +IPLDGFTSYA+RY DPALGFAVGY YL KY +L PNQLTAAA+VMQYWV
Sbjct: 117 TMACLGEMATFIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWV 176

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R  VNPG+W+T+  AVI  INI GV+FFGEFEFWLSS K                GG  
Sbjct: 177 PRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAG 236

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           SH+RLGFRYWK PG F  YS  +S  G  GKFVSF +V V  +FAYLG EL GIVAAE  
Sbjct: 237 SHDRLGFRYWKHPGAFNDYSDDIS--GSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEAS 294

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPRR+VP+AIKLT YRI+VFY+ ++FLLG+ V YND  L+            P+ +AI N
Sbjct: 295 NPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTAS--PFSIAILN 352

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           AGI VLP IFN C+L FVFSA NSDLYV SR+LY LA+D KAPKIFA TN WG+PYNSL 
Sbjct: 353 AGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLF 412

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           +  LFC LAYM VSSS+  +F YFVNV SI GLL+WISILITYI FDRA R Q +DK+T 
Sbjct: 413 VSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTF 472

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +Y APFQP  A+++L FC ++A++KNFTVFLG  FDYKTFITGYIG+P+++LC+  YKI 
Sbjct: 473 AYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGH-FDYKTFITGYIGLPIFVLCYFGYKIT 531

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE 566
            K++   +  VDL + K+ +D E+ E +L     +EE
Sbjct: 532 CKSEIRSARYVDLVSQKSLVDREQVEYELIEQLKREE 568

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  333 bits (854), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/504 (36%), Positives = 279/504 (55%), Gaps = 14/504 (2%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
            K   L ++L+ R VS+                    + GPI++ IAY   G ++  V+ 
Sbjct: 27  EKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIF 86

Query: 113 CLGEMAAYIPLD-GFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
            L EMA++ P+D GF+ Y  RY DPA GFA G+ Y  KY ++    LTA  LV+ YW  R
Sbjct: 87  SLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--R 144

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
             VN GVW+TV    +  +N + VK+FGE E  L+ FK                GG P+H
Sbjct: 145 PDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNH 204

Query: 232 NRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNP 291
              GFRYW++ G   PY     + GG GKF+ + +  V ++F ++G+E+ GIV  E  NP
Sbjct: 205 TTTGFRYWRESGAL-PYL----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANP 259

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAG 351
           ++ +P++     +RI   Y+  VF+LGL+++  +  L+            P+V+AI ++G
Sbjct: 260 KKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANAS--PFVIAISSSG 317

Query: 352 IPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALC 411
           I VLP+  NA +L F+ S+ N+D+Y+ SR LYGLA D  APKIF   N + VP       
Sbjct: 318 IKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTG 377

Query: 412 TLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSY 471
           +L   LAYMN   SA T+FSY  +  S+FG+L+W  ILI YI++DRA + +GI  + + +
Sbjct: 378 SLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437

Query: 472 QAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
           +  FQP  A++ L F  ++     +  F+   F YKTFIT YIG+   IL  + YK+  K
Sbjct: 438 RMWFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFK 496

Query: 532 TKWIKSANVDLFTYKTAIDLEEEE 555
           TK++K + +   +++T  + E EE
Sbjct: 497 TKFVKPSEI---SFRTRNEHEGEE 517

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/537 (35%), Positives = 295/537 (54%), Gaps = 23/537 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           D +H    LKK L  RH+ +                    Q GP  + +++ I+  +V+ 
Sbjct: 46  DYEHN---LKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYC 102

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           +M  L EM  Y+P  G      TRY DP+LGFA G+ Y + Y +L   +LTAAA +++YW
Sbjct: 103 IMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYW 162

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
               +V  GVWIT+FL V++ +N   V+F+GE EFW +S K                GG 
Sbjct: 163 TD--QVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGA 220

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTELCGIVAA 286
           P+H+R+GFRYW++PG F        I GG  G+F+   +  + + FA+ L  EL G+   
Sbjct: 221 PNHDRVGFRYWRNPGAF-----GYHITGGNLGRFLDLWTAIIKSAFAFILSPELVGLACV 275

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYVV 345
           E K+ RRN+ +A +  +YRI+ FYL +  ++G+ VA ND  LLL            P+V 
Sbjct: 276 EAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQ 335

Query: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405
            I N+GIPVL H+ N  +LT  +SA NS  Y  SRS+  L+    APKIF+K N +GVPY
Sbjct: 336 GIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPY 395

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
           N++ LC+L  CLAY+NVSS++  +F +  N+ +I G + W  I + YI F +A     + 
Sbjct: 396 NAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL- 454

Query: 466 KNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVC 525
            + + Y++P QP +A+       ++ L   + VF+   +DYK F+T YI +P+++  ++ 
Sbjct: 455 LDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLG 514

Query: 526 YKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIF 582
           +K ++KT++     VD     T ++  EEE KL ++R+ +        W++F +++ 
Sbjct: 515 HKTIYKTRF--CIPVDQIDVITGLEEAEEEAKLSVVRVPKN------AWEKFINWLL 563

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/513 (34%), Positives = 291/513 (56%), Gaps = 14/513 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
            G+ +   +K++L+ RH+ M                     AGP+  LI+Y  MG + ++
Sbjct: 76  QGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYS 135

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT ++ R+  PA G A GY Y F + +    +L+    V+++W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFW 195

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
               KV    WI++F  +I  +N+  VK++GEFEFW++S K                G G
Sbjct: 196 TN--KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F + GTEL GI A E 
Sbjct: 254 VT-GPVGFRYWRNPGAWGP--GIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR+ VPRAIK  ++RI+ FY+ ++  +GL V YNDP L             P+++AI+
Sbjct: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TTATSYVSVSPFIIAIE 367

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G  VLPHIFNA +LT + SA NS++YVGSR L+GL+ +K APK  ++T   GVPY ++
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAV 427

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +  +F  LAYM  S+  + +F + +N+T + G  +W+ I I++I F +A + +GI ++ 
Sbjct: 428 FITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDE 487

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A   P  A+ A  F +++ L++ FT F    FD   F+  YI I +++  ++ ++I
Sbjct: 488 LPFKAKLMPGLAYFAATFMIIIILIQGFTAF-APKFDGIDFLAAYISIFLFLAIWILFEI 546

Query: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
           + + ++I K  +VD+ + +  I+    E+ E K
Sbjct: 547 IFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPK 579

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  326 bits (836), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/491 (36%), Positives = 271/491 (55%), Gaps = 11/491 (2%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
           G      L ++L    VS+                    + GPI+I +AY   G ++  V
Sbjct: 26  GSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYLFTGSILAVV 85

Query: 111 MSCLGEMAAYIPLD-GFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
           +  L EMAA+ P+D GF+ Y T+Y DPA GFA G+ Y  KY ++    LTA  LV+ YW 
Sbjct: 86  IFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW- 144

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
            R  +N  VW+TV  A    +N + V++FG+ E +++  K                GGGP
Sbjct: 145 -RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLVITCGGGP 203

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
            H  +GFRYW++  GF PY     + G  GKF+ + +  + ++F ++G+E+ GI+  E  
Sbjct: 204 DHTTIGFRYWRE-SGFLPYL----VKGNTGKFLGWWACVIQSIFGFMGSEMIGIIYGETA 258

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR+ +P+A +  + RI VFY+  VF+LGL+V+ ++  L+            P+V+AI  
Sbjct: 259 NPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANAS--PFVIAIST 316

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           +GI VLP   NA +L F+ S+  +D+Y+ SR LYGLA D  APKIF + N   +P     
Sbjct: 317 SGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMVGCV 376

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           + +L   LAYMN   SA T+F Y  +  S+FG+L+W  IL+ YI +DR  +  G+  + +
Sbjct: 377 VGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRLDEI 436

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            ++ PFQP  A+IAL F  ++     ++ F+   F+YK FIT YIGI   +L  + YK+ 
Sbjct: 437 PFRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLFITSYIGIFANVLLVLGYKLY 495

Query: 530 HKTKWIKSANV 540
           +KTKW+K   +
Sbjct: 496 YKTKWVKPEEI 506

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/513 (35%), Positives = 289/513 (56%), Gaps = 16/513 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K+DL+ RH+SM                     AGP+  L+AY  MG + F V   LGEM
Sbjct: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A +IP+   FT Y  R+  PALG A GY Y F + V    +L+    ++QYW     V  
Sbjct: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF--AVPL 179

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
            VWI VF  ++   N++ V+F+GE EFW+++ K                GG  S   LGF
Sbjct: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGF 238

Query: 237 RYWKDPGGFKPYS-GAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           RYWK+PG   P+  G +S    + +F+ + S  + A F Y GTEL GI A E KNPR+ V
Sbjct: 239 RYWKNPG---PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+AI    +RI+ FY+ ++F +GL V Y DP L             P+V+AI+N+G  VL
Sbjct: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVL 353

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P +FN  +L  + SA NS++Y+GSR LYGL+    AP +F KTN  GVP+ ++   ++F 
Sbjct: 354 PSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFG 413

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
           CLAY+N+S +A+ +F + + +T++ G  +W+ I +++I F +  + +GI +N L ++A F
Sbjct: 414 CLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKF 473

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  A+ A  F  ++ L++ F  F  + F +  FI  YI + ++I+C++ ++++ KT+ I
Sbjct: 474 MPWGAYYAAFFITVIILIQGFDSFAPE-FVFSEFIADYISVFLFIVCWLGFQVLFKTRLI 532

Query: 536 -KSANVDLFTYKTAIDL----EEEEGKLEMMRL 563
            +  +VD+ T +  ID     +++E K  + +L
Sbjct: 533 LRKEDVDIDTDRREIDALVWSDDDEPKTLLQKL 565

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  326 bits (836), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/506 (34%), Positives = 290/506 (57%), Gaps = 13/506 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G+ +   +K++L+ RH+ M                     AGP+  LIAY  MG +V++
Sbjct: 51  NGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYS 110

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT ++ R+  P+ G A GY Y F + +    +L+    ++Q+W
Sbjct: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI++F  +++ +N+  V+F+GEFEFW++S K                G G
Sbjct: 171 TS--AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +GFRYW++PG   P  G ++    + KF+ + S  + A F Y GTEL GI A E 
Sbjct: 229 VT-GPVGFRYWRNPGPMGP--GIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR++VPRAIK  ++RI+ FY+ ++F +GL V YNDP L             P++++I+
Sbjct: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAAS---PFIISIQ 342

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G P+LPHIFNA +L+ + SA NS++YVGSR ++GL+  K AP+I ++TN  GVP+ S+
Sbjct: 343 NSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSV 402

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
               LF  LAYM  S+  E  F++ +N+T + G  SW+ I I+++ F +A   +GI ++ 
Sbjct: 403 IFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDD 462

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A F P  A+ A+ F  ++ +++ FT F   +FD   F+  YI   ++I  ++ +++
Sbjct: 463 LPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQL 521

Query: 529 VHKTKWI-KSANVDLFTYKTAIDLEE 553
             + + I K  +VD+ T +   D+EE
Sbjct: 522 WFRCRLIWKIEDVDIDTDRR--DIEE 545

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/513 (34%), Positives = 291/513 (56%), Gaps = 14/513 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G+ +   +K++L+ RH+ M                     AGP+  LI+Y  MG + ++
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
               KV    WI++F  +I  +N+  VK++GEFEFW++S K                G G
Sbjct: 196 TY--KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F + GTEL GI A E 
Sbjct: 254 VT-GPVGFRYWRNPGAWGP--GIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR++VPRAIK  ++RI+ FY+ ++  +GL V YNDP L Q           P+++AI+
Sbjct: 311 ANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS---PFIIAIE 367

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G  VLPHIFNA +LT + SA NS++YVGSR L+GL+ +K APK  ++T   GVPY ++
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAV 427

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +   F  LAYM  S+  + +F + +N+T + G  +W+ I I++I F +A + +GI ++ 
Sbjct: 428 FVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A   P  A+ A  F  ++ +++ FT F    F+  +F   YI I +++  ++ ++ 
Sbjct: 488 LPFKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQC 546

Query: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
           + + ++I K  +VD+ + +  I+    E+ E K
Sbjct: 547 IFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPK 579

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  325 bits (832), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/542 (34%), Positives = 293/542 (54%), Gaps = 28/542 (5%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           D K +G +L++ L ARH+ +                      GP  + I+Y I+  V++ 
Sbjct: 49  DAKLEG-KLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYP 107

Query: 110 VMSCLGEMAAYIPLDGFTSYAT------RYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
           +M+  GEM  Y+P +G  S  +      RY DP+L FA G+ Y + Y++L   + TAA+ 
Sbjct: 108 IMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASG 167

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 223
           V++YW     V    WIT+FL++++ +N+  VK++GE EFW +S K              
Sbjct: 168 VVKYWTD--AVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFIL 225

Query: 224 XXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTELC 281
             GGGP+H+RLGFRYWK+PGGF     A  I GG  G F+   S  +   FA+ LG EL 
Sbjct: 226 FWGGGPNHDRLGFRYWKNPGGF-----AHHITGGNLGNFLDVYSGIIKGAFAFILGPELI 280

Query: 282 GIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXX 340
            + ++ECK+ RRN+ +A K  ++R++ FY+     + + VA NDP L             
Sbjct: 281 ALASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGS 340

Query: 341 XPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNS 400
            P+V+ I+NAGI +LPHI NAC+LT  +SA N+ ++  SRSL  +A + +APKIF K N 
Sbjct: 341 SPFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINR 400

Query: 401 WGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFR 460
           +GVP+ ++    L  CLAY+NVSSS   +F++F N+++I G + W   L+ Y+ F +A +
Sbjct: 401 FGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIK 460

Query: 461 VQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYI 520
             G++ N L Y   FQ    W ++    +V     + VF+   ++   FI  YI +P+++
Sbjct: 461 YNGLE-NRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFV 519

Query: 521 LCFVCYKIVH---KTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQF 577
           + ++ +KI     K  W     +D+ T  T I   EE  ++    L EER +    + +F
Sbjct: 520 VLWIGHKIYTRDFKKWWYPVEEIDVVTGLTEI---EERTRI----LDEERVEPKGAFPKF 572

Query: 578 YD 579
            D
Sbjct: 573 MD 574

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/513 (34%), Positives = 293/513 (57%), Gaps = 14/513 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G+ +   +K++L+ RH+ M                     AGP+  LIAY  MG + F+
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFS 135

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
               KV    WI++F  +I  +N+  VK++GEFEFW++S K                G G
Sbjct: 196 TH--KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F + GTEL GI A E 
Sbjct: 254 VT-GPVGFRYWRNPGAWGP--GIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR+ VPRAIK  ++RI+ FY+ ++  +GL V YNDP L +           P++VAI+
Sbjct: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS---PFIVAIQ 367

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G  VLPHIFNA +LT + SA NS++YVGSR L+GL+ +K APK  ++T+  GVPY ++
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
               +F  LAYM  S+  + +F + +N+T + G  +W+ I I++I F +A + +GI ++ 
Sbjct: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A   P  A+ +  F +++ +++ FT F    F+  +F+  YI I ++I  ++ ++ 
Sbjct: 488 LPFKAKLMPGLAYYSSFFMIIIIIIQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFEC 546

Query: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
           + + ++I K  +VD+ + +  I+    E+ E K
Sbjct: 547 IFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPK 579

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 286/526 (54%), Gaps = 22/526 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG  +  +LK+ LQ+RHV +                      GP  + I+Y I+  V++ 
Sbjct: 98  DGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 157

Query: 110 VMSCLGEMAAYIPLDGFTSYA------TRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
           +M  LGEM  ++P DG  S        TRY DP+LGFA G+ Y + Y++L   + TAA+ 
Sbjct: 158 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASG 217

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 223
           V++YW     V  GVWIT+FL V++ +N   VK +GE EFW +S K              
Sbjct: 218 VVEYWTT--AVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFIL 275

Query: 224 XXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTELC 281
             GGGP+H+RLGFRYW+ PG F     A  + GG  G F    +  +   FA+ LG EL 
Sbjct: 276 FWGGGPNHDRLGFRYWQHPGAF-----AHHLTGGSLGNFTDIYTGIIKGAFAFILGPELV 330

Query: 282 GIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXX 340
            + +AEC + RRN+ +A +  ++R++ FY+     + + V YNDP L+            
Sbjct: 331 CMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGS 390

Query: 341 XPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNS 400
            P+V+ I+NAGI VLPHI N C+LT  +SA N+ ++  +RSL  +A   +APK   + N 
Sbjct: 391 SPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINK 450

Query: 401 WGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFR 460
           WGVPY ++ +  L  CLAY+NVSSS   +F++F N+++I G L W+   I Y+ F +A  
Sbjct: 451 WGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIF 510

Query: 461 VQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYI 520
             G+  + L ++   QP T W +L    ++ +   + +F+   +    FI  YI +P+++
Sbjct: 511 YNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFL 569

Query: 521 LCFVCYKIVHKT---KWIKSANVDLFTYKTAIDLEEEEGKLEMMRL 563
           + +  +K+  +T    W+  + +D+ T    +++EE+  ++E MRL
Sbjct: 570 VLWFGHKLYTRTWRQWWLPVSEIDVTT--GLVEIEEKSREIEEMRL 613

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  324 bits (831), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/513 (34%), Positives = 291/513 (56%), Gaps = 14/513 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G+ +   +K++L+ RH+ M                     AGP+  LI+Y  MG + ++
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT ++ R+  PA G A GY Y F + V    +L+    V+Q+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI++F  +I  +N+  VK++GEFEFW++S K                G G
Sbjct: 196 TY--AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +GFRYW++PG + P  G +S    + +F+ + S  + A F + GTEL GI A E 
Sbjct: 254 VT-GPVGFRYWRNPGAWGP--GIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEA 310

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR+ VPRAIK  ++RI+ FY+ ++  +GL V YNDP L             P+++AI+
Sbjct: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS---PFIIAIE 367

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G  VLPHIFNA +LT + SA NS++YVGSR L+GL+  K APK F+KT   GVPY ++
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
              ++F  LAYM  S+    +F++ +N+T + G  +W+ I +++I F +A + +GI ++ 
Sbjct: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A   P  A+ A  F +++ L++ FT F   TF+   F+  YI + +++  ++ +++
Sbjct: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFEL 546

Query: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
           + + +++ K  +VD+ + +  I+    EE E K
Sbjct: 547 IFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPK 579

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  323 bits (829), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/513 (34%), Positives = 286/513 (55%), Gaps = 12/513 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G      +K+ L+ RHVSM                     AGP+  LIA+ ++G + ++
Sbjct: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT ++ R+  PA+G A GY Y F + +    +L+    ++QYW
Sbjct: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI +F  ++++ N+  VK++GEFEFW++S K                G G
Sbjct: 185 TD--AVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P    +GFRYW+ PG +   +G ++    K +F+ + S  + A F Y GTEL GI A E 
Sbjct: 243 P-EGPIGFRYWRKPGPWG--NGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGET 299

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
           KNPR+ VPRAI    +RI++FY+ ++F +GL V YNDP L +           P+++AI 
Sbjct: 300 KNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAIL 358

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N   PVLPHIFNA +LT + SA NS++YVGSR L+GL+ +  APK F+KT   GVP+ ++
Sbjct: 359 NCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAV 418

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +  +F  LAY+NVS+ A+ +F + +N+T+I G ++W+ I I++I F +  + +GI ++ 
Sbjct: 419 LITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDD 478

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L Y+A F P  A+ A  F  ++ +++ FT F    F+   F   YI + ++ + +  ++ 
Sbjct: 479 LPYKAKFMPYAAYYAAFFITVIIIIQGFTAF-APHFNVSDFFAAYISVFLFFIVWAIFQT 537

Query: 529 VHKTKWIKSAN----VDLFTYKTAIDLEEEEGK 557
           +++TK  ++ +             I  EEEE K
Sbjct: 538 IYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPK 570

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/496 (35%), Positives = 277/496 (55%), Gaps = 10/496 (2%)

Query: 45  VDWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMG 104
           +D+  +G  +   +K+ L+ RH+SM                     AGP+  LIAY  MG
Sbjct: 69  IDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMG 128

Query: 105 WVVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
            + + V   LGEMA +IP+   FT +  R+  PA G A GY Y F + +    +L+    
Sbjct: 129 TIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQ 188

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 223
           ++Q+W     V  G WI +F  ++ T N+  VK++GE EFW++  K              
Sbjct: 189 IIQFWTF--AVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM 246

Query: 224 XXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGI 283
             G G +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI
Sbjct: 247 VCGAGKT-GPVGFRYWRNPGPWGP--GIISKDVNEGRFLGWVSSLINAAFTYQGTELVGI 303

Query: 284 VAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPY 343
            A E KNPRR VPRAI    +RI+ FY+ ++  +GL V +NDP L             P+
Sbjct: 304 TAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPF 360

Query: 344 VVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGV 403
           V+AI+N+G  VLPHIFNA +L+ + SA NS++YVGSR LYGLA +K APK+FA+    GV
Sbjct: 361 VIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGV 420

Query: 404 PYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQG 463
           PY S+     F  LAY+N+S+SA+ +F + +N+T+I G  +W+ I + +I F +  + + 
Sbjct: 421 PYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRN 480

Query: 464 IDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCF 523
           + +N L ++A F P  A+ +  F  ++ +++ FT F    F+   F   YI + +++  +
Sbjct: 481 MSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAF-APKFNVSNFFAAYISVFLFLAIW 539

Query: 524 VCYKIVHKTKWIKSAN 539
           V ++I  +T++I + N
Sbjct: 540 VVFQIRFRTRFILTKN 555

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  322 bits (826), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/542 (34%), Positives = 292/542 (53%), Gaps = 25/542 (4%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
           K +   LK+ LQ+RH+ +                      GP  +L +Y I+  V++ VM
Sbjct: 43  KREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVM 102

Query: 112 SCLGEMAAYIPLDGFTS------YATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVM 165
           + LGEM  Y+P  G  S        +RYADP+LGFA G+ Y + Y++L   + TAA+ V+
Sbjct: 103 NALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVV 162

Query: 166 QYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 225
            YW     V    WIT+FL V+  +N   VKF+GE EFW +  K                
Sbjct: 163 TYWTT--VVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFW 220

Query: 226 GGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIV 284
           GGGPSH+RLGFRYW+ PG F  +       G  G+F+   +  +   FA+ LG EL  + 
Sbjct: 221 GGGPSHDRLGFRYWQKPGAFAYHI----TTGNTGRFLDVWTGVIKGGFAFILGPELVAVT 276

Query: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXX-XXXXPY 343
           ++E  + RRN+ +A +   YR++ FY+ +   +G+ VA NDP+L              P+
Sbjct: 277 SSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPF 336

Query: 344 VVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGV 403
           V+AI+NA I +LPHI NAC+L+  +S+ NS ++  SRSL  +A D  APK+F K N  GV
Sbjct: 337 VIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGV 396

Query: 404 PYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQG 463
           PYN++A+   F CLAY+NVSS +   F++F N+++I G + WI I + Y+ F +A   +G
Sbjct: 397 PYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRG 456

Query: 464 IDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCF 523
           +  + + +++PFQP   +  +    ++ L   +  F+   +    F+  YI +PV+++ +
Sbjct: 457 L-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLW 515

Query: 524 VCYKIVHKT--KW-IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           V +KI  +T   W I  A VD+ T     ++EE   +L+ +R+          W++F D+
Sbjct: 516 VGHKIYTRTLSTWVIPVAEVDVTT--GLAEIEELTKELDALRVPPNS-----AWEKFMDW 568

Query: 581 IF 582
           + 
Sbjct: 569 LL 570

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  321 bits (822), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/544 (34%), Positives = 286/544 (52%), Gaps = 36/544 (6%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+ L++RHV +                      GP  + IAY I+  V++ +M+ +GEM
Sbjct: 75  LKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEM 134

Query: 118 AAYIPLDGFTSYAT------RYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
             Y+P DG  S  +      RY D +L FA G+ Y + Y++L   + TAAA V++YW   
Sbjct: 135 VCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTL- 193

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
             V    WIT+FLA+I  +N+  VK+FGE EFW +S K                GGGPSH
Sbjct: 194 -AVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSH 252

Query: 232 NRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKN 290
           +RLGFRYWK+PG F  +       G  G F+   S  +   FA+ LG EL  + ++EC +
Sbjct: 253 DRLGFRYWKNPGAFAHHV----TDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSD 308

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXXXPYVVAIKN 349
            RRN+ +A K  +YR++ FY+     +G+ VA+NDP+L              P+V+ I+N
Sbjct: 309 QRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQN 368

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           AGI VLPHI NAC+LT  +S+ N+ ++  SRSL+ +A +  APKIF + N +GVPY ++ 
Sbjct: 369 AGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVI 428

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           L TL  CLAY+N SSSA  +F++  N+++I G L WI   I Y+ F +A     I  N L
Sbjct: 429 LSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKA-----IFYNNL 483

Query: 470 SYQAPF----QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVC 525
             + PF    QP     +L    ++ +   +  F+   ++   FI  YI +P+++  +V 
Sbjct: 484 YDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVG 543

Query: 526 YKIVHKTKWIKSANVDLFTYKTAIDLEE-------EEGKLEMMRLKEERKQHGWTWKQFY 578
           +K+ +  K       D    K A  +E+       +E + +   L E R      W++F 
Sbjct: 544 HKVYNHFK------NDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWERFI 597

Query: 579 DYIF 582
           D++ 
Sbjct: 598 DWLL 601

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/526 (34%), Positives = 287/526 (54%), Gaps = 22/526 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G ++  +LK+ LQ+RHV +                      GP  + I+Y I+  V++ 
Sbjct: 102 EGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 161

Query: 110 VMSCLGEMAAYIPLDGFTSYA------TRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
           +M  LGEM  ++P DG  S        TRY D +LGFA G+ Y + Y++L   + TAA+ 
Sbjct: 162 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASG 221

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 223
           V++YW     V  GVWIT+FL V++ +N+  VK +GE EFW +S K              
Sbjct: 222 VVEYWTT--AVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFIL 279

Query: 224 XXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTELC 281
             GGGP+H+RLGFRYW+ PG F     A  + GG  G F    +  +   FA+ LG EL 
Sbjct: 280 FWGGGPNHDRLGFRYWQHPGAF-----AHHLTGGSLGNFTDIYTGIIKGAFAFILGPELV 334

Query: 282 GIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXX 340
            + +AEC + RRN+ +A +  ++R++ FY+     + + V YNDP L+            
Sbjct: 335 CMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGS 394

Query: 341 XPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNS 400
            P+V+ I+NAGI VLPHI N C+L+  +SA N+ ++  +RSL  +A   +APK   + N 
Sbjct: 395 SPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINR 454

Query: 401 WGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFR 460
           WGVPY ++ +  L  CLAY+NVSSS   +F++F N+++I G L W+   I Y+ F +A  
Sbjct: 455 WGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIF 514

Query: 461 VQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYI 520
             G+  + L ++   QP T W +L    ++ L   + +F+   +    FI  YI +P+++
Sbjct: 515 YNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFL 573

Query: 521 LCFVCYKIVHKT---KWIKSANVDLFTYKTAIDLEEEEGKLEMMRL 563
           + +  +K+  +T    W+  + +D+ T    I++EE+  ++E MRL
Sbjct: 574 VLWFGHKLYTRTWSQWWLPVSEIDVTT--GLIEIEEKSREIEEMRL 617

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/526 (34%), Positives = 291/526 (55%), Gaps = 22/526 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K+ L+ RH+ M                     AGP+  L+AY  MG VVF+V   LGEM
Sbjct: 66  VKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A +IP+   F+ +A R+  PALG A GY Y   +      +L+    ++Q+W    KV  
Sbjct: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF--KVPL 183

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             WI++F  ++   N+  VKF+GEFEFW++S K                G G +   +GF
Sbjct: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT-GPIGF 242

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW++PG   P  G +S   G+ +F+ + S  + A F Y GTEL GI A E  NPR+ VP
Sbjct: 243 RYWRNPGAMGP--GIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           RAI+  L RI++FY+ ++F +GL+V YNDP L             P+++ I+NAG  VLP
Sbjct: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSS---PFIITIQNAGTRVLP 357

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
           HIFNA +LT + SA NS++YVGSR L+ +A +  APK  AKT   GVPY S+   + F  
Sbjct: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           L+YM +S+     F++ +N+T + G  +W+ I  +++ F +A + +GI ++ L Y+A + 
Sbjct: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI- 535
           P  A+ A+ F +++ L++ FT F    F  + F+  YI + ++++ +  ++I  + + I 
Sbjct: 478 PWLAYYAIFFMVVIILIQGFTSF-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW 536

Query: 536 KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
           K  +VD       ID +  E  +E +  +++  +    W +F+D++
Sbjct: 537 KLEDVD-------IDTDRRE--IESVVWEDDAPKT--LWDKFWDFV 571

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/535 (34%), Positives = 292/535 (54%), Gaps = 21/535 (3%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           D + K   +K++L+ RH+SM                     AGPI  LIAY  MG VVF+
Sbjct: 27  DDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFS 86

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEM  +IP+   FT +A R+  PA G A GY Y F + +    +L+    ++Q+W
Sbjct: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI++   ++   N+  V+ +GE EFW++S K                G G
Sbjct: 147 TM--AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAG 204

Query: 229 PSHNRLGFRYWKDPGGFKPYS-GAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
            +   +GFRYWK+PG   P+  G +S    + +F  + S  + A F + GTEL GI A E
Sbjct: 205 VT-GPVGFRYWKNPG---PWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
            + PR+ VP+AIK  ++RI+VFY+ ++ ++GL V YNDP L             P+++ I
Sbjct: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QSNDSYVSSSPFIITI 317

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +NAG  +LPHIFNA +L  + SA NS++Y+GSR LYGLA +K APK F  T+  GVPY +
Sbjct: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +   ++F  LAYM  ++  +  F++ +N+  + G  +W+ I  ++I F +A + +GI +N
Sbjct: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK 527
            L Y+A   P  A+ A+ F +++ +++ FT F    F    F   YI + ++I+ +V ++
Sbjct: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQ 496

Query: 528 IVHKTKWI-KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
           I  K + + K  +VDL T +   D+EEE    ++     E K   W W +F++Y+
Sbjct: 497 IWFKCRLVWKLQDVDLDTDRR--DIEEEVWSDDV-----EDKNKNW-WDRFWNYV 543

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  320 bits (820), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/525 (34%), Positives = 281/525 (53%), Gaps = 20/525 (3%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG     RLK+ LQ+RHV +                      GP  + I+Y I+  V++ 
Sbjct: 154 DGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 213

Query: 110 VMSCLGEMAAYIPLDGFTSYA------TRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
           +M  LGEM  ++P DG  S        TRY D +LGFA G+ Y + Y++L   + TAA+ 
Sbjct: 214 IMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASG 273

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 223
           V++YW     V  GVWIT+FL V++ +N   VK +GE EFW +S K              
Sbjct: 274 VVEYWTT--AVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFIL 331

Query: 224 XXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCG 282
             GGGP H+RLGFRYW+ PG F  +       G  G F    +  +   FA+ LG EL  
Sbjct: 332 FWGGGPKHDRLGFRYWQHPGSFAHHLAG----GSLGNFTDIYTGIIKGAFAFILGPELVC 387

Query: 283 IVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XX 341
           + +AEC + RRN+ +A +  ++R++ FY+     + + V YNDP L+             
Sbjct: 388 MTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSS 447

Query: 342 PYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSW 401
           PYV+ I+NAGI VLPHI N C+LT  +SA N+ ++  +RSL  +A   +APK   K N +
Sbjct: 448 PYVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRF 507

Query: 402 GVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRV 461
           GVPY ++ +  L  CLAY+NVSSS   +F++F N+++I G L WI   I Y+ F +A   
Sbjct: 508 GVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFF 567

Query: 462 QGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYIL 521
            G+  + L ++   QP T W +L    ++ +   + +F+   ++   FI  YI +P++++
Sbjct: 568 NGL-YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLV 626

Query: 522 CFVCYKIVHKT---KWIKSANVDLFTYKTAIDLEEEEGKLEMMRL 563
            ++ +K+  +T    W   + +D+ T    +++EE+   +E +RL
Sbjct: 627 LWLGHKLYTRTWNHWWHSVSEIDVTT--GLVEIEEKSRDIEELRL 669

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/530 (34%), Positives = 283/530 (53%), Gaps = 30/530 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L+K L +RH+ +                      GP+ + +++ I+ ++V+ VM+ L E
Sbjct: 45  NLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAE 104

Query: 117 MAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           M  Y+P  G      +RY DP+LGFA G+ Y + Y +L   +L+AAA V+QYW    KV+
Sbjct: 105 MICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTD--KVH 162

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
             VWIT+FL +++ +N   VKF+GE EFW +S K                GG PSH+RLG
Sbjct: 163 VAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLG 222

Query: 236 FRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTELCGIVAAECKNPRR 293
           FRYW +PG F     A  I GG  G+F+   +  + + FA+ L  EL G+   E K+ RR
Sbjct: 223 FRYWNNPGPF-----AYHITGGNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRR 277

Query: 294 NVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXX-XXXXPYVVAIKNAGI 352
           N+ +A +  ++RI+ FY+ +   +G  ++ +DP L+Q            P+V  I NAGI
Sbjct: 278 NIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGI 337

Query: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412
           PVL HI NA +L+  +S+ NS +Y  SRS+  LA    APK+F + N  GVPYN++AL T
Sbjct: 338 PVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALST 397

Query: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472
              CL Y+N SSS+  +F++  N+ +I G + W  I ITY+ F +A     I  N L  +
Sbjct: 398 AVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKA-----IFYNNLYER 452

Query: 473 APF----QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
            PF    QP   +  + F +++ L   +  F+   ++   F+  YI +P++ L ++ +KI
Sbjct: 453 VPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKI 512

Query: 529 VHKTKW-IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQF 577
             KT+W I    +D+    T +   EEE K+   R  +        W++F
Sbjct: 513 WFKTRWYIPFREIDVI---TGLADAEEEAKMTQPRTPKN------MWEKF 553

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  315 bits (808), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/529 (33%), Positives = 286/529 (54%), Gaps = 28/529 (5%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           D       LKK L++RH+ +                      GP  +  +Y I+  +++ 
Sbjct: 43  DAPQGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYP 102

Query: 110 VMSCLGEMAAYIPLDGFT------SYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
           VM+ LGEM  Y+P DG +         TRY DP+LGFA G+ Y + Y++L   + TAA+ 
Sbjct: 103 VMNALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASG 162

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 223
           V+QYW     V  G WIT+FL V++ +N   VKF+GE EFW +S K              
Sbjct: 163 VVQYWTT--AVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFIL 220

Query: 224 XXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCG 282
             GGGP H+RLGFRYW+ PG F  +  +    G  G+F+   +  +   FA+ LG EL  
Sbjct: 221 FWGGGPHHDRLGFRYWQKPGAFAYHITS----GNTGRFLDIWTGVIKGGFAFILGPELVA 276

Query: 283 IVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXXX 341
           + +AE ++ RRN+ +A +  +YR++ FY+ +   +G  VAYND  L              
Sbjct: 277 LTSAEAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSS 336

Query: 342 PYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSW 401
           P+V+ I+NAGI VLPHI N C+L+  +S+ NS ++  SRSL  ++ +  APKI  + N +
Sbjct: 337 PFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRF 396

Query: 402 GVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRV 461
           GVPY ++AL +L  C+AY+NVSSS   +F++F N+++I G + WI I I Y+ F +A   
Sbjct: 397 GVPYAAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFF 456

Query: 462 QGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYIL 521
           Q + +  + ++ PFQP   W  +    ++ L   + +F+   ++   FI  Y+ +P++++
Sbjct: 457 QNLYER-VPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLV 515

Query: 522 CFVCYKIVHKTKWIKSANVDLFTYKT-AIDLEEEEGKLEMMRLKEERKQ 569
            ++ +K+     W +       T+KT AI + E +    +  ++EE K+
Sbjct: 516 LWIGHKL-----WTR-------TWKTWAIPVPEIDVTTGLKEIEEESKE 552

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  315 bits (808), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 182/534 (34%), Positives = 285/534 (53%), Gaps = 23/534 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LK+ L++RHV +                      GP  +  +Y I+   ++ +M+  GE
Sbjct: 69  KLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGE 128

Query: 117 MAAYIPLDGFTSYAT------RYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
           M  Y+P +G  S  +      +Y D +LGFA  + Y + +++L   + TAAA V++YW  
Sbjct: 129 MVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAW 188

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
             KV  G WIT+FL  ++ +N++ V F+GE EFW +S K                GGGPS
Sbjct: 189 ALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGGGPS 248

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECK 289
           H+RLGFRYW+ PG F  +       G  G F+   +  +   FA+ LG EL  + ++EC 
Sbjct: 249 HDRLGFRYWQRPGAFADHI----TDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSECH 304

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXXXPYVVAIK 348
           + RRN+ +A +  ++R+++FY+     + + VAYNDP L              P+V+ I+
Sbjct: 305 DQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQ 364

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           NAGI VLPHI N C++T  +SA N+ ++  SRSL  +A    APK F+K N +GVPY ++
Sbjct: 365 NAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVAV 424

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
               LFCCLAY+NVSSS   +F++F N+++I G + WI   + YI F +A     +  + 
Sbjct: 425 GFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YDR 483

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L Y+   Q    W +L    ++ L   + +F+   +DYK FI  YI +PV+I+ ++ +K+
Sbjct: 484 LPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKL 543

Query: 529 VHKT--KW-IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYD 579
           V ++  +W I    +D+FT      LEE E       L E+R      W +F D
Sbjct: 544 VTRSWRQWYIPVDKIDVFT-----GLEEIEELTN--ELDEKRVPPNNAWDKFLD 590

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  315 bits (806), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 179/533 (33%), Positives = 289/533 (54%), Gaps = 20/533 (3%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G+     +K+ L+ RH+ M                     AGP+  LIAY  M  +V++
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V+  LGEMA +IP+   FT +++R+  PA G A GY Y F + +    +L+    ++++W
Sbjct: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WIT+F  ++   N+  VK++GEFEFW++  K                G G
Sbjct: 189 TT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E 
Sbjct: 247 IT-GPVGFRYWRNPGAWGP--GIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR++VPRAIK  ++RI+VFY      +GL V YNDP L             P+++AI+
Sbjct: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIE 360

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G  VLPHIFNA VLT + SA NS++YVGSR +YGLA  K AP  F +TN+ GVPY ++
Sbjct: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
              + F  LAYM +S+   + F++ +N+T + G  +W+ I   +I F +A + +GI ++ 
Sbjct: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A F P  A+ AL F +++ L++ FT F   TF    F   Y+ + ++I  ++  +I
Sbjct: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQI 539

Query: 529 VHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
             + +        +F     +D++ +   +E +   +E  +    W +F++ +
Sbjct: 540 WFRCR--------IFHRLDEVDIDTDRRDIEAVVWDDEPPKT--LWDKFWNIV 582

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  313 bits (802), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 173/478 (36%), Positives = 266/478 (55%), Gaps = 11/478 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++K++L+ RH+ M                     AGP+  LIAY  MG +VF+V   LGE
Sbjct: 101 QVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           MA +IP+   FT +A+R+     G A GY Y F + +    +L+    V+++W    KV 
Sbjct: 161 MATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF--KVP 218

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              WI++F  +I+ +N   VK +GEFEFW++S K                G G +   +G
Sbjct: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPVG 277

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           FRYW+ PG + P  G +S    + +F+ + S  + A F Y GTEL GI A E  NPR++V
Sbjct: 278 FRYWRHPGPWGP--GIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           PRAIK    RI++FY+ ++F +GL V YNDP L             P+++AI+N+G  VL
Sbjct: 336 PRAIKKVSVRILLFYILSLFFIGLLVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVL 392

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHIFNA +LT + SA NS++YVGSR LYGL+  K APK F KT + GVP+ ++     F 
Sbjct: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAFG 451

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LAYM  S+  +  F++ +N+T + G  +W+SI I++I F +  + +G+ ++ L Y+A  
Sbjct: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
            P  A+    F  ++ L++ FT F    FD   F+T YI   +++  ++  +   +T+
Sbjct: 512 MPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  314 bits (804), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 287/526 (54%), Gaps = 22/526 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG ++  +LK+ LQ+RHV +                      GP  + I+Y I+  V++ 
Sbjct: 97  DGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYP 156

Query: 110 VMSCLGEMAAYIPLDGFTSYA------TRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
           +M  LGEM  ++P DG  S        TRY D +LGFA G+ Y + Y++L   + TAA+ 
Sbjct: 157 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASG 216

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 223
           V++YW     V  GVWITVFL V++ +N   VK +GE EFW +S K              
Sbjct: 217 VVEYWTT--AVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFIL 274

Query: 224 XXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTELC 281
             GGGP H+RLGFRYW+ PG F     A  + GG  G F    +  +   FA+ LG EL 
Sbjct: 275 FWGGGPKHDRLGFRYWQHPGAF-----AHHLTGGSLGNFTDIYTGIIKGAFAFILGPELV 329

Query: 282 GIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXX 340
            + +AEC + RRN+ +A +  ++R++ FY+     + + V YNDP+L+            
Sbjct: 330 CMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGS 389

Query: 341 XPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNS 400
            P+V+ I+NAGI VLPHI N C+LT  +SA N+ ++  +RSL  +A   +APK   K N 
Sbjct: 390 SPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINR 449

Query: 401 WGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFR 460
           WGVPY ++A   L  CLAY+NVSSS   +F++F N+++I G L WI   I Y+ F +A  
Sbjct: 450 WGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIF 509

Query: 461 VQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYI 520
             G+  + L ++   QP T W +L    ++ +   + +F+   +    FI  Y+ +P+++
Sbjct: 510 YNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFL 568

Query: 521 LCFVCYKIVHKT---KWIKSANVDLFTYKTAIDLEEEEGKLEMMRL 563
           + ++ +K+  +T    W+  + +D+   +  +++EE+  ++E +RL
Sbjct: 569 VLWLGHKLYTRTWHQWWLPVSEIDV--TRGLVEIEEKSREIEELRL 612

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  313 bits (801), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/515 (34%), Positives = 280/515 (54%), Gaps = 22/515 (4%)

Query: 55  GIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCL 114
           G  LK+ L++RHV +                      GP  + I+Y I+  V++ +M  +
Sbjct: 72  GHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGI 131

Query: 115 GEMAAYIP-----LDGFTSY-ATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           GEM  Y+P      +GF +Y   +Y D +LGFA  + Y + Y++L   + TAA+ V++YW
Sbjct: 132 GEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYW 191

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WIT+FLA ++ +N   VKF+GE EFW +S K                GGG
Sbjct: 192 TT--SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGG 249

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTELCGIVAA 286
           P+H+RLGFRYW++PGGF     A  I GG  G F+   +  +   FA+ LG E+  + ++
Sbjct: 250 PNHDRLGFRYWQNPGGF-----AHHIRGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSS 304

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXXXPYVV 345
           E ++ RRN+ +A +  ++R++ FY+     + + VAYNDP L              P+V+
Sbjct: 305 EVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVI 364

Query: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405
            I+NAGI VLPHI NAC+L+  +SA N+ ++  SRSL  +A + +AP+IFAK N WGVPY
Sbjct: 365 GIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPY 424

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
            ++ L +   CLAY+N SSS   +F++F N++ I G + WI + I YI F +A    G+ 
Sbjct: 425 YAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM- 483

Query: 466 KNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVC 525
           ++ L Y A   P   +  L    ++ L   + VF+   +D K F+  YI +PV+ + ++ 
Sbjct: 484 QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIG 543

Query: 526 YKIVHKT----KWIKS-ANVDLFTYKTAIDLEEEE 555
           +++  +     KW KS   +D+ T    I+ +  E
Sbjct: 544 HRVYRRKIFTLKWWKSIEEIDVVTGVEEIEEKTRE 578

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  311 bits (798), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 174/513 (33%), Positives = 280/513 (54%), Gaps = 13/513 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G +    +K+ L+ARH+SM                     AGP+  LIAY  MG VV++
Sbjct: 52  EGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYS 111

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           +   LGEMA +IP+    T ++ R+  PA G A GY Y F + +    +L+    ++ YW
Sbjct: 112 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYW 171

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V  G WIT+F  ++  +N   V+F+GE EFW++S K                GG 
Sbjct: 172 TS--VVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS 229

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            S   +GFR W++PG +   +G +S    + +F+ + S  + A F Y GTEL GI A E 
Sbjct: 230 -SQGPIGFRNWRNPGPWG--TGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGES 286

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
           KNPR+ VP+AI    +RI+ FY+ ++F +GL V YNDP +             P+V++I+
Sbjct: 287 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRM--DNTSDTDVNASPFVISIR 344

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           NAG  +LP IFNA VL  V SA NS++Y+GSR +Y LA    APK F   N  GVP   +
Sbjct: 345 NAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGV 404

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +  L   +A++ V+++A+  F++ VN++++ GL +W+ I + +I F +  + +GI ++ 
Sbjct: 405 MVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDA 464

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A F P  A+ A  F  ++  ++ +T F    FD   F T YI + + ++ F+  +I
Sbjct: 465 LPFKAKFMPWAAYYAASFVFVIIFIQGYTAF-SPKFDVTQFFTAYISLMLMLVVFIGCQI 523

Query: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
            +K +++ K  ++D+ T +  ID    E++E K
Sbjct: 524 YYKCRFLWKLEDIDIDTNRREIDAIVWEDDEPK 556

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  309 bits (792), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/525 (32%), Positives = 277/525 (52%), Gaps = 22/525 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L K LQ+RH+ +                      G   +L+++ ++  +V+ +M  L EM
Sbjct: 46  LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM 105

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
             Y+P  G      +RY DP+LGFA G+ Y + Y +L   +L+AAA V+ YW     V  
Sbjct: 106 ICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW--DNPVPM 163

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             WIT+FL V++ +N   VK++GE EFW +S K                GG P+H+R GF
Sbjct: 164 AAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGF 223

Query: 237 RYWKDPGGFKPYSGAVSI-PGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKNPRRN 294
           RYWK+PG F     A+S+ PG  G+F+      + + FA+ L  EL GI   E ++ RRN
Sbjct: 224 RYWKNPGPF-----AMSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRN 278

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXX-XXXXPYVVAIKNAGIP 353
             +A +  +YRI+ FY+    ++G+ ++  DP L++            P+V  I NAGIP
Sbjct: 279 TEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIP 338

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
           VL H+ N  +L+  +SA NS +Y  +R +  LA +  APK   K N +GVPYN++ +CTL
Sbjct: 339 VLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTL 398

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
             CLAY+NV +++  +F +  N+ +I G + W ++ I +I F R      + ++ + YQ 
Sbjct: 399 VACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRIPYQG 457

Query: 474 PFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
           P QP  A+      ++V L   F VFL   ++   F+  Y+ +P+Y++ ++ +K+  +T+
Sbjct: 458 PLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTR 517

Query: 534 W-IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQF 577
           W I    +D+    T +   EEE K+   R+ +        W++F
Sbjct: 518 WYIPVEQIDVI---TGLVEAEEESKMTPPRIPKN------LWEKF 553

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  310 bits (795), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 167/523 (31%), Positives = 285/523 (54%), Gaps = 20/523 (3%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
           KH+ +  K+ L+ RH++M                     AGP+  LIAY  +G ++F+V 
Sbjct: 89  KHRSV--KRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVT 146

Query: 112 SCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
             LGEM  +IP+   FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W  
Sbjct: 147 QSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTT 206

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
              V    WI +F  ++   N+  VK++GE EFW++  K                G GP 
Sbjct: 207 --AVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGP- 263

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
           H   GFRYW+DPG + P  G ++    + +F+ + S  + A F Y GTEL GI A E  N
Sbjct: 264 HGPFGFRYWRDPGAWGP--GIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 321

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR+ VP+AIK  + RI+ FY+ ++F +G+ V +NDP L             P+++AI+N+
Sbjct: 322 PRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSS---PFIIAIQNS 378

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           G+ +LP IFN  +L  + SA NS++YVGSR L+GLA    AP+ F +T   GVP+ ++  
Sbjct: 379 GVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLF 438

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
            +LF  LA++ +++  + +F++ +++ +I G  +W+ I +++I F +A   +GI +N+L 
Sbjct: 439 TSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLP 498

Query: 471 YQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
           ++A F P  A+ A  F +++ L++ FT F    F+   F+  YI + ++++ +  ++ + 
Sbjct: 499 FKAIFMPWLAYYATAFIILIILIQGFTAF-APRFNVSDFVASYISLLLFVIIWGVFQAMK 557

Query: 531 KTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWT 573
           K +        +F     IDL+ +   +E +R +++  +  WT
Sbjct: 558 KCR--------IFWKVEDIDLDSDRKDIEDIRWEDDSPKTFWT 592

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  308 bits (789), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 175/532 (32%), Positives = 286/532 (53%), Gaps = 20/532 (3%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
           G  K  ++K+ L+ RH+SM                     AGP+  LIAY  +G + ++V
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94

Query: 111 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
              LGEMA +IP+   FT +  R+  PALG A GY Y   + +    +L+    ++Q+W 
Sbjct: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
               V    WI +F  ++   N+  VK++GE EFW++  K                G G 
Sbjct: 155 D--AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  
Sbjct: 213 T-GPVGFRYWRNPGPWGP--GIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR+ VPRAI    +RI+ FY+ ++  +GL V +NDP L             P+V+AI+N
Sbjct: 270 NPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIEN 326

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           +G  VLPHIFNA +L+ + SA NS++YVGSR  Y +A++  APK    T   G+PY ++ 
Sbjct: 327 SGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVL 386

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
             ++   LAY+  SS A  +F++ +N+T++ G  +WI I I++I F +A + QGI ++ L
Sbjct: 387 TTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDL 446

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            ++A F P  A+ A  F  ++ +++ FT F    F    F T YI + ++ + ++ ++I 
Sbjct: 447 PFKAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFKVSDFFTAYISVMLFFVFWIGFQI- 504

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
               W +     LF     IDL+ +  +++ +  +E++ ++   W++F+  I
Sbjct: 505 ----WFRG---PLFIKTEDIDLDTDRREIDDVVWEEQKPRN--LWEKFWAAI 547

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  308 bits (790), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 176/506 (34%), Positives = 281/506 (55%), Gaps = 14/506 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            +K++L+ RH+ M                    QAGP+  LI+Y  MG +V++V   LGE
Sbjct: 72  EVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGE 131

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           MA +IP+   FT +A R+  P++G A GY Y F + V    +L+    V+QYW     V 
Sbjct: 132 MATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTY--AVP 189

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              WI++F  VI   N+  VK++GE EFW++  K                G G +   +G
Sbjct: 190 LAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVT-GPVG 248

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           FRYW++PG + P  G +S    + +F+ + S  +   F Y GTEL GI A E  NPR+ V
Sbjct: 249 FRYWRNPGPWGP--GIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAV 306

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           PRAIK  ++RI+ FY+ ++F +GL V YND  L             P+++AIKN+G PVL
Sbjct: 307 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDDAL---NNTDSYVASSPFIIAIKNSGTPVL 363

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHIFNA +   + SA NS++YVGSR L+GL+ +K APKI ++T   GVP+ ++ + ++  
Sbjct: 364 PHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVG 423

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LAYM  S+  +  F++ +N+T++ G  +W+ I +++I F +A + +GI ++ L ++A  
Sbjct: 424 ALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAAL 483

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  A+ A     ++ +++ FT F    F    F   YI I ++I  +  ++I+ + ++I
Sbjct: 484 MPGLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFI 542

Query: 536 -KSANVDLFTYKTAIDL---EEEEGK 557
            K  +VD+ T +  I+    E+ E K
Sbjct: 543 HKVEDVDIDTDRRDIEAVVWEDAEPK 568

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  309 bits (792), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 176/534 (32%), Positives = 288/534 (53%), Gaps = 22/534 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           + +++  R+K+ L+ RH+ M                     AGP+  LIAY  MG VV+ 
Sbjct: 96  EAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYF 155

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+    T ++ R+  PA G A GY Y F + +    +++    V+QYW
Sbjct: 156 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 215

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI +F  ++  +N   VK +GEFEFW++S K                GG 
Sbjct: 216 TK--AVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGG- 272

Query: 229 PSHN-RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
            SH   +GFRYW++PG + P  G +S   G+ +F+ + S  + A F Y GTEL GI A E
Sbjct: 273 -SHQGPIGFRYWRNPGPWGP--GIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGE 329

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR++VPRAI   ++RI +FY+ ++F +GL V +ND  L             P+V++I
Sbjct: 330 AANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASS---PFVISI 386

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +NAG   LP IFNA VL  + SA NS++YVGSR LY LA+   APKIF+    +GVPY  
Sbjct: 387 QNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMG 446

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +        LA++ V+++A T F++ +N++++ GL +W+ I +++I F +A + +GI ++
Sbjct: 447 VICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRD 506

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK 527
            L ++A   P  A+ A  F  ++  ++ F  F    FD  TF T YI + +  + F   +
Sbjct: 507 DLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFT-PKFDVSTFFTSYISLILLAVLFSGCQ 565

Query: 528 IVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
           + ++ ++I             ID++ +  ++E +  +E+  ++   W++F+ ++
Sbjct: 566 LYYRCRFIWKVE--------DIDIDSDRREIEAIIWEEDEPKN--LWEKFWAWV 609

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  307 bits (787), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 179/519 (34%), Positives = 279/519 (53%), Gaps = 22/519 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           R+K+ L+ RH+ M                     +GP+  LIAY  MG +++ V   LGE
Sbjct: 90  RVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGE 149

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           MA +IP+    T ++ R+  PA G A GY Y F + +    +++    V+QYW    KV 
Sbjct: 150 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTF--KVP 207

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN-RL 234
              WI +F  +I  +N   VK +GEFEFW++S K                GG  SH   +
Sbjct: 208 LAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGG--SHQGPI 265

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           GFRYW++PG     +G +S   G+ +F+ + S  + A F Y GTEL GI A E  NPR++
Sbjct: 266 GFRYWRNPGAMG--AGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 323

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           VPRAI   ++RIV+FY+ ++F +GL V YNDP L             P+V++I+NAG  V
Sbjct: 324 VPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASS---PFVISIQNAGTKV 380

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           LP IFNA VL  V SA NS++YVGSR LY LA    APK FA     GVPY  +    L 
Sbjct: 381 LPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALL 440

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             LA++ V+ +A T F++ +N++++ GL +W+ I + +I F +A + +GI ++ L ++A 
Sbjct: 441 GLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAK 500

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKW 534
           F P  A+ A  F  ++  ++ F  F    FD   F T YI + + ++ F   ++ ++ + 
Sbjct: 501 FMPWGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCR- 558

Query: 535 IKSANVDLFTYK-TAIDLEEEEGKLEMMRLKEERKQHGW 572
                   F +K   ID++ +  +++ +  +++  Q+ W
Sbjct: 559 --------FLWKLEDIDIDSDRREIDAIVWEDDEPQNLW 589

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  306 bits (785), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 184/528 (34%), Positives = 277/528 (52%), Gaps = 35/528 (6%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LK+ L +RHV                        GP  ++I+Y I+  V++ +M+ LGE
Sbjct: 57  KLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGE 116

Query: 117 MAAYIPLDGFTSYAT------RYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
           M  Y+P +G  S  +      RY D +L FA G+ Y + +++L   + TAA+ V+ YW  
Sbjct: 117 MVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTT 176

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
              V   VWIT+FL ++  +N   VK+FGE EFW +S K                GGGPS
Sbjct: 177 --SVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPS 234

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTELCGIVAAEC 288
           H RLGF YWKDPG F     A  I GG  G F+   +  +   FA+ LG EL  + ++EC
Sbjct: 235 HVRLGFHYWKDPGTF-----AHHITGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSEC 289

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXX-XXXXPYVVAI 347
            + RRN+ +A K  ++R++ FY+     + + VAYNDP+LL             P+V+ I
Sbjct: 290 NDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGI 349

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +NAGI VLPHI NAC+L+  +SA NS ++  SRSL  +A +  APKIF K N +GVPY S
Sbjct: 350 QNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYS 409

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           + L  +  CLA++NVSSS   +F +F N+++I G L WI  +I Y+ F +A     I  N
Sbjct: 410 VGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKA-----IFYN 464

Query: 468 TLSYQAPF----QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCF 523
            +  + PF    QP   W +L    ++ L   +  F+   +    F+  YI +P++++ +
Sbjct: 465 NMYDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILW 524

Query: 524 VCYKIVHKTK--------WIKSANVDLFTYKTAIDLEEEEGKLEMMRL 563
           V +K   + K        +     +D+ T     + EE   KL+M R+
Sbjct: 525 VGHKFWARYKHAVPLLKLYYPVDEIDVIT--GLAEAEEVAEKLDMNRI 570

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  306 bits (785), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 172/537 (32%), Positives = 289/537 (53%), Gaps = 26/537 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L++ L++RH+ M                      GP  + I+Y I+  VV+ +M   GEM
Sbjct: 77  LQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEM 136

Query: 118 AAYIPLDGFTSYAT------RYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
             Y+P +G  +  +      RY D +LGFA  + Y + Y++L   + TAA+ V++YW   
Sbjct: 137 VCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTV- 195

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
             V  GVWI +FL +++ +N   VK++GE EFW +S K                GGGP+H
Sbjct: 196 -AVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNH 254

Query: 232 NRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKN 290
           +RLGFRYW+ PG F  +     + GG G+F+   S  +   FA+ LG EL  + +AEC++
Sbjct: 255 DRLGFRYWQRPGAFTEHI----MKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECED 310

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXXXXPYVVAIKN 349
            RRN+ +A +  ++R++ FY+     + + VAYNDP L+             P+V+ I+N
Sbjct: 311 QRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQN 370

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           AGI VLPHI NAC+L+  +SA N+ ++  +RSL  +A +  AP++F K N +GVPY +++
Sbjct: 371 AGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAIS 430

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           L     CLA++NVSSS   +F++F N+++I G + WI   + YI F +A    G+  + L
Sbjct: 431 LSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRL 489

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            ++   QP   + +L    ++ L   +  F+   +    F+  YI +P++++ +V +K+ 
Sbjct: 490 PFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLW 549

Query: 530 HKT----KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIF 582
            +T     W +   +D+ T    +D+EE    L+  R++   +     W++F D + 
Sbjct: 550 TRTFTKRWWRRVDQIDVTT--GLVDIEERTKILDETRVEPSTR-----WQKFMDAVL 599

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  305 bits (781), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 177/522 (33%), Positives = 284/522 (54%), Gaps = 15/522 (2%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
            KG  +K+ L+ RH+ M                     AGP+  LI+Y  MG V+++V  
Sbjct: 61  RKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 113 CLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
            LGEMA +IP+   F+ +A R+  PALG   GY Y   +      +L+    ++QYW   
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTD- 179

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
             V    WI +F  ++  +N+  VK++GEFEF ++S K                G G S 
Sbjct: 180 -AVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSG 238

Query: 232 NRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNP 291
             +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  NP
Sbjct: 239 GPIGFRYWRNPGAWGP--GIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 296

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAG 351
           RR VPRAIK  + RI+VFY+ ++F +GL V YNDP L             P++++I+N+G
Sbjct: 297 RRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSEGTFVSSSPFMISIENSG 353

Query: 352 IPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALC 411
             VLP IFNA VL  + SA NS++Y+GSR LY L+ +  AP+  +     GVPY ++   
Sbjct: 354 TKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLST 413

Query: 412 TLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSY 471
           + F  LA++  S+ +  +F++ +N+T + G  +W+ I +++I F +A + +GI ++ L Y
Sbjct: 414 SAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPY 473

Query: 472 QAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
           +A   P  A+ A  F  ++ L++ FT F   TF    FI  YI + ++I  ++ +++  K
Sbjct: 474 RARMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFIAAYISVFLFIAIWLLFQVWFK 532

Query: 532 TKWI-KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            +++ K  +VD+ + +   D+EE+   + +    + R QH W
Sbjct: 533 CRFVWKLQDVDIDSDRR--DIEEQ---VWIEPECKTRWQHVW 569

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  303 bits (777), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 179/503 (35%), Positives = 278/503 (55%), Gaps = 13/503 (2%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
           + +GI  ++ L+ RHVSM                     AGP+  LI+Y  MG + F V 
Sbjct: 45  QERGI--QRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVT 102

Query: 112 SCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
             LGEMA +IP+   FT +  R+  PALG A GY Y F + +    +L+    ++QYW  
Sbjct: 103 QSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTL 162

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
              V    WI +F   I   N+V VKF+GEF+FW++  K                G G +
Sbjct: 163 --GVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKT 220

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
              +GFRYW++PG +    G +S    +G+F+ + S  V A F Y GTEL G+ A E  N
Sbjct: 221 -GPVGFRYWRNPGPWG--DGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESAN 277

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR+ VP+AI+    RI++FY+ ++F +GL V +NDP L             P+++AI+N+
Sbjct: 278 PRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKL---DSTANYSASSPFIIAIQNS 334

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           G   LP IFNA +LT + SA NS++YVGSR LYGLA +  APKI  + N  GVPY  + +
Sbjct: 335 GTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGI 394

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
            +LF  L Y++VSS +   F + +N+T+I G  +W+ I + +I F +A + QGI ++ L 
Sbjct: 395 VSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLP 454

Query: 471 YQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
           ++A   P  A+ A  F L++ +++ FT F    F+   F   Y+ + ++I  +V ++++ 
Sbjct: 455 FKAKLMPWGAYYAAFFILLIIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQVIF 513

Query: 531 KTKWI-KSANVDLFTYKTAIDLE 552
           K++ I K  +VD+ + +  I+ E
Sbjct: 514 KSRLIHKVEDVDIDSDRREIEAE 536

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  305 bits (781), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 170/468 (36%), Positives = 263/468 (56%), Gaps = 10/468 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G  K   +K+ L+ RH+ M                     AGP+  LIAY  M  +VF+
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT +++R+  PA+G A GY Y F + V    +L+    ++Q+W
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI ++  ++  +N+  VKF+GEFEFW++S K                G G
Sbjct: 209 TH--AVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAG 266

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E 
Sbjct: 267 VT-GPVGFRYWRNPGPWGP--GIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 323

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR+ VPRAIK   +RI++FY+ ++F +GL V Y+D  L             P+++AI+
Sbjct: 324 ANPRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISAS---PFIIAIE 380

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G  +LPHIFNA +L+ + SA NS++YVGSR L+GLA  K APK F  T+  GVPY S+
Sbjct: 381 NSGTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSV 440

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
              + F  LA++ VSS     F++ +N+ S+ G  +W+ I I ++ F +A + +GI ++ 
Sbjct: 441 FFTSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDD 500

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGI 516
           L ++A F P  A+ ++ F  ++ +++ FT F   TF+   F+  YI I
Sbjct: 501 LPFKARFMPHLAYYSIFFMTIIIIIQGFTAF-APTFNGSDFVAAYISI 547

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  304 bits (778), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 176/512 (34%), Positives = 274/512 (53%), Gaps = 13/512 (2%)

Query: 48  GYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVV 107
           G  G+ +   +K+ L+ RH+ M                     AGP+ +LIAY  M  + 
Sbjct: 64  GEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIA 123

Query: 108 FTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQ 166
           F+VM  LGEMA YIP+   F+ ++ R+  PA G A GY Y F + +    +L+    ++Q
Sbjct: 124 FSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQ 183

Query: 167 YWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
           YW    KV    WI++F  +I  +N   VKF+GEFEFW++  K                G
Sbjct: 184 YWTF--KVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCG 241

Query: 227 GGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286
            G +   +GFRYW+   G+    G +S    + +F+ + S  + A F Y GTEL GI A 
Sbjct: 242 AGKT-GPVGFRYWRH--GYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAG 298

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVA 346
           E  NPR+ VP++IK TL+RI++FY+ ++  +GL V +ND  L             P+++A
Sbjct: 299 EAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASS---PFILA 355

Query: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYN 406
           IKN+G   LP IFNA +LT V SA NSD+YVGSR +Y +A ++ AP I AK +  GVPY 
Sbjct: 356 IKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYA 415

Query: 407 SLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDK 466
           ++   +    LAY+  SSS   +F++ +N+T + G  SW  I  +++ F +A + +GI +
Sbjct: 416 AVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISR 475

Query: 467 NTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCY 526
           N L ++A F P  A  +  F  ++ LV+ FT F    F    F+  YI + ++ + +  +
Sbjct: 476 NDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFT-PHFQASDFVASYISVGLFFVIWAVF 534

Query: 527 KIVHKTK-WIKSANVDLFTYKTAIDLE--EEE 555
           +I  +    +  A +D+ T +  +D E  E+E
Sbjct: 535 QIWFRCPLLVPIAEIDIDTDRRDVDAEVWEDE 566

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  302 bits (774), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 172/512 (33%), Positives = 273/512 (53%), Gaps = 14/512 (2%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
           G  K  ++K+ L+ RH+SM                     AGP+  LIAY  +G + + V
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94

Query: 111 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
              LGEMA +IP+   F  +  R+  PALG A GY Y   + +    +L+    V+Q+W 
Sbjct: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
               V    WI +   V+++ N+  VKF+GE EFW++  K                G G 
Sbjct: 155 D--AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  
Sbjct: 213 T-GPVGFRYWRNPGPWGP--GIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR+ VPRAI    +RI+ FY+ ++  +GL V +NDP L             P+V+AI+N
Sbjct: 270 NPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIEN 326

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           +G  VLPHIFNA +L+ + SA NSD+Y+ SR LY + ++  APK    T   G+PY ++ 
Sbjct: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
             +L   LAY+  S  A  +F + +N+T++ G  +W+ I + +I F +A + QGI ++ L
Sbjct: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDL 446

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            ++A F P  A+ A  F  ++ +++ FT F    F+   F T Y+ + ++   ++ ++I 
Sbjct: 447 PFKAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIW 505

Query: 530 HKTK-WIKSANVDLFTYKTAID---LEEEEGK 557
            +   + K+ ++DL T +  ID    EE+E K
Sbjct: 506 FRGPLFKKTEDIDLDTDRREIDNDVWEEDEPK 537

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  303 bits (775), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 173/527 (32%), Positives = 284/527 (53%), Gaps = 21/527 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            +K+ L+ RH+ M                     AGP+  LI+Y  MG V+++V   LGE
Sbjct: 65  EVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           M  +IP+   F+ +A R+  PALG   GY Y   +      +L+    V+QYW     V 
Sbjct: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTE--AVP 182

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              WI +F  ++ ++N+  VK++GEFEF ++S K                G G S   +G
Sbjct: 183 LAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIG 242

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           FRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  NPR+ +
Sbjct: 243 FRYWRNPGAWGP--GIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAL 300

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           PRAIK  + RI+VFY+ ++F +GL V YNDP L             P++++I+N+G  VL
Sbjct: 301 PRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGTKVL 357

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P IFNA VL  + SA NS++Y+GSR LY L+ +  AP+  +     GVPY S+   ++F 
Sbjct: 358 PDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFG 417

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LA++ VS+ +   F++ +N+T + G  +W+ I  ++I F +A R +GI ++ L Y+A  
Sbjct: 418 FLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQM 477

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  A+ A  F  ++ L++ FT F   TF    F+  YI I +++  ++ +++  K + +
Sbjct: 478 MPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLL 536

Query: 536 -KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
            K  ++D+ + +  I+        E++ ++ E K     W++ +D +
Sbjct: 537 WKLQDIDIDSDRRQIE--------ELVWIEPECKTR---WQRVWDVL 572

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  302 bits (774), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/512 (33%), Positives = 277/512 (54%), Gaps = 13/512 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            +++ L+ RH+ M                     AGP+  LI+Y  MG V+++V   LGE
Sbjct: 65  EVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           MA +IP+   F+ +A R+  PALG   GY Y   +      +L+    ++QYW     V 
Sbjct: 125 MATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTH--AVP 182

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              WI +F  ++  +N+  VK++GEFEF ++S K                G G     +G
Sbjct: 183 LAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIG 242

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           FRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  NPR+ V
Sbjct: 243 FRYWRNPGAWGP--GIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 300

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           PRAIK  + RI+VFY+ ++F +GL V YNDP L             P++++I+N+G  VL
Sbjct: 301 PRAIKKVVIRILVFYILSLFFIGLLVPYNDPKL---DSDGTFVSASPFMISIENSGTKVL 357

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P IFNA VL  +FSA NS++Y+GSR LY L+ +  APK  +     GVPY ++ L +LF 
Sbjct: 358 PDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFG 417

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LA++  S+ +   F++ +N+T + G  +W+ I  ++I F +A + +GI ++ L Y+A  
Sbjct: 418 FLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARM 477

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  A+ A  F  ++ L++ FT F   TF    F+  YI + ++ + ++ +++  K + I
Sbjct: 478 MPFLAYYASFFIALIVLIQGFTAF-APTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLI 536

Query: 536 -KSANVDLFTYKTAIDLE---EEEGKLEMMRL 563
            K  ++D+ + +  I+ +   E E K    R+
Sbjct: 537 CKLQDIDIDSDRREIEEQVWIEPECKTRWQRV 568

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  303 bits (777), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 176/536 (32%), Positives = 283/536 (52%), Gaps = 27/536 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LKK LQ+RH+ +                      GP  +L +Y I+  V++ VM+ LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 118 AAYIPLDG------FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
             ++P          +   TRYADP+LGFA G+ Y + Y++L   + TAA+ V+ YW   
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTT- 223

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
             V  G WI +FL V+  +N   VK +GE EFW +  K                GGGP+H
Sbjct: 224 -AVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 232 NRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKN 290
           +RLGFRYW+ PG F  +       G  G+F+   +  +   FA+ LG EL  I ++E  +
Sbjct: 283 DRLGFRYWQHPGAFAYHI----TTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALD 338

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XXPYVVAIKN 349
            RRN+ +A +   YR+V FY+ +   +G+ V+  DP+L              P+V+AI+N
Sbjct: 339 ARRNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQN 398

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           A I VLPHI NAC+L+  +S+ NS ++  SRSL  +A D  AP+I  + N  GVPY ++A
Sbjct: 399 AHIKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVA 458

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           L   F CLA++NVSS +   F++F N+++I G + WI I + Y+ F +A   +G+ +  +
Sbjct: 459 LSAAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYER-V 517

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            +++P QP   +  +    ++ L   +  F+   ++   F+  YI +P++++ +V +KI 
Sbjct: 518 PFKSPLQPYGTYFFIVVVSLICLTNGYASFV--NWNASDFVAAYITLPIFVVLWVGHKIY 575

Query: 530 HKT--KW-IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIF 582
            +T   W +  A VD+ T     ++EEE   L+  R+          W++F  ++ 
Sbjct: 576 TRTWSTWLLPVAEVDVTT--GLAEIEEETKILDAQRIPPAN-----AWQKFEQWLL 624

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 166/499 (33%), Positives = 271/499 (54%), Gaps = 11/499 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +  +   R+K+ L+ RH+ M                     AGP+  LIAY  MG +V+ 
Sbjct: 59  EAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYF 118

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           +   LGEMA +IP+    T ++ R+  PA G A GY Y F + +    +++    V+Q+W
Sbjct: 119 ITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFW 178

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI +F   +  +N   VK +GE EFW++S K                GG 
Sbjct: 179 TS--AVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS 236

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            S   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E 
Sbjct: 237 -SQGPIGFRYWRNPGPWGP--GIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 293

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR++VPRAI   ++RIV+FY+ ++F +G+ V +NDP L             P+V++I+
Sbjct: 294 ANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL---ASNVAVIASSPFVISIQ 350

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           NAG  VLPHIFNA V+  + SA NS++YVGSR LY L+    APK F      GVPY  +
Sbjct: 351 NAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGV 410

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
              +L   LA++ V+++A T F++ +N++++ GL +W+ I +++I F +A + +GI ++ 
Sbjct: 411 IATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDD 470

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A   P  A+ A  F  ++  ++ F  F    FD   F T YI + + ++  +  ++
Sbjct: 471 LPFKAKLMPWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFTAYISLIILVVLLIGCQL 529

Query: 529 VHKTKWI-KSANVDLFTYK 546
            ++ +++ K  ++D+ T +
Sbjct: 530 YYRCRFLWKLEDIDIDTDR 548

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  302 bits (773), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 181/515 (35%), Positives = 276/515 (53%), Gaps = 21/515 (4%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           Y+ KH    +K+ L+ RH+ M                    +AGP+  LI+Y  MG VV+
Sbjct: 102 YEDKH----VKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVY 157

Query: 109 TVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
            +   LGEMA +IP+    T ++ R+  PA G A GY Y F + +    +++    V+QY
Sbjct: 158 FITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQY 217

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W    KV   VWI +F  +I  +N   VK +GEFEFW++S K                GG
Sbjct: 218 WTD--KVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGG 275

Query: 228 GPSHN-RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286
             SH   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A 
Sbjct: 276 --SHQGPIGFRYWRNPGAWGP--GIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 331

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVA 346
           E  NPR+ VPRAI   ++RIV+FY+ ++F +GL V YN+P L             P+V++
Sbjct: 332 EAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASS---PFVIS 388

Query: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYN 406
           I+NAG   LP IFNA VL  V SA NS++YVGSR LY LA    APK F      GVPY 
Sbjct: 389 IQNAGTYALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYL 448

Query: 407 SLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDK 466
            +        LA++ V+++A T F++ +N++++ GL +W+ I + +I F +A   +GI +
Sbjct: 449 GVLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISR 508

Query: 467 NTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCY 526
           + L ++A   P  A+ A  F  ++  ++ F  F    F    F T YI + +  + F   
Sbjct: 509 DDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTGC 566

Query: 527 KIVHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
           ++ +K ++I K  ++D+ T +  I+    E++E K
Sbjct: 567 QLYYKCRFIWKLEDIDIDTDRREIEAIIWEDDEPK 601

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  301 bits (772), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 169/516 (32%), Positives = 278/516 (53%), Gaps = 26/516 (5%)

Query: 46  DWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGW 105
           + G +       LK+ L++RH+ +                      GP  + I+Y I+  
Sbjct: 84  EQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIIST 143

Query: 106 VVFTVMSCLGEMAAYIPLDGFTSYAT------RYADPALGFAVGYTYLFKYLVLTPNQLT 159
            V+ +M+ LGEM  ++P +G  S  +      +Y DP+LGFA  + Y + +++L   +++
Sbjct: 144 FVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVS 203

Query: 160 AAALVMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXX 219
           AA+ V++YW     V  G WIT+FL++I+ +N + V  +GE EFW +S K          
Sbjct: 204 AASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIIL 263

Query: 220 XXXXXXGGGP-SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LG 277
                 GGGP S   LGFRYWK+PG F  +       GG G F+   +  +   F+  LG
Sbjct: 264 SFILFWGGGPKSDGILGFRYWKNPGSFAHHITG----GGGGNFLDIYTGIIKGGFSVILG 319

Query: 278 TELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXX 337
            EL  + ++EC + RRN+ +A K  ++R++ FY+     +G+ VAYNDP+L         
Sbjct: 320 PELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKA 379

Query: 338 XX-XXPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFA 396
                P+V+ I+NAGI  +PHI N C+LT  +SA N+ ++  SRSL  +A +  APKIF 
Sbjct: 380 GAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFC 439

Query: 397 KTNSWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFD 456
           + N  GVPY ++    L  CLAY+NVSSS   +F++F N+++I G + WI   + YI F 
Sbjct: 440 RINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFR 499

Query: 457 RAFRVQGIDKNTLSYQAPF----QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITG 512
           +A     I  N L+++ PF    Q  T W +L +  ++ L   + +F+   ++ K FI  
Sbjct: 500 KA-----ITYNKLTHRIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAA 554

Query: 513 YIGIPVYILCFVCYKIVHKT---KWIKSAN-VDLFT 544
           YI +P++I+ ++ +K+  +T    W++  + +D++T
Sbjct: 555 YITLPIFIVLWIGHKVFTRTLLKAWLRPIDKIDVYT 590

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  299 bits (765), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 164/526 (31%), Positives = 290/526 (55%), Gaps = 23/526 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           ++++L+ RH+ M                     AGP+  LIAY  M  + ++V   LGEM
Sbjct: 27  VRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEM 86

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A +IP+   FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W     V  
Sbjct: 87  ATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF--AVPL 144

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             WI++F  ++  +N+  VK++GEFEFW++  K                G G +   +GF
Sbjct: 145 AAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVT-GPVGF 203

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW+ PG F P  G ++    + +F+ + S  + A F + GTEL GI A E  NPR+ VP
Sbjct: 204 RYWRHPGAFGP--GIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           RAIK  ++RI+ FY+ ++F +GL V Y+D    +           P+++AI+N+G  VLP
Sbjct: 262 RAIKKVVFRILFFYILSLFFIGLLVPYDD---WKLTSTDSYVSASPFIIAIENSGTHVLP 318

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
           HIFNA ++  + SA NS++YVGSR +YGL+  + AP I ++T   GVP+ ++ + +LF  
Sbjct: 319 HIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGA 378

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           LAYM  S+  +  F++ +N+T + G  +W+ I +++I F +A  ++GI ++ L ++A + 
Sbjct: 379 LAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWM 438

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI- 535
           P  A+  + F  ++ +++ FT F    ++   F+T YI + ++I  ++ ++   + + I 
Sbjct: 439 PGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIW 496

Query: 536 KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
           +  +VD+ T + A++        E + +++E +     W +F++ +
Sbjct: 497 RVEDVDIDTDRRAVE--------EAVWIEQEPRGF---WDKFWNVV 531

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 179/514 (34%), Positives = 275/514 (53%), Gaps = 19/514 (3%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           Y+ KH    +++ L+ RH+ M                     AGP+  LIAY  MG VV+
Sbjct: 101 YEDKH----VRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVY 156

Query: 109 TVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
            V   LGEMA +IP+    T ++ R+  PA G + GY Y F + +    +++    V++Y
Sbjct: 157 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEY 216

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W    KV  GVWI +F  +I  +N   VK +GEFEFW++S K                GG
Sbjct: 217 WTT--KVPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGG 274

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
                 +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E
Sbjct: 275 S-KQGPIGFRYWRNPGAWGP--GIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 331

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR+ VPRAI   ++RIV+FY+ ++F +GL V Y DP L             P+V++I
Sbjct: 332 AANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASS---PFVISI 388

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +NAG   LP IFNA VL  V SA NS++YVGSR LY LA    APK F      GVPY  
Sbjct: 389 QNAGTYALPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLG 448

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +        LA++ V+++A T F++ +N++++ GL +W+ I +++I F +A   +GI ++
Sbjct: 449 VLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRD 508

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK 527
            L ++A F P  A+ A  F  ++  ++ F  F    F    F T YI + +  + F   +
Sbjct: 509 DLPFKAKFMPYGAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQ 566

Query: 528 IVHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
           + +K ++I K  ++D+ + +  I+    E++E K
Sbjct: 567 LYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPK 600

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  298 bits (763), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 171/493 (34%), Positives = 275/493 (55%), Gaps = 11/493 (2%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L++  + RHV M                    + GP ++LIA+   G ++  V+  L EM
Sbjct: 46  LQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEM 105

Query: 118 AAYIPLD-GFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A++ P+D  F+ YATRY DPALGFA G+ Y  KY +   ++L+A  L++QYW  R  ++ 
Sbjct: 106 ASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYW--REDLSI 163

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
            ++I VFL V+L++N + +KF+GE EFW +  K                GGGPS   +GF
Sbjct: 164 AIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGF 223

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW++   F PY     + G  G+F+ + +  + + +AY+G+E  G+V  E  NP++ +P
Sbjct: 224 RYWREYA-FVPYL----VKGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIP 278

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A +  ++RI  FY+  V +LGL ++ +D  L             P+V+A  NAGI  LP
Sbjct: 279 AATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGS--PFVIAFTNAGIKGLP 336

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
              NA ++ F+ SA N+ LYV SR+ YGLA D  APKIF   N +GVP+N   L  L   
Sbjct: 337 SFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISL 396

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           L++MN+S+S+  +F Y  +  ++FG L+W+S+LI+YI ++RA     + ++ + ++  FQ
Sbjct: 397 LSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQ 456

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIK 536
           P +A++ L F  ++     ++ F+   F YK+FI  YIGI V+I   + +K   K+   +
Sbjct: 457 PYSAYVCLFFVSLIIFFNGYSAFIAG-FKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATR 515

Query: 537 SANVDLFTYKTAI 549
             ++     + AI
Sbjct: 516 PEDLRSIMVEEAI 528

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  299 bits (766), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 177/546 (32%), Positives = 289/546 (52%), Gaps = 32/546 (5%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
            G H    LKK L++ H+ +                    + GP  + I+Y IM  +++ 
Sbjct: 47  SGDHN---LKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYP 103

Query: 110 VMSCLGEMAAYIPL--------DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAA 161
           VM+ L EM  ++P            ++  TRY D +LGFAVG+ Y++ Y++L   + TAA
Sbjct: 104 VMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAA 163

Query: 162 ALVMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXX 221
           + V+ YW     V    WIT+FL +I+ +N   V+F+G  E    S K            
Sbjct: 164 SGVVTYWTT--AVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSI 221

Query: 222 XXXXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTEL 280
               GGGP+H+RLGFR+WKDPG +  +       GG G+     +  + A FA+ LG EL
Sbjct: 222 VLFFGGGPNHDRLGFRFWKDPGAWAYHLA----DGGAGRLSDIITGVIRAGFAFILGPEL 277

Query: 281 CGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXX 339
             + + E ++ RRN+ +A +  ++R++ FY  +    G+ V+ NDP+LL           
Sbjct: 278 VVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAG 337

Query: 340 XXPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTN 399
             P+V+ I+NAGI VLPHI N C+L+  +S+ NS +Y  +RSL  L+ +  APKIF + N
Sbjct: 338 SSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVN 397

Query: 400 SWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAF 459
            WGVPY  +A  T F CLAY+NVSSS   +F++F N+++I G L WI   + Y+ F +A 
Sbjct: 398 RWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAV 457

Query: 460 RVQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVY 519
               +  + L ++ PFQP   W  +    ++ L+  +  F+   ++YK FI  YI +P++
Sbjct: 458 FFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV--HWNYKDFIAAYITLPLF 514

Query: 520 ILCFVCYKIVHKT--KWIKS-ANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQ 576
           ++ ++ +K   +T  +W+ S + +D+ T     ++EEE  +L   R+          W++
Sbjct: 515 LILWLGHKAYTRTWSQWMISVSEIDVTT--GLREIEEETKELNARRIPPRN-----LWEK 567

Query: 577 FYDYIF 582
             +++F
Sbjct: 568 ILEWLF 573

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  300 bits (768), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 166/513 (32%), Positives = 280/513 (54%), Gaps = 14/513 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           + + K  ++K+ L+ RH+ M                    ++GP+  LIAY  MG VV+ 
Sbjct: 94  EAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYF 153

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+    T +++R+  PA G + GY Y F + +    +++    V+++W
Sbjct: 154 VTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFW 213

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
               KV    WI++F  ++  +N   V  +GE EFW++S K                GG 
Sbjct: 214 TT--KVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS 271

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
                +GFRYW+   G+    G +S    + +F+ + +  + A F Y GTEL GI A E 
Sbjct: 272 -KQGPIGFRYWRH--GYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEA 328

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR++VPRAI   ++RIV+FY+ ++F +GL V YNDP L             P+V++I+
Sbjct: 329 ANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKL---NSATSYIASSPFVISIE 385

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           NAG   LPHIFNA ++  + SA NS++YV SR LY LA+   APKIFA+    GVP+  +
Sbjct: 386 NAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGV 445

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +  L   LA++ V+++A   F++ +N++++ GL +W+ I ++++ F  A + +GI ++ 
Sbjct: 446 IVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDD 505

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A F P  ++ A  F  ++  ++ FT F    FD  +F T YI + +  + F+  ++
Sbjct: 506 LPFKARFMPYGSYYACFFITVIIFIQGFTAF-SPKFDVASFFTAYISLILLAVLFIGCQL 564

Query: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
            ++ ++  K  ++D+ T +  ID    E++E K
Sbjct: 565 YYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPK 597

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  298 bits (763), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 169/503 (33%), Positives = 274/503 (54%), Gaps = 11/503 (2%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
           H    +++ L+ RHVSM                     AGP+  LI+Y  MG + + V  
Sbjct: 48  HGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQ 107

Query: 113 CLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
            LGEMA +IP+   FT +  R+    LG A GY Y F + V    +L+    +++YW   
Sbjct: 108 SLGEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTS- 166

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
             V    WI +F   I   N+V VKF+GEF+FW++  K                G G + 
Sbjct: 167 -AVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKT- 224

Query: 232 NRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNP 291
             +GFRYW++PG +    G +S    +G+F+ + S  V A F Y GTEL GI A E  NP
Sbjct: 225 GPVGFRYWRNPGPWG--DGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANP 282

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAG 351
           R+ VP+AI    +RI++FY+ ++F +GL V +ND  L             P+++AI+N+G
Sbjct: 283 RKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAGS---PFIIAIQNSG 339

Query: 352 IPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALC 411
             +LP IFNA +L  + SA NS++YVGSR LYGLA ++ AP+ FA+TN  GVP  ++   
Sbjct: 340 TKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFV 399

Query: 412 TLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSY 471
             F  L Y++VS+ A   F + +N+T+I G  SW+ I + ++ F +A ++QGI ++ L +
Sbjct: 400 ANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPF 459

Query: 472 QAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
           +A   P  A+ +  F  ++ +++ FT  L  TF+   F   YI + ++++ +  ++  ++
Sbjct: 460 KAKLMPWGAYYSAFFITLIIIIQGFTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCWYR 518

Query: 532 TKWI-KSANVDLFTYKTAIDLEE 553
           T+ I +  +VD+ + +  +D ++
Sbjct: 519 TRIIHRIEHVDIDSDRREVDAQQ 541

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  298 bits (763), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 177/517 (34%), Positives = 285/517 (55%), Gaps = 18/517 (3%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
           G      +K++L+ RH+ M                     +GP+  LIAY  +G + + V
Sbjct: 55  GSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAV 114

Query: 111 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
              LGEMA +IP+   FT +A+R+  P++G AVGY Y F + V    +L+    ++ YW 
Sbjct: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
               V    WI++F  ++  +N+  VKF+GE EFW+++ K                G G 
Sbjct: 175 F--AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV 232

Query: 230 SHNRLGFRYWKDPG--GFKPYSGAVSIPGGK--GKFVSFASVFVYALFAYLGTELCGIVA 285
           +   +GFRYW++PG  G    S  V I   K  G+F+ + +  + A F Y GTEL GI A
Sbjct: 233 T-GPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITA 291

Query: 286 AECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVV 345
            E  NPR+ VPRAIK  ++RI++FY+ ++F +GL V ++DP L             P+++
Sbjct: 292 GEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSS---PFII 348

Query: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405
           AI+N+G  +LP IFNA +L  + SA NS++YVGSR L+ LA    APKI ++T   GVP+
Sbjct: 349 AIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPW 408

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
            S+    +F  LAYM  +   +T+F + VN+T+I G  +W+ ILI++I F +  + +GI 
Sbjct: 409 VSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGIS 468

Query: 466 KNTLSYQAPFQPVTAWIALGFCLMVALV-KNFTVFLGDTFDYKTFITGYIGIPVYILCFV 524
           ++ L ++A   P  A+ A+ FC+++ ++ + FT F   TFD   F   YI + ++ L + 
Sbjct: 469 RDDLPFKANLMPGLAYYAV-FCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWG 526

Query: 525 CYKIVHKTKWI-KSANVDLFTYKTAID---LEEEEGK 557
            +++  K +WI K  +VD+ + +  ++    E+ E K
Sbjct: 527 AFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPK 563

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  299 bits (766), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 179/515 (34%), Positives = 275/515 (53%), Gaps = 21/515 (4%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           Y+ KH    +K+ L+ RH+ M                     AGP+  LIAY  MG +V+
Sbjct: 101 YEDKH----VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVY 156

Query: 109 TVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
            V   LGEMA +IP+    T ++ R+  PA G + GY Y F + +    +++    V++Y
Sbjct: 157 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEY 216

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W    KV    WI +F  +I  +N   VK +GEFEFW++S K                GG
Sbjct: 217 WTD--KVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGG 274

Query: 228 GPSHN-RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286
             SH   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A 
Sbjct: 275 --SHQGPIGFRYWRNPGAWGP--GIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAG 330

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVA 346
           E  NPR+ VPRAI   ++RIV+FY+ ++F +GL V YND  L             P+V++
Sbjct: 331 EAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASS---PFVIS 387

Query: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYN 406
           I+NAG   LP IFNA VL  V SA NS++YVGSR LY LA    APK F      GVPY 
Sbjct: 388 IQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYL 447

Query: 407 SLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDK 466
            +        LA++ V+++A T F++ +N++++ GL +W+ I + +I F +A + +GI +
Sbjct: 448 GVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISR 507

Query: 467 NTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCY 526
           + L ++A   P  A+ A  F  ++  ++ F  F    F    F T YI + +  + F+  
Sbjct: 508 DDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSEFFTSYISLILLAVVFIGC 565

Query: 527 KIVHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
           +I +K ++I K  ++D+ + +  I+    E++E K
Sbjct: 566 QIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPK 600

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  298 bits (764), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 167/517 (32%), Positives = 274/517 (52%), Gaps = 18/517 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++K+ L+ RH+ M                     +GP+  LIAY  MG +++ +   LGE
Sbjct: 92  QVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSLGE 151

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           MA +IP+    T ++ R+  PA G A GY Y F + +    +++    V++YW    KV 
Sbjct: 152 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTD--KVP 209

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              WI +F  +I  +N   VK +GE EFW++  K                GG  S   +G
Sbjct: 210 LAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQGPIG 268

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           FRYW++PG + P  G +S     G+F+ + S  + A F Y GTEL GI A E  NPR+ V
Sbjct: 269 FRYWRNPGPWGP--GIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 326

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           PRAI   ++RI +FY+ ++F +G+ V YND  L             P+V++I+NAG  VL
Sbjct: 327 PRAINKVVFRIALFYIMSLFFIGMLVPYNDERL---ASTSAVIASSPFVISIQNAGTKVL 383

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P IFNA V+  + SA NS++YVGSR LY LA+   APK FA    +GVPY  + + +   
Sbjct: 384 PDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALG 443

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LA++ V+++A T F++ +N++++ GL +W+ I I++I F +A + +GI ++ L ++A  
Sbjct: 444 LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKL 503

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  A+ A  F  ++  ++ F  F    +D   F T YI + +  + F+  +I ++ +  
Sbjct: 504 MPFGAYYATFFVTVIIFIQGFQAF-SPHWDTTAFFTSYISLIILAVLFIGCQIFYRCR-- 560

Query: 536 KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
                  F     ID++ +  ++E +  +++  +  W
Sbjct: 561 ------FFWRVEDIDIDSDRREIEAVIWEDDEPKTLW 591

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  297 bits (760), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 165/484 (34%), Positives = 267/484 (55%), Gaps = 11/484 (2%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K++L+ RHV+M                     AGP+  L+AY  +  + + V   LGEM
Sbjct: 49  VKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEM 108

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A +IP+   FT +A+R+  PALG A GY Y   + +    +++    ++ YW     V  
Sbjct: 109 ATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPI 166

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             W+ +F  ++  IN++ VKF+GEFEFW++S K                GG     R+GF
Sbjct: 167 TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGF 225

Query: 237 RYWKDPGGFKPYS-GAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           RYWKDPG   P+  G VS      +F+ + S  + A F + GTEL G+ A E KNPRR V
Sbjct: 226 RYWKDPG---PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+AI    +RI++FY+ ++ ++GL V Y+DP L+Q           P+VVAI  AG  VL
Sbjct: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGTKVL 341

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P I N  ++  + SA NS++YVGSR LYGL     AP   ++T S GVPY ++   ++F 
Sbjct: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L Y+NVSS + ++F + +++T++ G  +W+ I +++I F +  + +GI ++ L ++A F
Sbjct: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  A+ A  F +++ LV+ FT F    F    F+  YI   ++++ ++ ++ + K +W 
Sbjct: 462 MPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWF 519

Query: 536 KSAN 539
            + +
Sbjct: 520 HTVD 523

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  297 bits (761), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 164/485 (33%), Positives = 269/485 (55%), Gaps = 10/485 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
            G  +   +K++L+ RH+ M                     AGP+  LIAY  M  +VF+
Sbjct: 81  QGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFS 140

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT +++R+  P++G A GY Y F + +    +L+    ++Q+W
Sbjct: 141 VTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI ++  ++  +N+  VKF+GEFEFW++S K                G G
Sbjct: 201 TD--AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG 258

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E 
Sbjct: 259 VT-GPVGFRYWRNPGPWGP--GIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEA 315

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR+ VPRAIK   +RI++FY+ ++F +GL V ++DP L             P+++AI+
Sbjct: 316 ANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIQ 372

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N+G  VLPHIFNA +L+ + SA NS++YVGSR ++GLA  K AP+ F  T   GVPY ++
Sbjct: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
              + F  LA++ VSS     F++ +N+  + G  +W+ I I ++ F +    +GI ++ 
Sbjct: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A   P  A+ A+ F +++ +++ FT F   TF+   F+  YI + ++   +V +++
Sbjct: 493 LPFKAALMPWLAYYAIFFMIIIIIIQGFTAF-APTFNGSDFVAAYISVFLFFFLWVSFQL 551

Query: 529 VHKTK 533
             + K
Sbjct: 552 YFRCK 556

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  298 bits (762), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 174/507 (34%), Positives = 272/507 (53%), Gaps = 17/507 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            +K+ L+ RH+ M                     AGP+  LIAY  MG V++ +   LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           MA +IP+    T ++ R+  PA G + GY Y F + +    +++    V+QYW    KV 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTD--KVP 222

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN-RL 234
              WI +F  +I  +N   VK +GEFEFW++S K                GG  SH   +
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGG--SHQGPI 280

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  NPR+ 
Sbjct: 281 GFRYWRNPGAWGP--GIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           VPRAI   ++RIV+FY+ ++F +GL V YN+P L             P+V++I+NAG   
Sbjct: 339 VPRAINKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SPSSAVIASSPFVISIQNAGTYA 395

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           LP IFNA VL  V SA NS++YVGSR LY LA    APK F      GVPY  +      
Sbjct: 396 LPDIFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAAL 455

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             LA++ V+++A T F++ ++++++ GL +W+ I + +I F +A + +GI ++ L ++A 
Sbjct: 456 GLLAFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAK 515

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKW 534
             P  A+ A  F  ++  ++ F  F    F    F T YI + +  + F+  ++ +K ++
Sbjct: 516 LMPYGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRF 573

Query: 535 I-KSANVDLFTYKTAIDL---EEEEGK 557
           I K  ++D+ + +  I+    E++E K
Sbjct: 574 IWKLEDIDIDSDRREIEAIIWEDDEPK 600

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  296 bits (757), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 169/511 (33%), Positives = 273/511 (53%), Gaps = 14/511 (2%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
           ++    +K+ L+ RH+ M                     +GP+  LIAY  MG +++++ 
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 112 SCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
             LGEMA +IP+    T ++ R+  PA G A GY Y F + +    +++    V++YW  
Sbjct: 155 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTK 214

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
             KV    WI +F   +  +N   VK +GE EFW++ F                  GG S
Sbjct: 215 --KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIA-FMKVLAIAGYLLYALIIVCGGSS 271

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
              +GFRYW++PG +   +G +S      +F+ + S  + A F Y GTEL GI A E  N
Sbjct: 272 QGPIGFRYWRNPGPWG--AGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAAN 329

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR++VPRAI   ++RI +FY+ ++F +GL V Y+DP L             P+V++I+NA
Sbjct: 330 PRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASS---PFVISIQNA 386

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           G  +LP IFNA V+  V SA NS++YVGSR LY LA    APK FA     GVPY  +  
Sbjct: 387 GTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLC 446

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
                 LA++ V+++A T F++ +N++++ GL +W+ I I++I F +A + +GI ++ L 
Sbjct: 447 TAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLP 506

Query: 471 YQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
           ++A F P  A+ A  F  ++  ++ F  F    FD   F T YI + +  + F+  +I +
Sbjct: 507 FKAKFMPWAAYYATFFVTVIIFIQGFQAF-SPHFDVTAFFTAYISLIILAVLFIGCQIYY 565

Query: 531 KTKWI-KSANVDLFTYKTAID---LEEEEGK 557
           + ++  K  ++D+ T +  I+    E++E K
Sbjct: 566 RCRFFWKLEDIDIDTDRREIEEVIWEDDEPK 596

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 167/517 (32%), Positives = 275/517 (53%), Gaps = 15/517 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +  ++  ++K++L+ RH+ M                     AGP+  LIAY  MG +V+ 
Sbjct: 76  EADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYF 135

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+    T ++ R+  PA G A GY Y F + +    +++    V+QYW
Sbjct: 136 VTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYW 195

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI +F  ++  +N   VK +GE EFW++  K                GG 
Sbjct: 196 TD--AVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGS 253

Query: 229 PSHNRLGFRYWKDPG----GFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIV 284
                +GFRYW++PG    G       +     +G+F+ + +  + A F Y GTEL GI 
Sbjct: 254 KKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGIT 313

Query: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYV 344
           A E  NPR+ VPRAI   ++RIV+FY+ ++F +GL V + D  L             P+V
Sbjct: 314 AGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL---SDDTTVIASSPFV 370

Query: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404
           ++I+NAG  +LP IFNA V+  V SA NS++YVGSR LY LA  K APKIFA+    GVP
Sbjct: 371 ISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVP 430

Query: 405 YNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGI 464
           +  +   +L   LA++ V ++A T F++ V+++++ GL +W+ I + ++ F +  + +GI
Sbjct: 431 FMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGI 490

Query: 465 DKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFV 524
            ++ L ++A F P  ++ A  +  ++  V+ F  F    FD  TF T YI + +  + F+
Sbjct: 491 SRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAF-SPHFDVTTFFTDYISLILLAVVFI 549

Query: 525 CYKIVHKTKWI-KSANVDLFTYKTAID---LEEEEGK 557
             ++ ++ +++ K  +VD+ + +  I+    E++E K
Sbjct: 550 GAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPK 586

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  295 bits (754), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 166/532 (31%), Positives = 281/532 (52%), Gaps = 21/532 (3%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
           G  +  R+K+ L+ RH+ M                     AGP+  LIAY  MG +++ +
Sbjct: 87  GHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFI 146

Query: 111 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
              LGEMA +IP+    T ++ R+  PA G   GY Y F + +    +++    V+QYW 
Sbjct: 147 TQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWT 206

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
               V    WI +F   +  +N   VK +GE EFW++S K                GG  
Sbjct: 207 D--AVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS- 263

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           S   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  
Sbjct: 264 SQGPIGFRYWRNPGPWGP--GIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 321

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR++VPRAI   ++RI +FY+ ++F +GL V YND  L             P+V++I+N
Sbjct: 322 NPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTL---SSGDSYIASSPFVISIQN 378

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           AG   LP IFNA V+  + SA NS++YVGSR LY LA    APK FA     GVP+  + 
Sbjct: 379 AGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVI 438

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           +      LA++ V+++A T F++ +N++++ GL +W  I +++I F +A + +GI ++ L
Sbjct: 439 VTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDL 498

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            ++A   P  A+ +  F  ++  ++ F  F    +D  TF T YI + + ++ F+  ++ 
Sbjct: 499 PFKAKLMPWGAYYSAFFVFVIIFIQGFEAF--TPWDTTTFFTSYISLILLVVVFIGCQLY 556

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
           ++ +++             ID++ +  ++E +  +++  ++   W++F+ ++
Sbjct: 557 YRCRFLLKVE--------DIDIDTDRREIEAIIWEDDEPKN--LWEKFWAWV 598

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 168/534 (31%), Positives = 286/534 (53%), Gaps = 22/534 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           + K +   +K+DL  RH++M                     +GP+  LIAY  +G VV++
Sbjct: 52  NEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYS 111

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+   FT ++ R+  PALG A GY Y F + +    +L+    ++Q+W
Sbjct: 112 VTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI++F  ++   N+  V+ +GE EFW++  K                G G
Sbjct: 172 TF--AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG 229

Query: 229 PSHNRLGFRYWKDPGGFKPY-SGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
            +   +GFRYW++PG   P+ +G +S    + +F+ +AS  + A F + GTEL GI A E
Sbjct: 230 KT-GPVGFRYWRNPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGE 285

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR+ VP+AI+  ++RI+VFY+ ++F +GL V Y+D   ++           P+++AI
Sbjct: 286 AANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAI 342

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +N+G  +LPHIFN  +L  + SA NS++Y+GSR L+GLA +   PK+FAKT   GVP  +
Sbjct: 343 ENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFA 402

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +   +LF  LA+M  S+  +  F + +NV  + G  SW+ I   +I F +  + +GI +N
Sbjct: 403 VVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRN 462

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK 527
            L ++A F P  A+ A    +++   + FT F    FD   F   YI + ++ + +  ++
Sbjct: 463 DLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQ 521

Query: 528 IVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581
           +  K +++    VD       ID++++  ++E    ++    +   W +F+D++
Sbjct: 522 LWFKCRYVWKL-VD-------IDIDKDRREIEDRVWQDTTPAN--LWGKFWDFV 565

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  290 bits (742), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 165/488 (33%), Positives = 262/488 (53%), Gaps = 12/488 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G  +   +K+ L+ RH+SM                    ++GP+  LIAY  +G +V+ 
Sbjct: 48  EGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYF 107

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+    T ++ R+  PA G A GY Y F + +    ++     V+QYW
Sbjct: 108 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYW 167

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI +F  ++   N   VKF+GE EFW++S K                GG 
Sbjct: 168 TD--AVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGG- 224

Query: 229 PSHN-RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
            SH   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E
Sbjct: 225 -SHQGPIGFRYWRNPGPWGP--GIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGE 281

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR+ VPRAI    +RI+ FY+ ++F +GL V Y+D   L+           P+V++I
Sbjct: 282 AANPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDD---LRLSNTTAVIASSPFVISI 338

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +NAG  VLPHIFNA V+  + SA NS++YVGSR LY LA+   APK F      GVPY  
Sbjct: 339 QNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLG 398

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           + +  L   LA++ V+++A   F++ VN++++ GL +W+ I ++++ F +  + +GI + 
Sbjct: 399 VIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISRE 458

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK 527
            L ++A   P  A+ A  F  ++ +++ F  F    F    F T YI + +  + F+  +
Sbjct: 459 DLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFT-PKFRVSDFFTSYISLILLAVLFLGCQ 517

Query: 528 IVHKTKWI 535
           + ++ ++I
Sbjct: 518 LFYRCRFI 525

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  290 bits (741), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 174/513 (33%), Positives = 268/513 (52%), Gaps = 19/513 (3%)

Query: 60  KDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMAA 119
           + L++RHV +                      GP  +LIAY++M   V++VM+ + EM  
Sbjct: 53  RGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVT 112

Query: 120 YIPLDGFT---SYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
            IPL G +   S    Y +  L F  G+   +   ++ P ++TA AL++QYW      NP
Sbjct: 113 LIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWT---DANP 169

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR-LG 235
            ++I++FL + + I ++ VK FGE EFW+SS K                GGGP+    LG
Sbjct: 170 AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLG 229

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKNPRRN 294
           F YWK PG FKPY     + GG GKF++F +  + + F++ L  E+    AAE   PRRN
Sbjct: 230 FHYWKKPGAFKPYL----VEGGTGKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRN 285

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAY-NDPLLLQXXXXXXXXXXXPYVVAIKNAGIP 353
           +PRA K  +YR+ +FY+  + ++G+ V Y ND LL             P+V+ IK AGI 
Sbjct: 286 MPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAGIR 345

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
           VLPHI NA +LT  +S     LY  SR+L+ +A    AP+I    N +GVPY    + +L
Sbjct: 346 VLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGITSL 405

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
           FC LAY+N S+S+  +F++  N+ +I G +SW+ + I YI F     V  ++ + + ++ 
Sbjct: 406 FCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPFRV 464

Query: 474 PFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
           P+Q   A++A+GF  ++ L   F VF+   +D   F   YI +   ++ FV   I +K +
Sbjct: 465 PYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYK-E 523

Query: 534 W----IKSANVDLFTYKTAIDLEEEEGKLEMMR 562
           W    I     D+    T  + EE E  + + R
Sbjct: 524 WRCRDIAEIEQDILPKITLAEAEEYEYDIPVPR 556

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  287 bits (734), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 166/485 (34%), Positives = 266/485 (54%), Gaps = 15/485 (3%)

Query: 90  QAGPIAILIAYSIMGWVVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLF 148
            AGP+  LI+Y  MG V+++V   LGEMA +IP+   F+ +A R+  PALG   GY Y  
Sbjct: 22  HAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWL 81

Query: 149 KYLVLTPNQLTAAALVMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSF 208
            +      +L+    ++QYW     V    WI +F  ++  +N+  VK++GEFEF ++S 
Sbjct: 82  SWCFTFALELSVLGQIIQYWTD--AVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASI 139

Query: 209 KXXXXXXXXXXXXXXXXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVF 268
           K                G G     +GFRYW++PG + P  G +S    +G+F+ + S  
Sbjct: 140 KVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGP--GIISSDKNEGRFLGWVSSL 197

Query: 269 VYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLL 328
           + A F Y GTEL GI A E  NPR+ VPRAIK  + RI+VFY+ ++F +GL V YNDP L
Sbjct: 198 INAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL 257

Query: 329 LQXXXXXXXXXXXPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAID 388
                        P++++I+N+G  VLP IFNA VL  + SA NS++Y+GSR LY L+ +
Sbjct: 258 ---DSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKN 314

Query: 389 KKAPKIFAKTNSWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISI 448
             AP+  +     GVPY ++   ++F  LA++  S+ +   F++ +N+T + G  +W+ I
Sbjct: 315 DLAPRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLI 374

Query: 449 LITYISFDRAFRVQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKT 508
             ++I F +A   +GI +N L Y+A   P  A+ A  F  ++ L++ FT F   +F    
Sbjct: 375 SFSHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVD 433

Query: 509 FITGYIGIPVYILCFVCYKIVHKTKWI-KSANVDLFTYKTAIDLEEEEGKLEMMRLKEER 567
           F+  YI + +++  +  +++  K   I K  +VD+ +     D  E E ++ +  L++ +
Sbjct: 434 FVAAYISVFLFVAIWFSFQLWFKCPIILKLQDVDIDS-----DRREIEEQVWIEPLRKTK 488

Query: 568 KQHGW 572
            Q  W
Sbjct: 489 WQCVW 493

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 168/506 (33%), Positives = 269/506 (53%), Gaps = 15/506 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++K+ L+ RH+ M                     AGP+  LIAY  MG +++ V   LGE
Sbjct: 91  KVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGE 150

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           MA +IP+    T ++ R+  PA G A GY Y F + +    +++    V+QYW     V 
Sbjct: 151 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTK--AVP 208

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              WI +F  ++  +N   VK +GE EFW++ F                  GG     +G
Sbjct: 209 LAAWIAIFWVLVTLMNFFPVKVYGEVEFWIA-FVKVLAIVGYLIYALVIVCGGSHQGPIG 267

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           FRYW+ PG F P  G +S     GKF+ + +  + A F Y GTEL GI A E  NPR+ V
Sbjct: 268 FRYWRHPGAFGP--GIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTV 325

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           PRAI   ++RIV+FY+ ++F +G+ + YND  L             P+V++IKNA   VL
Sbjct: 326 PRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL---SAQDAVIASSPFVISIKNAHTKVL 382

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P IFNA V+  V SA NS++YVGSR LY LA+   APK F+    +GVPY  +       
Sbjct: 383 PDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLG 442

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LA++ V+++A T F++ +N++++ GL +W+ I + +I F +A + +GI ++ L ++A  
Sbjct: 443 LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKL 502

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKW- 534
            P  A+ A  F  ++  ++ +  F    +D  TF T YI + +  +  V  ++ ++ ++ 
Sbjct: 503 MPWGAYYAAFFVTVIIFIQGYQAFC--PWDVSTFFTSYISLILLAVLVVGCQLYYRGRFL 560

Query: 535 IKSANVDLFTYKTAID---LEEEEGK 557
           +K  ++D+ T +  I+    E++E K
Sbjct: 561 LKLEDIDIDTDRREIESIVWEDDEPK 586

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  288 bits (737), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 171/523 (32%), Positives = 270/523 (51%), Gaps = 19/523 (3%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
           GK    ++K+ L+ RH+ M                    ++GP+  LIAY  MG VV+ V
Sbjct: 95  GKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFV 154

Query: 111 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
              LGEMA +IP+    T +  R+  PALG + GY Y F + +    +L+    ++QYW 
Sbjct: 155 TQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWT 214

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
              KV    WI +F  ++  +N   VK +GE EFW+SS K                GG  
Sbjct: 215 Y--KVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS- 271

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
               +GFRYW+   G+    G +S    + +F+ + S  + A F Y GTEL GI A E  
Sbjct: 272 RQGPIGFRYWRH--GYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAA 329

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR+ VPRAI   ++RI +FY+ ++F +GL V YND  L             P+V+++ N
Sbjct: 330 NPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASS---PFVISMLN 386

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
           AG   LP IFNA +L  V SA NSD+Y+ SR LY LA    APK F   N +GVPY  + 
Sbjct: 387 AGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVF 446

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           +  L   LA++ VS++A T F++ +N++++ GL +W  I   +I F +A + +GI ++ L
Sbjct: 447 VTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDL 506

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            ++A F P  A+ A  F  ++  ++ +  F    +D K+F T YI + ++ + ++   I 
Sbjct: 507 PFKARFMPWGAYYAAFFVGLIIFIQGYDAF--TPWDTKSFFTSYISLILFGVLYLGCLIY 564

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
           ++ +        L      ID++ +  ++E    +E+  ++ W
Sbjct: 565 YRGR--------LLIKIEDIDIDTDRKEVEAYVWEEDAPRNWW 599

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  284 bits (727), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 166/537 (30%), Positives = 275/537 (51%), Gaps = 34/537 (6%)

Query: 46  DWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGW 105
           D   +G ++   +K+ L+ARH+SM                     AGP+  L+AY  +G 
Sbjct: 43  DHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGT 102

Query: 106 VVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALV 164
           VV+++   LGEMA +IP+    T ++ R+  PA G A GY Y F + +    +L+    +
Sbjct: 103 VVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQI 162

Query: 165 MQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 224
           +QYW  R  V    WI +F  ++  +N   V+F+GE EFW++S K               
Sbjct: 163 IQYWTDR--VPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIV 220

Query: 225 XGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGK---------FVSFASVFVYALFAY 275
            GG            + P G  P +G +   G +           F+ + S  + A F Y
Sbjct: 221 CGGSK----------QGPIGL-PATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTY 269

Query: 276 LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXX 335
            GTEL GI A E  NPR+NVP+AI    +RI+ FY+ ++  +GL V Y+DP L       
Sbjct: 270 QGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRL--NSESS 327

Query: 336 XXXXXXPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIF 395
                 P+V++IKNAG  +LP IFNA VL  V SA NS++Y+GSR  Y LA+   APK  
Sbjct: 328 TDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQL 387

Query: 396 AKTNSWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISF 455
           A     GVPY  + + +L   ++++ ++ +A T F + VN++++ GL +W+ I + +I F
Sbjct: 388 AFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRF 447

Query: 456 DRAFRVQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIG 515
            +  + +GI ++ L ++A F P  A+ A  F  ++  ++ +T F    FD  TF T YI 
Sbjct: 448 MQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFT-PKFDVTTFFTSYIS 506

Query: 516 IPVYILCFVCYKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
           + + +L F+  +I +K +++ +           ID++ +  +++ +  +E+  ++ W
Sbjct: 507 LFLMLLVFIGCQIYYKCRFLWAVE--------DIDIDSDRREIDAIVWEEDEPKNIW 555

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  284 bits (726), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 170/487 (34%), Positives = 250/487 (51%), Gaps = 13/487 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LK+ L+ RH+ M                    + GP+ +LIAY  +G VV      + E
Sbjct: 48  KLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAE 107

Query: 117 MAAYIPLDGFT-SYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +A+++P  G T  +A ++ D ++GF  G+  +  Y  L P +L+A A++M+YW     V+
Sbjct: 108 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWT---DVS 162

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
           P V+ITVF  + +  NI  ++F+GE E+     K                GG     RLG
Sbjct: 163 PAVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLG 222

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           F YW++PG F  Y     + G  GKFV F +     +++Y G +   I+A E KN R  +
Sbjct: 223 FHYWREPGPFANYL----VGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAI 278

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
               K    RI+V YL TVF+L L V YND L+             P+V+A+  AGI VL
Sbjct: 279 FHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLI---ATGTGTARSSPFVIAMNRAGIKVL 335

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHI NA +LT  +SA N  +  GSR+L+ LA   +APKIF +T+  G+PY  +   + F 
Sbjct: 336 PHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFL 395

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LAYM+ S S+ T+F +F  + S   LL WI I   +I  DRA + QG  ++ L Y  P 
Sbjct: 396 PLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPM 455

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  AW +     +  L   F  F+   FD ++F T Y  IP+ I  F  +K+  KTK++
Sbjct: 456 GPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYL 515

Query: 536 KSANVDL 542
           +   VDL
Sbjct: 516 RPHEVDL 522

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  283 bits (724), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 171/487 (35%), Positives = 250/487 (51%), Gaps = 13/487 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LK+ L+ RH+ M                    + GP+ +LIAY  +G VV      + E
Sbjct: 43  KLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAE 102

Query: 117 MAAYIPLDGFT-SYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +A+++P  G T  +A ++ D ++GF  G+  +  Y  L P +L+A A++M+YW     ++
Sbjct: 103 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWT---DIS 157

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
           P V+IT+F  + +  NI  ++F+GE E+     K                GG     RLG
Sbjct: 158 PAVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERLG 217

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           F YW+DPG F  Y     + G  GKFV F S     +++Y G +   I+A E KN R  +
Sbjct: 218 FHYWRDPGPFAEYI----VGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAI 273

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
               K    RI+V YL TVF+L L V YND L+             P+V+A+  AGI VL
Sbjct: 274 YHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALI---ASGTGTAKSSPFVIAMNRAGIKVL 330

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHI NA VLT  +SA N  +  GSR+L+ LA   +APKIF KT+  G+PY  +   + F 
Sbjct: 331 PHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFL 390

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LAYM+ S S+ T+F +F  + S   LL WI I   +I  DRA + QG  ++ L Y  P 
Sbjct: 391 PLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPI 450

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  AW +     +  L   F  F+   FD ++F T Y  IP+ I  F  +K+  KT+++
Sbjct: 451 APYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYL 510

Query: 536 KSANVDL 542
           +   VDL
Sbjct: 511 RPEEVDL 517

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  285 bits (730), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 167/533 (31%), Positives = 281/533 (52%), Gaps = 32/533 (6%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG+    +LK+ L ARH+ +                    + GP  ++ +Y I+  +V+ 
Sbjct: 96  DGRKN--KLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYP 153

Query: 110 VMSCLGEMAAYIPLDGFTSYAT------RYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
           +M+ LGEM  Y+P DG  S  +      RY D +L FA G+ Y + +++L   + TAA+ 
Sbjct: 154 IMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASG 213

Query: 164 VMQYWVGRGKVNPG-VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXX 222
           V++YW    KV P   WI +F  +I  +N+  V+ +GE EFW +  K             
Sbjct: 214 VVEYWT---KVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFI 270

Query: 223 XXXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGK-GKFVSFASVFVYALFAY-LGTEL 280
              GGGP+H+RLGFRYW  PG F     A +I  G  G F+      +   F++ LG EL
Sbjct: 271 LFWGGGPNHDRLGFRYWITPGSF-----ANTITNGSFGNFLDVYKGIILGAFSFILGPEL 325

Query: 281 CGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXX-XXX 339
             + ++EC +PRRN+ +A K  ++R++ FY+     + + V+YNDP+L            
Sbjct: 326 VVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAG 385

Query: 340 XXPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTN 399
             P+V+ I+NAGI VLPHI N C+L   +S+ N+ L+  SRSL  +AI+ +APK   K N
Sbjct: 386 SSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKIN 445

Query: 400 SWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAF 459
            +GVPY ++ +  +  C+AY+N S S   +F +F N+++I G L WI + +TY+ F +A 
Sbjct: 446 RFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAI 505

Query: 460 RVQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVY 519
              G+ K+ L Y    QP     +L   +++ +   F + +   ++   FI  Y+ +P++
Sbjct: 506 EYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIF 564

Query: 520 ILCFVCYKIVHKTK----------WIKSANVDLFTYKTAIDLEEEEGKLEMMR 562
           ++ ++ +K  +K +          W +  ++D+ T    I++E E+ + E ++
Sbjct: 565 LMIWIGHKF-YKYRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEKFESEYVK 616

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  283 bits (723), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 167/524 (31%), Positives = 268/524 (51%), Gaps = 18/524 (3%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G  +  ++K+ L+ RHVSM                     AGP+  LIAY  MG +V+ 
Sbjct: 46  EGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYF 105

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   +GEMA +IP+    T ++ R+  PA G A GY Y F + +    +++    V+QYW
Sbjct: 106 VTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 165

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI +F   I   N   V+F+GE EFW++S K                GG 
Sbjct: 166 TK--AVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS 223

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
                +GFRYW++PG +    G +S    KG+F+ + +  + A F Y GTEL GI A E 
Sbjct: 224 -KQGPIGFRYWRNPGPWG--DGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEA 280

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR+ VP+AI    +RI+ FY+ ++F +GL V YN P L +           P+V++I+
Sbjct: 281 ANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASS---PFVISIQ 337

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           +AG  +LP IFNA VL  + SA NS++YVGSR L+ LA    APK F+   + GVPY  +
Sbjct: 338 SAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGV 397

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
               L   LA++ V  +A   F++ +N++++ GL +W+ I I++I F +  + +GI ++ 
Sbjct: 398 ICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDD 457

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L +++   P  A+ A  +  ++  V+ F  F    F    F TGYI + +  + F   ++
Sbjct: 458 LPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVVFCLAQL 516

Query: 529 VHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            ++ +         F     ID++ +  +++ +  +EE     W
Sbjct: 517 YYRCR--------FFNRLEDIDIDSDRREIDALIWEEEEPTTLW 552

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  282 bits (722), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 163/524 (31%), Positives = 271/524 (51%), Gaps = 18/524 (3%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G  +  ++K+ L+ RHVSM                     +GP+  LIAY  MG VV+ 
Sbjct: 107 EGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYF 166

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   +GEMA +IP+    T +++R+  PA G A GY Y F + +    +L+    V++YW
Sbjct: 167 VTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYW 226

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI +F  ++   N   V+F+GE EFW++S K                GG 
Sbjct: 227 TE--AVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS 284

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
                +GFRYW++PG +   +G +S    +G+F+ + +  + A F Y GTEL GI A E 
Sbjct: 285 -KQGPIGFRYWRNPGPWG--AGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEA 341

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPRR VPRAI    +RI+ FY+ ++F +GL V YN   L +           P+V++I+
Sbjct: 342 ANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASS---PFVISIQ 398

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           NAG   LP IFNA VL  + SA NS++YVGSR L+ LA    APK+F+     GVP+  +
Sbjct: 399 NAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGV 458

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            + +L   LA++ V+ +A   F++ +N++++ GL +W+ I I++I F +  + +GI ++ 
Sbjct: 459 IVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDD 518

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L +++   P  A+ A  +  ++  V+ F  F    F    F T YI + + ++ F   ++
Sbjct: 519 LPFKSKLMPYGAYYAAFWVTVIIFVQGFQAF-SPHFKVTEFFTSYISLMLLVVVFCGAQL 577

Query: 529 VHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            ++ +         F     ID++ +  + + +  +++     W
Sbjct: 578 FYRCR--------FFNRLEDIDIDSDRREADALIWEDDEPTTLW 613

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  280 bits (715), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 252/487 (51%), Gaps = 14/487 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LK+ L+ARH+ M                    + GP+ +LIAY ++G VV      + E
Sbjct: 45  KLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAE 104

Query: 117 MAAYIPLDGFT-SYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +A+++P  G T  ++ ++ D A+GF  G+  +  Y  L P +L+A A+VM YW     ++
Sbjct: 105 VASFMPATGATIRHSEQFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWT---DLS 159

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
           P ++IT+F  + +  NI  ++F+GE E++    K                GG     RLG
Sbjct: 160 PAIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGG-TKQERLG 218

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           F YW++PG F  Y     + G  GKFV F +     +++Y G +   I+A E KN R  +
Sbjct: 219 FHYWRNPGPFAEYL----VGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAI 274

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
               K    RI++ YL TVF+L L V YND L+             P+V+A++ AGI VL
Sbjct: 275 FHGAKNVFVRIILLYLITVFVLTLIVPYNDKLI---ATGSGNARSSPFVIAMERAGIKVL 331

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHI NA +LT  +SA N  +  GSR+L+ LA   +APKIF KT+  G+P+  +   + F 
Sbjct: 332 PHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFL 391

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LAYM+ S S+ T+FS+F  + S   LL WI I   +I  DRA R QG  +  L Y    
Sbjct: 392 PLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTI 451

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  AW +     +  L   F  F+   FD ++F + Y  IP+ I  F  +K+  KT+++
Sbjct: 452 APYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYL 511

Query: 536 KSANVDL 542
           +   VDL
Sbjct: 512 RPHEVDL 518

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  280 bits (716), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 172/513 (33%), Positives = 272/513 (53%), Gaps = 14/513 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +G      +K+ L+ RHVSM                     +GP+  LIAY  MG VV+ 
Sbjct: 65  EGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYF 124

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           V   LGEMA +IP+    T ++ R+  PA G A GY Y F + +    +L+    ++ YW
Sbjct: 125 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYW 184

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V    WI +F  ++   N   VK++GEFEF ++S K                GG 
Sbjct: 185 TD--AVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS 242

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            S   +GFRYW++PG +   +G ++    K +F+ +    V A F Y GTEL GI A E 
Sbjct: 243 -SQGPIGFRYWRNPGPWG--TGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEA 299

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR+ VP+AI    +RI+VFY+ ++F +GL V YN P   Q           P+V++I+
Sbjct: 300 SNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSP---QLESNSAVIASSPFVISIQ 356

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           NAG  VLP IFNA VL  + SA NS++YVGSR LY LA+   APK F+     GVPY  +
Sbjct: 357 NAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGV 416

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
               L   LA++  + +A T F++ +N++++ GL +W  I + +I F +  +++GI +++
Sbjct: 417 ICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDS 476

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528
           L ++A   P  A+ A  F  ++  ++ FT F    FD   F T YI + + ++ F+  ++
Sbjct: 477 LPFKAKLMPWGAYYAAFFVGLIVFIQGFTAF-APRFDVSEFFTAYISLILLVVLFILCQL 535

Query: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557
            ++ +++ K  ++D+ + +  ID    E++E K
Sbjct: 536 YYRCRFLTKIEDIDIDSDRREIDAIIWEDDEPK 568

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  278 bits (711), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 171/557 (30%), Positives = 283/557 (50%), Gaps = 33/557 (5%)

Query: 45  VDWGYDGKHKGIR-LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIM 103
           VD     K    R LK  LQ+RH+ +                      GP A++I+Y ++
Sbjct: 42  VDIESGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVI 101

Query: 104 GWVVFTVMSCLGEMAAYIPLD-------GFTSY-ATRYADPALGFAVGYTYLFKYLVLTP 155
             +V+ +M+  GEM  Y+P +       G+ +Y  ++Y D +LGFA  + Y + ++VL  
Sbjct: 102 STIVYPIMNMFGEMVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVA 161

Query: 156 NQLTAAALVMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXX 215
            + TAA+ +++YW    K+   V I +FL VI  +N + VKF+GE EFW +  K      
Sbjct: 162 TECTAASSIVEYWTS--KIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITG 219

Query: 216 XXXXXXXXXXGGGPSHNR---LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYAL 272
                     GG P++     +GF YWK+P  F+ Y       G  G F+   +  +   
Sbjct: 220 LIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYV----TNGSLGNFLDVYNALIKGA 275

Query: 273 FAY-LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQX 331
           FA+ LG EL  + ++EC + RRN+ +A +  +YR++ FY+     + + V YNDP LL  
Sbjct: 276 FAFILGPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNA 335

Query: 332 XXXXX-XXXXXPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKK 390
                      P+V+ I+NAGI +LPHI N C+LT   SA N+ L+  +R+L  +  +  
Sbjct: 336 LALNKPGAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGS 395

Query: 391 APKIFAKTNSWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILI 450
           AP+IF++ N  GVPY +L+L  +  CLA++N S+S+  +F +F N+++I G + W +  I
Sbjct: 396 APRIFSRINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCI 455

Query: 451 TYISFDRAFRVQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFI 510
            Y+ F R     G+  + L ++   Q    W +  F  ++ L   +   +   ++Y+ FI
Sbjct: 456 AYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFI 514

Query: 511 TGYIGIPVYILCFVCYKIV----HKTKWIKSAN-VDLFTYKTAIDLEEEEGKLEMMRLKE 565
             YI +PV+++ +  + I      + KW K  + +D+ T      LEE E K ++    E
Sbjct: 515 AAYITLPVFLVLYFGHIIYSGRWRQRKWWKPVDEIDVVT-----GLEEIELKTKIA--DE 567

Query: 566 ERKQHGWTWKQFYDYIF 582
           ER+ H   + +  DYI 
Sbjct: 568 ERQGHSGRFAKCLDYIL 584

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  278 bits (710), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 158/511 (30%), Positives = 266/511 (52%), Gaps = 14/511 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++++ L++RH+ +                      GP  +LI+Y IM + V+T+M  L E
Sbjct: 58  QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTE 117

Query: 117 MAAYIPLDGFTSY---ATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGK 173
           M    P+ G  S    A  Y +  L F  G+   +   ++ P+++TA+ L++QYW     
Sbjct: 118 MVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWT---D 174

Query: 174 VNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS-HN 232
            N  +++++F+ + + +  + VK FGE EFW+S  K                GGGP+ H+
Sbjct: 175 ANSAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHH 234

Query: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKNP 291
            LGF YWK PG FKP+       G  GKF++  +  + + FA+ L  E     +AE   P
Sbjct: 235 VLGFHYWKHPGAFKPHIST----GNTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRP 290

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAY-NDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           RRN+PRA    ++R+++FY+    ++G++V Y N  LL             P+V+ IK  
Sbjct: 291 RRNMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEV 350

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           GI VLPHI NA +LT  +SA  +++Y  SR L+ +A+   APKIFA+ N +GVPY S+ +
Sbjct: 351 GIKVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIV 410

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
            + FC LAY+N S+SA  +F++  N+++I G +SW+ + ITY+ F R      ++ + + 
Sbjct: 411 PSCFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIK 469

Query: 471 YQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
           ++ PFQ + A+ +  F ++++L   + VF    +    F   YI I   ++ F+     +
Sbjct: 470 FRKPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYY 529

Query: 531 KTKWIKSANVDLFTYKTAIDLEEEEGKLEMM 561
           K    +            ID+ +EE   E++
Sbjct: 530 KEWRFRDMEEIRSELIPKIDMADEEESNEIV 560

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  277 bits (709), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 164/527 (31%), Positives = 273/527 (51%), Gaps = 24/527 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++ + L+ RH+ +                      GP  +LIAY I+ + V+++M+ + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 117 MAAYIPLDG---FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGK 173
           M   IPL G     S A  Y +  + F  G+   +   ++ P ++TA AL++QYW     
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWT---D 170

Query: 174 VNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR 233
            N  ++I++F+ V + + ++ VK FGE EFW+SS K                GGGP+ + 
Sbjct: 171 ANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDH 230

Query: 234 -LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKNP 291
            LGF YWK+PG F P+       G  G+F++  +  + + F++ L  E     +AEC  P
Sbjct: 231 VLGFHYWKNPGAFNPHLAE----GNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAP 286

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYN-DPLLLQXXXXXXXXXXXPYVVAIKNA 350
           RRN+P+A +  +YR+ +FY+    ++G+ V +N D L+             P+V+ I+ A
Sbjct: 287 RRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEA 346

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           GI +LPHI NAC+LT  +S     LY  SR+LY +A+   APKIFAK N +G PY S  L
Sbjct: 347 GIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGL 406

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT-L 469
            +LF  LAY+N S SA  +F++  N+ +I G +SWI + +TYI F +   +  +D N  +
Sbjct: 407 ASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKV--INALDLNDRV 464

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            ++ PFQ   A++  GF  +++L   + VF+   ++   F   Y+ I   I  ++     
Sbjct: 465 PFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFY 524

Query: 530 HKTKW----IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
           +K +W     K   V++      ID+ +EE + +++ +     +  W
Sbjct: 525 YK-QWTFRDFKEIEVEIL---PKIDIADEEERNDVIPVPRNFMEKVW 567

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  275 bits (702), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 171/487 (35%), Positives = 253/487 (51%), Gaps = 14/487 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           RLK+ L+ RH+ M                    +AGP  + +AY ++G VV      + E
Sbjct: 49  RLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAE 108

Query: 117 MAAYIPLDGFT-SYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +A+++P  G T  +A ++ D ++GF  G+  +  Y  L P +L+A A+VM+YW     +N
Sbjct: 109 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWT---DIN 163

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
           P VWIT+F  + +  NI  ++F+GE E++    K                GG     RLG
Sbjct: 164 PAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQERLG 222

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           F YW++PG F  Y     + G  GKFV F +     +++Y G +   I+A E KN R  +
Sbjct: 223 FHYWREPGPFAEYI----VKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAI 278

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
               +    RI+V YL  V +L L V YND L+             PYV+AI+ A I +L
Sbjct: 279 FHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLI---ATGTGTAKSSPYVIAIQRANIKIL 335

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHI NA +LT  +SA N  +  GSR+L+ LA   +APKIF  TN  G+PY  +A  + F 
Sbjct: 336 PHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFL 395

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+YM+VSSS+  +FS+F  + S   LL WI I   +I  DRA + QG  ++ L +    
Sbjct: 396 PLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCL 455

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535
            P  AW +    L+  L   F  F+   FD ++F T Y  IP+ I+ F  +K+  KTK++
Sbjct: 456 GPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYL 515

Query: 536 KSANVDL 542
           + A VDL
Sbjct: 516 RPAEVDL 522

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  275 bits (703), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 158/515 (30%), Positives = 271/515 (52%), Gaps = 20/515 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++ + L++RH+ +                      GP  +LI+Y IM + V+ +M+ L E
Sbjct: 66  QVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNFLTE 125

Query: 117 MAAYIPLDGFTSY---ATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGK 173
           M   +P+ G TS       Y +  L F  G    +   ++ P+++TA A+++QYW     
Sbjct: 126 MVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWT---D 182

Query: 174 VNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR 233
            N  ++I++F+ V +++ ++ V FFGE EFW+S  K                GG P+ ++
Sbjct: 183 ANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQDK 242

Query: 234 -LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKNP 291
            LGF YWK PG F P+     +PG  GKF++  +  + + F+Y L  E+    AAE K+P
Sbjct: 243 VLGFHYWKHPGAFNPHL----VPGNTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDP 298

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXX-XXXXXXXPYVVAIKNA 350
           RRN+PR  +  +YR+ +FY+C    +G+ V Y++  LL             P+V+ I+  
Sbjct: 299 RRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEV 358

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           GI VLPHI NAC+LT  +S   S LY  SR L+ +A++   PKIFA TN +G PY S A 
Sbjct: 359 GIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAA 418

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
            ++FC LAY+N S S+  +F++  N+ +I G + W+ + + Y+ F +      +  + + 
Sbjct: 419 ASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANL-TDKMP 477

Query: 471 YQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
           ++  F    A+++ GF  +++L   + VF+ D ++   F   Y  + +  + ++   I +
Sbjct: 478 FRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYY 537

Query: 531 KTKWIKSANVDLFTY----KTAIDLEEEEGKLEMM 561
           KT  IK  ++D        K A+  EEE+G++ ++
Sbjct: 538 KT--IKLRDLDEVAAEIIPKIAMADEEEKGEVPIV 570

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  270 bits (691), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 161/503 (32%), Positives = 257/503 (51%), Gaps = 11/503 (2%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           ++ L  R VSM                      GP ++LIA+ +   V   +  C+  M 
Sbjct: 46  RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVMV 105

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            Y+P+ G F  +  R+ D + GF+VG+TY          ++TA  LV+++W    K+   
Sbjct: 106 TYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTD--KIPKA 163

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
             I++ +A+  ++N+  V  FGE EF+LS  K                GG P H  LGF+
Sbjct: 164 ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGFK 223

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
            W +PG F  Y       G  GKF  F S  ++AL+ + G +  G  A+E  NPR+ +P 
Sbjct: 224 NWSNPGAFAEYISK----GSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPS 279

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XXPYVVAIKNAGIPVLP 356
           + +    R+++FY+     +G+ V +ND  +++            PYV A+K  GI VLP
Sbjct: 280 SFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLP 339

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
           HI N  +LT + SA NS LY  SR L+ LA++ +APK+F K    GVP        L C 
Sbjct: 340 HIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCCVAVLLVCG 398

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           LAY++VS+S   + ++F+NV +    + +I I I+Y+ F +  + Q ID  TL Y + F 
Sbjct: 399 LAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFL 458

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIK 536
           P   W +L + +++  +  + VFL D++D ++FI  Y  IP +I+ F  +K+  KT+++K
Sbjct: 459 PYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFVK 518

Query: 537 SANVDLFTYKTAIDLEEEEGKLE 559
              +DLF+     +L EE+   E
Sbjct: 519 PVEMDLFS--GIAELAEEDAYWE 539

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  269 bits (688), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 163/509 (32%), Positives = 258/509 (50%), Gaps = 18/509 (3%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           ++   + + L +DL  RH+                        GP +++IA++I+   +F
Sbjct: 62  FNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLF 121

Query: 109 TVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           T+++ LGE+AA  P+  GF  Y TR  DP+LGFAV   YL ++ VL P +L AA++ ++Y
Sbjct: 122 TIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRY 181

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W     VN   W+ VF   I   +++ VK FGE EF LS  K                GG
Sbjct: 182 W--NNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGG 239

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
           GP +  +G +YW DPG F   S     PG +  F    SVFV A F+Y GTEL G+ AAE
Sbjct: 240 GPKNGYIGAKYWNDPGSFVGAS-----PGSQ--FKGLCSVFVTAAFSYSGTELVGVSAAE 292

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR  +P+A K T + I + YL  + ++G  V ++DP LL            P V+AI
Sbjct: 293 SANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAAS-PLVIAI 351

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +N GI  LP + NA +L  + S  NS +Y  SR +  +A     P+IF   ++ G P  +
Sbjct: 352 ENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVA 411

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +    +F  L+++  S+  E +F +   ++ +  L  W++I I++I F RA   QG   +
Sbjct: 412 IIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLD 471

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFV 524
            L Y +    + +W      ++V +   +T          D+++F  GY+ +P+++ CFV
Sbjct: 472 ELPYLSMTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFV 531

Query: 525 CYKIVHKTKW---IKSANVDLFTYKTAID 550
            +K+ +K  W   I+S  +D+ T +  ID
Sbjct: 532 GHKL-YKRNWSWMIRSNKIDVNTGRRMID 559

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  268 bits (686), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 157/488 (32%), Positives = 250/488 (51%), Gaps = 8/488 (1%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           ++ L  R VSM                    Q GP ++LIA+ +   V   +  C+  M 
Sbjct: 118 RRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMV 177

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            Y+P+ G F  +  R+ D + GFAVG+TY          ++TA  LV++YW    K+   
Sbjct: 178 TYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTD--KIPKA 235

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
             I++ + +  ++N+  V FFGE EF+LS  K                GG P H  LGF+
Sbjct: 236 ALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFK 295

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
            W +PG F  Y       G  G+F  F S  V+AL+ + G +  G  A+E  NPR+ +P 
Sbjct: 296 NWSNPGAFAEYIS----DGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPS 351

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XXPYVVAIKNAGIPVLP 356
           + +    R+++FY+     +G+ + YNDP +++            PYV A+K  GI VLP
Sbjct: 352 SFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLP 411

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
           HI N  +LT + SA NS LY  SR L+ LA+D +AP+IF  T   GVP        + C 
Sbjct: 412 HIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICG 471

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           LAY++VS+S   + ++F+NV +    + +I I ++Y+ F +    Q +D  +L Y +   
Sbjct: 472 LAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSL 531

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIK 536
           P  AW +L + +++ LV  +TVFL  ++D ++F+  Y  IP +++    +K+   TK ++
Sbjct: 532 PYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVR 591

Query: 537 SANVDLFT 544
              +DLFT
Sbjct: 592 PLEMDLFT 599

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  259 bits (661), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 164/526 (31%), Positives = 268/526 (50%), Gaps = 22/526 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            + + L++RH+ +                      GP  ILI+Y +M + V+T+++ L E
Sbjct: 50  EMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVWTIVNQLTE 109

Query: 117 MAAYIPLDG---FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGK 173
           M A IPL G     S A  Y    L F  G+   +   ++ P+++TA A+++QYW     
Sbjct: 110 MVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAMLIQYWT---D 166

Query: 174 VNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR 233
            N  ++I++F+   + I ++ V+ FGE EF +SS K                GGGPS + 
Sbjct: 167 ANSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFFGGGPSQDH 226

Query: 234 -LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAY-LGTELCGIVAAECKNP 291
            LGF YWK PG FK +     +PG  GKF++  +  + + F++ L  E     +AE  +P
Sbjct: 227 ILGFHYWKKPGAFKEHL----VPGSTGKFLAVWTAIIKSGFSFVLVPETVASCSAESASP 282

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXX-XXXXXXXPYVVAIKNA 350
           RRN+PRA +  +YR+ +FY+  V ++ + V  +D  LL             PYV+ IK A
Sbjct: 283 RRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASPYVIGIKEA 342

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           GI VLPHI NAC+LT  +S   ++LY  SR L+ +A+   AP+IFAK N +GVPY S A+
Sbjct: 343 GIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFGVPYYSTAV 402

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
             LF  LAY+N S S+  +F++  N+ +I G +SW+ + +TY  F        IDK  L+
Sbjct: 403 ACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTV-----IDKLDLN 457

Query: 471 YQAP----FQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCY 526
            + P    FQ   A+  + F ++++L   + VF+   ++   F   Y+ I    + F+  
Sbjct: 458 DRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVAVLFIGS 517

Query: 527 KIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            I +K    +  +         ID+ +E+ + ++  + +   +  W
Sbjct: 518 TIYYKELRFRDVSEIGREIIPKIDIADEDERNDVPVVPKNWGEKIW 563

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  259 bits (662), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 166/531 (31%), Positives = 264/531 (49%), Gaps = 29/531 (5%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           YD  +   +L KDL  RH+                        GP ++++A+ I+   +F
Sbjct: 80  YDTANDS-KLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLF 138

Query: 109 TVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           T+++ LGE+AA  P+  GF  Y TR+ +P+ GFAV   YL ++ VL P +L AA++ ++Y
Sbjct: 139 TIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRY 198

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W     +N   W+ +F   I   N++ VK FGE EF LS  K                GG
Sbjct: 199 W--NNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGG 256

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
           GPS   +G RYW DPG F         PG +  F    +VFV A F+Y GTEL  + AAE
Sbjct: 257 GPSGEYIGGRYWNDPGAF-----VGDTPGRR--FKGVCAVFVTAAFSYSGTELVAVSAAE 309

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR  +P+A K T + I + Y+  + ++G  V YND  LL            P V+AI
Sbjct: 310 SHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAAS-PLVIAI 368

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +N GI  LP + NA +L  + S  NS +Y  SR +  +A     PK     +  G P  +
Sbjct: 369 ENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYA 428

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +    +F  L+++  S   E +F++   ++ +  L  W SI +++I F +A + Q    N
Sbjct: 429 IFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLN 488

Query: 468 TLSYQAPFQPVT----AWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYI 520
            L    PF  +T    +W       +V +   +T       D  D ++F  GY+ +P++I
Sbjct: 489 EL----PFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFI 544

Query: 521 LCFVCYKIVHKTKW---IKSANVDLFTYKTAIDLE--EEEGKLEMMRLKEE 566
           +C++ +K V+K  W   +K+ ++DL T +  IDL+  ++E +LE  ++ ++
Sbjct: 545 VCYLGHK-VYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQMAQK 594

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  255 bits (652), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/455 (34%), Positives = 230/455 (50%), Gaps = 13/455 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           RLK+ L+ RH+ M                    + GP+ +LIAY  +G VV      + E
Sbjct: 47  RLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAE 106

Query: 117 MAAYIPLDGFT-SYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +A+++P  G T  +A ++ D ++GF  G+  +  Y  L P +L+A A++M+YW     V+
Sbjct: 107 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYWT---DVS 161

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
           P V+ITVF  + +  NI  ++F+GE E+     K                GG     RLG
Sbjct: 162 PAVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLG 221

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           F YW+DPG F  Y     + G  GKFV F +     +++Y G +   I+A E KN R  +
Sbjct: 222 FHYWRDPGPFANYL----VAGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAI 277

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
               K    RI+V YL TVF+L L V YND L+             P+V+A+  AGI VL
Sbjct: 278 FHGAKNVFLRIIVLYLVTVFVLTLIVPYNDKLI---ATGTGTAKSSPFVIAMNRAGIKVL 334

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHI NA +LT  +SA N  +  GSR+L+ LA   +AP+IF KT+  G+PY  +   + F 
Sbjct: 335 PHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFL 394

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LAYM+ S S+ T+F +F  + S   LL WI I   +I  DRA + QG  ++ L      
Sbjct: 395 PLAYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRI 454

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFI 510
            P  AW +    ++      F  F+   FD ++F+
Sbjct: 455 APFAAWFSGIMSVIFLFTGGFYNFMHGHFDIESFL 489

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  256 bits (655), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 161/533 (30%), Positives = 269/533 (50%), Gaps = 21/533 (3%)

Query: 48  GYDGKHKGI-RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWV 106
           G D   KG  +LKK +++RHV M                      GP  ++I Y+IMG  
Sbjct: 85  GSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSC 144

Query: 107 VFTVMSCLGEMAA-YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALV 164
           ++ ++   GE+A  Y  L G F +Y +   DPALGF+V + Y  ++L + P +L  A++ 
Sbjct: 145 LYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASIT 204

Query: 165 MQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 224
           ++YW     VNP +++ +F  VI+TIN+ G + + E EF+ ++FK               
Sbjct: 205 IKYWTT--SVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVN 262

Query: 225 XGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIV 284
            GG  +   +G +YW DPG F   SG   I   KG      S  V A FA+  TE   + 
Sbjct: 263 CGGAGNDGYIGGKYWNDPGSF---SGDKPIDHFKG----VVSTLVTAAFAFGATEFIALT 315

Query: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYV 344
           AAE  NPR+++P A K  LYRI+V Y+ ++ L+G  V +N   L+            PYV
Sbjct: 316 AAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELM--GSGGSATHASPYV 373

Query: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404
           +AI + G+ V+PH+ NA +L  V S  NS  Y  SR L  LA    AP      +  G P
Sbjct: 374 IAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRP 433

Query: 405 YNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGI 464
             ++ + ++F  ++++  S   ET+F++ + ++ +  L +W +I +++I F RA +VQG 
Sbjct: 434 TLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGR 493

Query: 465 DKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVF--LGD-TFDYKTFITGYIGIPVYIL 521
               L +++      ++ A G  L++ + + +T    +G+   D + F   Y+ +P+ I 
Sbjct: 494 SLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIA 553

Query: 522 CFVCYKIVHK--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            +  YK+  +  T +I ++ +DL + +   D  E+  K E    +E+ +  GW
Sbjct: 554 LYFGYKVWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEYREKLRNSGW 604

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  256 bits (654), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 163/539 (30%), Positives = 265/539 (49%), Gaps = 27/539 (5%)

Query: 48  GYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVV 107
           G +  HK   LKK +Q RHV M                     AGP  +LI Y+IMG ++
Sbjct: 106 GANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSIL 165

Query: 108 FTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVM 165
           + ++   GEMA  Y  L G + +Y +   D   GFAV + Y  ++L + P +L  A++ +
Sbjct: 166 YCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTI 225

Query: 166 QYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 225
           +YW     VNP V++ +F  +++TINI G + + E EF+ +  K                
Sbjct: 226 KYWTT--SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDV 283

Query: 226 GGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVA 285
           GG  +   +G +YW DPG F   +G  +I     +F   A+  V A FA+ G+E   I  
Sbjct: 284 GGAGNDGFIGGKYWHDPGAF---NGKHAID----RFKGVAATLVTAAFAFGGSEFIAITT 336

Query: 286 AECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVV 345
           AE  NPR+ +P A K  +YRI+  +L T+ LLG  V YN   LL            PYV+
Sbjct: 337 AEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLL--GSTGGGTKASPYVI 394

Query: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405
           A+ + G+ V+PH  NA +L  V S  NS  Y  +R    L+    APK+F+  +  G P 
Sbjct: 395 AVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPL 454

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
            ++ +  LF  +A+   S   E +F++ + ++ +  L +W +I ++++ F RA +VQG  
Sbjct: 455 IAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRS 514

Query: 466 KNTLSYQAPFQPVTAWIALGFCLM--VALVKNFTVFLG----DTFDYKTFITGYIGIPVY 519
              L +++       W +   C+M  + L+  F V +        D + F   Y+ +P+ 
Sbjct: 515 LGELGFKS---QTGVWGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPIL 571

Query: 520 ILCFVCYKIVHKT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQ 576
           I  +V YK+ HK    +I++  +DL +++   D E  + + E  R   ER ++G  WK+
Sbjct: 572 IALYVGYKVWHKDWKLFIRADKIDLDSHRQIFDEELIKQEDEEYR---ERLRNGPYWKR 627

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  255 bits (651), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 165/534 (30%), Positives = 259/534 (48%), Gaps = 28/534 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LKK ++ RHV M                     AGP  ++I Y+IMG  ++ ++   GEM
Sbjct: 142 LKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEM 201

Query: 118 AAYIP--LDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           A      L GF +Y +   DP  GFAV + Y  ++L + P +L   +L ++YW     VN
Sbjct: 202 AVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTT--TVN 259

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
           P  ++ +F  VI+ I I G + + E EF+ +  K                GG  +   LG
Sbjct: 260 PDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLG 319

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F+  +G         +F    + FV A FA+  TE   + AAE  NPR+ +
Sbjct: 320 AKYWHDPGAFRGTNGIQ-------RFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAI 372

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P A K  LYR++  ++ T+ LLG  V ++   L+            PYV+AI   G+ V+
Sbjct: 373 PSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLM--GAGGSATKASPYVLAISIHGVRVV 430

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PH  NA +L  VFS  NS  Y  SR L GLA    APK F   +  G P+ ++    LF 
Sbjct: 431 PHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFG 490

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            +A+   S   + +F++ + ++ +  L +WI+I +++I F RA  VQG     + ++A  
Sbjct: 491 VIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQL 550

Query: 476 QPVTAWIALGFCLMVALVKNFTVFL------GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
               ++ A    +++AL+  F V +      GD  D + F   Y+ +P+ I  +  YK+ 
Sbjct: 551 GVYGSYYAT-IMMVLALIAQFWVAIAPIGNNGD-LDAEGFFENYLAMPILIAFYFGYKL- 607

Query: 530 HKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
            K  W   I++ ++DL +Y+   D  EE  K E    KE+ K +G  WK+  D+
Sbjct: 608 WKRDWRLFIRAKDIDLDSYRQVFD--EELLKQEDEEYKEKLK-NGPMWKRVVDF 658

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  253 bits (645), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 157/529 (29%), Positives = 263/529 (49%), Gaps = 14/529 (2%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           D       + + L++RHV                        GP  +LI+YS+M + V+ 
Sbjct: 56  DTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWA 115

Query: 110 VMSCLGEMAAYIPLDGFTSYAT---RYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQ 166
           +M+ + EM   IPL G +S A+    Y +    F  G+   +   ++ P ++TA AL+++
Sbjct: 116 IMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIE 175

Query: 167 YWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
           YW      N  +++T+F+ +   ++++ VK FGE EF +S  K                G
Sbjct: 176 YWT---DANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFG 232

Query: 227 GGPS-HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGT-ELCGIV 284
           GGP+ H  LGF YW  PG F  Y     + G  G F++     + + FA++   E+    
Sbjct: 233 GGPAQHKVLGFHYWNTPGAFNSYL----VKGSTGAFLAVWKAIIKSGFAFVMIPEITSSC 288

Query: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXX-XXXXXXXPY 343
           +AE   PR+N+PRA +  +YR+ VFY+    ++G+ V Y++  L +            P+
Sbjct: 289 SAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPF 348

Query: 344 VVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGV 403
           V+ I+ AGI +LPHI NAC+LT  +S   S+LY  SR L+ LA+   APK F+K N +GV
Sbjct: 349 VIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGV 408

Query: 404 PYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQG 463
           PY S+A  +LF  LAY+N S S+  +F++  N+ +I G ++W+ + ITY+ F +      
Sbjct: 409 PYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLK 468

Query: 464 IDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCF 523
           I+ + + Y+   Q   A+ +  F  ++A+   F VF+   ++   F T Y+ I    + F
Sbjct: 469 IN-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLF 527

Query: 524 VCYKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
           +   I +K    +  +V        ID  ++E K E +   +   +  W
Sbjct: 528 IGSSIYYKEWTFRDMDVVGREIMPKIDQADQEEKEEYLPPPKNWVERVW 576

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  249 bits (636), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 163/535 (30%), Positives = 260/535 (48%), Gaps = 29/535 (5%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
           +K   LKK +Q RHV M                     AGP  +LI Y IMG +++ ++ 
Sbjct: 111 NKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQ 170

Query: 113 CLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
             GEMA  Y  L G + +Y +   D   GFAV + Y  ++L + P +L  A++ ++YW  
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
              VNP V++ +F  +++TINI G + + E EF+ +  K                GG  +
Sbjct: 231 --SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
              +G +YW DPG F   +G  SI     +F    +  V A FA+ G+E   I  AE  N
Sbjct: 289 DGFIGGKYWHDPGAF---NGKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQAN 341

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR+ VP A K  +YRI+  +L T+ LLG  V YN   LL            PYV+A+ + 
Sbjct: 342 PRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLL--GSSGGGTKASPYVIAVASH 399

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           G+ V+PH  NA +L  V S  NS  Y  +R L  L+    AP++F   +  G P  ++ +
Sbjct: 400 GVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGV 459

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
             LF  +A+   S   + +F++ + ++ +  L +W +I +++I F RA +VQG     L 
Sbjct: 460 SALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELG 519

Query: 471 YQAPFQPVTAWIALGFCLM--VALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFV 524
           +++       W +   C+M  + L+  F V +        D + F   Y+ +P+ I  +V
Sbjct: 520 FRS---QTGVWGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYV 576

Query: 525 CYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQ 576
            YKI  K  W   I++  +DL +++   D E  + + E  R   ER ++G  WK+
Sbjct: 577 GYKI-WKKDWKLFIRADKIDLISHRQIFDEELIKQEDEEFR---ERLKNGPCWKR 627

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  248 bits (633), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 158/517 (30%), Positives = 261/517 (50%), Gaps = 26/517 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+ L+ RH+ M                      GP A++IA+ + G +V++V+  LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A  +P+ G + SY +R+ +P+ GFA+ Y YL   L+  P +L AA++ + YW    K   
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKY-A 207

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS-HNRLG 235
             ++ +F  VI+ IN+ GVK +GE EF  S  K                GGGPS    +G
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            RYW +PGGF               F  FA++FV + F++ G+E+  + AAE +NPR+++
Sbjct: 268 ARYWYNPGGFAH------------GFKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDL 315

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           PRA K   +RI +FY+ ++ L+G  V Y D  L             P+V+AI  AGI  L
Sbjct: 316 PRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS--PFVIAIARAGIKGL 373

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + N  +L  V S  N  +Y  SR++  LA     P+ F   +  G P   + LC +F 
Sbjct: 374 PSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFG 433

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L++++ SS+   +F + + ++ +     W SI + ++ F RA  VQG   + LSY+A  
Sbjct: 434 LLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQT 493

Query: 476 QPVTAWIALGFCLMVALVKNFTVF--LGDTFDYKTFITGYIGIPVYILCFVCYKIVHK-- 531
               +   +G   +V   + +     +G + +   F + Y+ +PV I  + C+K+  +  
Sbjct: 494 GIWGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSW 553

Query: 532 TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERK 568
           T  IKS+++D+ T +  +DLE     L    ++EE++
Sbjct: 554 TFLIKSSDIDIDTGRREMDLE-----LLKQEIQEEQQ 585

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  246 bits (629), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 162/520 (31%), Positives = 258/520 (49%), Gaps = 21/520 (4%)

Query: 56  IRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLG 115
           + L K+L  RH+                        GP +++I + I+   +FTV++ LG
Sbjct: 68  VNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALG 127

Query: 116 EMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           EMAA  P+  GF  Y TR+ DP++GFAV   YL ++LVL P +L AA++ ++YW     +
Sbjct: 128 EMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NDTI 185

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N   W+ +F AVI   N++ VK FGE EF LS  K                GGGP    L
Sbjct: 186 NSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYL 245

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW +PG F  ++          KF    SVFV A F+Y G E+  + AAE K+PRR 
Sbjct: 246 GGKYWHNPGSFVGHTSGT-------KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRT 298

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           +P+A K T + I   Y+  + L+G  V Y++P LL            P V+AI+N GI  
Sbjct: 299 IPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASS-PLVIAIENGGIKG 357

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           LP + NA +L  + S  NS +Y  SR +  +A     P++    +  G P N++     F
Sbjct: 358 LPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFF 417

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L+++  S     +F++   ++ +  +  W++I I++I F +A + Q    + L Y + 
Sbjct: 418 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQ 477

Query: 475 FQPVTAW---IALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
                +W   I L   L+V+   +     G   D ++F  GY+  P+ I C+V +K+V++
Sbjct: 478 TGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYR 537

Query: 532 TKWIKSA--NVDLFTYKTAIDLEEEEGKLEMMRLKEERKQ 569
            K I  A  ++D+ T +  +DL      +    +KEE++ 
Sbjct: 538 KKQIVVALEDMDIDTGRRQVDL-----TIRRQEMKEEQEH 572

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  247 bits (631), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 163/542 (30%), Positives = 265/542 (48%), Gaps = 39/542 (7%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
            + K   L+K ++ RHV +                    +AGP  ++I Y+IMG  ++ +
Sbjct: 124 AEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCI 183

Query: 111 MSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           +   GEMA AY  L G F +Y +   D A GF+V + Y  ++L + P +L  A++ +QYW
Sbjct: 184 IQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW 243

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                VN  V++ +F  +I+ IN+ G K + E EF+ +S K                GG 
Sbjct: 244 TT--TVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA 301

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +G +YW +PG F+   G  SI     +F    S F  A FA+  +E   I A+E 
Sbjct: 302 GNDGYIGAKYWHNPGAFR---GDKSI----DRFKDVMSTFTTAAFAFGASEFIAIGASEQ 354

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPRR +P A K  +YRI+  +L ++ L+G  V YN   L+            PYV+A+ 
Sbjct: 355 SNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM--GSGSAATKASPYVIAVA 412

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           + G+ V+PH  NA +L  V S  NS  Y   R LY L+    AP  F   +  G P  ++
Sbjct: 413 SHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAM 472

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +  LF  +A+   SS  E +F++ + ++ +  L +WI+I +++I F RA +VQG   + 
Sbjct: 473 IMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDE 532

Query: 469 LSYQAPFQPVTAWIA--LGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILC 522
           + +++    V  W +      + +AL+  F V +     D  D + F   Y+ +P+ I+ 
Sbjct: 533 IGFKS---QVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVL 589

Query: 523 FVCYKIVHKTKW---IKSANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQHGWTW 574
           +  YKI  K  W   I++ ++DL +++   D      EEEE K        ER ++G  W
Sbjct: 590 YFGYKIC-KRDWKLFIRAKDIDLVSHRKIYDGELIKQEEEEFK--------ERLRNGPFW 640

Query: 575 KQ 576
           K+
Sbjct: 641 KK 642

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  246 bits (628), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 161/534 (30%), Positives = 260/534 (48%), Gaps = 27/534 (5%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
           +K   LKK +Q RHV M                     AGP  +LI Y+IMG +++ ++ 
Sbjct: 111 NKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 113 CLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
             GE+A  Y  L G + +Y +   D   GFAV + Y  ++L + P +L  A++ ++YW  
Sbjct: 171 ACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
              VNP V++ +F  +++TINI G + + E EF+ +  K                GG  +
Sbjct: 231 --SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGN 288

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
              +G +YW DPG F   +G  SI     +F    +  V A FA+ G+E   I  AE  N
Sbjct: 289 DGFIGGKYWHDPGAF---NGKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSN 341

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR+ +P A K  +YRI+  +L T+ +LG  V YN   LL            PYV+AI + 
Sbjct: 342 PRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLL--GSGGGGTKASPYVIAIASH 399

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           G+ V+PH  NA +L  V S  NS  Y  +R    L+    APK F+  +  G P  ++ +
Sbjct: 400 GVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGV 459

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
             LF  +A+   S   E +F++ + ++ +  L +W +I  ++I F RA +VQG     L 
Sbjct: 460 SALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELG 519

Query: 471 YQAPFQPVTAWIALGFCLM--VALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFV 524
           +++       W ++  C+M  + L+  F V +        D + F   Y+ +P+ I  +V
Sbjct: 520 FKS---QTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYV 576

Query: 525 CYKIVHKT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQ 576
            YKI  K    +I++  +DL +++   D E  + + E  R   ER ++G  WK+
Sbjct: 577 GYKIWTKDWKLFIRADKIDLESHRQIFDEELIKQEDEEYR---ERLRNGPYWKR 627

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  244 bits (622), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 165/522 (31%), Positives = 263/522 (50%), Gaps = 28/522 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L K+L  RH+                        GP ++++ + I+   +FTV++ LGE
Sbjct: 42  NLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINSLGE 101

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +AA  P+  GF  Y TR+ DP++GFAV   YL ++LVL P +L AA+L ++YW    K+N
Sbjct: 102 LAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYW--NDKIN 159

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F   I+  N++ VK FGE EF LS  K                GGGPS   LG
Sbjct: 160 SDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYLG 219

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           F+YW +PG F   + A        KF    SVFV A F++ G E+  + AAE KNPR+ +
Sbjct: 220 FKYWNNPGAFVGGTNA-------SKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + +   Y+  + L+G  V YND  LL            P V+AI+N GI  L
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAAS-PLVIAIENGGIKGL 331

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  + S  NS +Y  SR +  +A     PK+ +K +  G P N+L +  +F 
Sbjct: 332 PSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFG 391

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S     +F++   ++ +  +  W++I  + I F RA +VQ    + L Y +  
Sbjct: 392 LLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQT 451

Query: 476 QPVTAWIALGFCLMVALVKNF--TVF-LGDTF-DYKTFITGYIGIPVYILCFVCYKIVHK 531
               AW  +   L + +V +F  ++F LG    D ++F   ++ +P+ ++C+  +K+   
Sbjct: 452 GIWGAWYGV-LVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFA 510

Query: 532 TKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
             W   I +  +D+ + +  ID   EEG      LK+ER++ 
Sbjct: 511 RNWRLQIGAEEMDIDSGRKIID---EEG------LKQEREEE 543

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  244 bits (623), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 159/521 (30%), Positives = 263/521 (50%), Gaps = 20/521 (3%)

Query: 54  KGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSC 113
           K  +L KDL  RH+                        GP +++IA++I+   +FT+++ 
Sbjct: 60  KDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNS 119

Query: 114 LGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRG 172
           LGE++A  P+  GF  Y TR+ +P+ GFAV + YL ++ +L P +L AA++ ++YW    
Sbjct: 120 LGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYW--NK 177

Query: 173 KVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN 232
            +NP  W+++F   I   N++ VK FGE EF LS  K                GGGPS  
Sbjct: 178 SINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGG 237

Query: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292
            +G +YW DPG F   + A        +F   ++VF+ A F+Y G EL G+ AAE +NPR
Sbjct: 238 FIGGKYWNDPGAFVGDTPA-------QRFKGLSAVFITAAFSYSGLELVGVSAAESRNPR 290

Query: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI 352
             +P+A K T + I + YL  + L+G  V  NDPLLL            P V+AI+N GI
Sbjct: 291 VTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAAS-PLVIAIQNGGI 349

Query: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412
             LP + NA +L  + S  NS +Y  SR +  +A     P+  A  +  G P  ++A+  
Sbjct: 350 KGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITL 409

Query: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472
           L   L+++  S+  + +F++   ++ +  L  W +I + ++ F  A + Q      L Y 
Sbjct: 410 LVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYV 469

Query: 473 APFQPVTAW---IALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +      +W   I +G  L+ +   +     G+  D  +F   Y+ +P++I C++ +KI 
Sbjct: 470 SMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIW 529

Query: 530 HKT--KWIKSANVDLFTYKTAIDL----EEEEGKLEMMRLK 564
            +    +IK + VD+ + +T  D     +E+E + E+M+ K
Sbjct: 530 KRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTK 570

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  244 bits (624), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 161/527 (30%), Positives = 254/527 (48%), Gaps = 21/527 (3%)

Query: 54  KGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSC 113
            G  L KDL  RH+                        GP +++I + I+   +FTV++ 
Sbjct: 85  DGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINS 144

Query: 114 LGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRG 172
           LGE+AA  P+  GF+ Y TR+ DP++ F++   YL ++LVL P +L AA++ ++YW    
Sbjct: 145 LGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYW--ND 202

Query: 173 KVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN 232
           K+N   W+++F  VI  +N++ VK FGE EF LS  K                GGGP   
Sbjct: 203 KINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGG 262

Query: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292
            +G +YW DPG F  ++          +F    SVFV A F+Y G E+  + AAE  +PR
Sbjct: 263 YIGGKYWHDPGAFVGHTAG-------SQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPR 315

Query: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI 352
           + +P A K T + I   Y+  + L+G  V Y+DP LL            P V+AI+N GI
Sbjct: 316 KTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASS-PLVIAIENGGI 374

Query: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412
             LP + NA +L  V S  NS +Y  SR +  +AI    PK   + +  G P N+  +  
Sbjct: 375 KGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTL 434

Query: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472
            F  ++++  S     +F++   ++ +  +  W+ I I++I F RA  +QG     + Y 
Sbjct: 435 FFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYL 494

Query: 473 APFQPVTAW---IALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
           +      +W   I L   L+ A   +         +  TF  GY+ +P+ + C+V +K  
Sbjct: 495 SQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFY 554

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQ 576
            K       N  LFT    IDL+  +  +++  L+EE+K      K+
Sbjct: 555 FK-------NWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALKK 594

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  244 bits (624), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 164/545 (30%), Positives = 265/545 (48%), Gaps = 42/545 (7%)

Query: 48  GYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVV 107
           G D  H    L+K ++ RHV M                    +AGP A++I Y IMG  +
Sbjct: 113 GDDDAH----LQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCL 168

Query: 108 FTVMSCLGEMAA-YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVM 165
           + ++   GEMA  Y  L G F +Y +   D  + F V + Y  ++L + P +L  A++ +
Sbjct: 169 YCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTI 228

Query: 166 QYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 225
            YW    KVN  V++ +F  +I  IN  G K + E EF+ +S K                
Sbjct: 229 DYWTT--KVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINT 286

Query: 226 GGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVA 285
           GG  +   +G +YW +PG F+   G  SI     +F    S F  A FA+  +E   I A
Sbjct: 287 GGAGNDGYIGAKYWHNPGAFR---GDKSI----DRFKDVMSTFTTAAFAFGASEFIAIGA 339

Query: 286 AECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVV 345
           +E  NPRR +P A K  +YRI+  +L ++ L+G  V Y+   LL            PYV+
Sbjct: 340 SEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQAS-PYVI 398

Query: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405
           A+ + G+ V+PH  NA +L  V S  NS  Y   R LY LA    APK F   +  G P 
Sbjct: 399 AVASHGVRVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPA 458

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
            ++ + T+F  +A+ + S   E +F++ +++  +  L +W +I +++I F RA +VQG  
Sbjct: 459 RAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRS 518

Query: 466 KNTLSYQAPFQPVTAWIA--LGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVY 519
            + + +++    V  W +      +++AL+  F V +     D  D + F   Y+ +P+ 
Sbjct: 519 VDEIGFKS---QVGVWGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPIL 575

Query: 520 ILCFVCYKIVHKTKW---IKSANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQHG 571
           I+ +  YKI +K  W   I++ ++DL +++T  D      EEEE K        E+ ++G
Sbjct: 576 IVLYFGYKI-YKKDWKLFIRAKDIDLISHRTIFDGELVRQEEEEYK--------EKLRNG 626

Query: 572 WTWKQ 576
             WK+
Sbjct: 627 PKWKR 631

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  245 bits (626), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 160/541 (29%), Positives = 264/541 (48%), Gaps = 26/541 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           + + K   LKK ++ RH  M                     AGP  ++I Y+IMG  V+ 
Sbjct: 137 EQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 110 VMSCLGEMAAYIP--LDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           ++   GE+A      + GF +Y     DPALGF+V + +  ++L + P +L  A++ ++Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W    KV+P V++ +F  +I+ IN+ G K + E +F+ +  K                GG
Sbjct: 257 WTV--KVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGG 314

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
             +   +G +YW+DPG F+   G   I     +F    + FV A FA+  +E   + A+E
Sbjct: 315 AGTDGYIGSKYWRDPGAFR---GDTPIQ----RFKGIVATFVTAAFAFGMSEQLAMTASE 367

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR+ +P A K  +YRI+  +L ++ L+G  V Y    LL            PYV+A+
Sbjct: 368 QSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLL--GAAGSATKASPYVIAV 425

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
            + G+ V+PH  NA +L  V S  NS  Y  SR L  LA    APK F   +  G P  +
Sbjct: 426 SSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVA 485

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           + +  LF  +A+   S   E +F++ + ++ +  L +WI+I +++I F RA +VQG    
Sbjct: 486 MLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLG 545

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILC 522
            + Y++      +  A+   +M+AL+  F V +     G     ++F   Y+ +P+ I  
Sbjct: 546 EVGYKSQVGVWGSAYAV-LMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIAL 604

Query: 523 FVCYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYD 579
           ++ +K V K  W   I +  VDL +++   D  EE  K E    K ER ++G  WK+  D
Sbjct: 605 YIFFK-VWKNDWSLFIPANKVDLVSHRNIFD--EELLKQEDEEYK-ERLRNGPYWKRIVD 660

Query: 580 Y 580
           +
Sbjct: 661 F 661

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  244 bits (623), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 262/534 (49%), Gaps = 27/534 (5%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
           HK   LKK +Q RHV M                     AGP  +LI Y+IMG +++ ++ 
Sbjct: 111 HKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 113 CLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
             GEMA  Y  L G + +Y +   D   GFAV + Y  ++L + P +L  A++ ++YW  
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
              VNP V++ +F  +++TINI G + + E EF+ +  K                GG  +
Sbjct: 231 --SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
              +G +YW +PG F   +G  +I     +F    +  V A FA+ G+E   I  AE  N
Sbjct: 289 DGYIGGKYWHEPGAF---NGVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSN 341

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR+ +P A K  +YRI+  +L T+ ++G  V YN   LL            PYV+AI + 
Sbjct: 342 PRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLL--GSSGGGTKASPYVIAIASH 399

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           G+ V PH  NA +L  V S  NS  Y  +R    L+    APKIF+  +  G P  ++ +
Sbjct: 400 GVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCV 459

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
             LF  +A+   S   + +F++ + ++ +  L +W +I +++I F RA +VQG     L 
Sbjct: 460 SALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELG 519

Query: 471 YQAPFQPVTAWIALGFCLM--VALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFV 524
           +++       W ++  C+M  + L+  F V +        D + F   Y+ +P+ I+ +V
Sbjct: 520 FKS---QTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYV 576

Query: 525 CYKIVHKT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQ 576
            YK+ +K    +I++  +DL +++   D E  + + +  R   ER + G  W++
Sbjct: 577 GYKMWNKDWKLFIRADKIDLTSHRQIFDEELIKQEDDEYR---ERLRTGPYWRR 627

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  245 bits (625), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 160/542 (29%), Positives = 264/542 (48%), Gaps = 28/542 (5%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           + + K   LKK ++ RH  M                     AGP  ++I Y+IMG  V+ 
Sbjct: 137 EQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 110 VMSCLGEMAAYIP--LDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           ++   GE+A      + GF +Y     DPALGF+V + +  ++L + P +L  A++ ++Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W     VNP V++ +F  +I+ IN+ G K + E +F+ +  K                GG
Sbjct: 257 WTT--SVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGG 314

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
             +   +G +YW+DPG F+   G   I     +F    + FV A FA+  +E   + A+E
Sbjct: 315 AGTDGYIGSKYWRDPGAFR---GDTPIQ----RFKGVVATFVTAAFAFGMSEQLAMTASE 367

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR+ +P A K  +YRI+  +L ++ L+G  V Y    LL            PYV+A+
Sbjct: 368 QSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLL--GAAGSATKASPYVIAV 425

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
            + G+ V+PH  NA +L  V S  N   Y  SR L  LA    APK F   +  G P  +
Sbjct: 426 SSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAA 485

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           + +  LF  +A+   S   E +F++ + ++ +  L +WI+I +++I F RA +VQG    
Sbjct: 486 MLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLG 545

Query: 468 TLSYQAPFQPVTAWIALGFCLM--VALVKNFTVFL-----GDTFDYKTFITGYIGIPVYI 520
            + Y++    V  W +    LM  +AL+  F V +     G     ++F   Y+ +P++I
Sbjct: 546 EVGYKS---QVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWI 602

Query: 521 LCFVCYKIVHK--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFY 578
             ++ YK+  K  + +I +  VDL +++   D  EE  K E    K ER ++G  WK+  
Sbjct: 603 ALYIFYKVWKKDWSLFIPADKVDLVSHRNIFD--EELLKQEDEEYK-ERLRNGPYWKRVL 659

Query: 579 DY 580
           D+
Sbjct: 660 DF 661

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  242 bits (617), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 156/517 (30%), Positives = 250/517 (48%), Gaps = 23/517 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            LKK +++RHV M                      GP A++I Y ++ +V + ++   GE
Sbjct: 65  HLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGE 124

Query: 117 MAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA   P     F +Y + +    +GFA  + +L ++L + P +L    + +QYW     +
Sbjct: 125 MAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYW--NDSI 182

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  VWI +F   +L +++ GVK +GE EF  ++ K                GG  +   +
Sbjct: 183 NADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYI 242

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YWK+PG F   + A       G+F     V V A F+Y GTEL  +   E  NPRR+
Sbjct: 243 GAKYWKNPGSFASSTSA-------GRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRS 295

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P+A K ++YRI++ YL T+ L+G +V +++  L+            PYV+A    G+ V
Sbjct: 296 TPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLM--GAGGSSTHASPYVLAASIHGVKV 353

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY   R    LA    APK  A  +  G P  +LA C + 
Sbjct: 354 VPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVV 413

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             +A+   SS  E +F++   + ++  L +W +IL+++I F  A +VQG D N L Y+A 
Sbjct: 414 GVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKAL 473

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
                +    GFC++V  +  F V L   G T   + F   Y+  P+++  +  Y +  +
Sbjct: 474 TGVWGSMWGFGFCVLV-FIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKR 532

Query: 532 --TKWIKSANVDLFTYKTAIDLE----EEEGKLEMMR 562
             T   K  ++DL  ++   D E    E+E + E +R
Sbjct: 533 DFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKIR 569

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  243 bits (619), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 167/519 (32%), Positives = 259/519 (49%), Gaps = 20/519 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++ KDL  RH+                        GP +++I + I+   +FTV++ LGE
Sbjct: 95  QMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGE 154

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +AA  P+  GF  Y TR+ DP+ GFAV   YL ++LVL P +L AA++ ++YW    K+N
Sbjct: 155 LAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYW--NDKIN 212

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F A I   N++ VK FGE EF LS  K                GGGP    +G
Sbjct: 213 SDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIG 272

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F   +          KF    SVFV A F+Y G EL  + AAE  NPR  +
Sbjct: 273 GKYWHDPGAFVGETSGT-------KFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETI 325

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + I + Y+  + L+G  V YN+P LL            P V+AI+N GI  L
Sbjct: 326 PKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASS-PLVIAIENGGIRGL 384

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  + S  NS +Y  SR +  +A  +  P+   + +  G P N+  L   F 
Sbjct: 385 PSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFG 444

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S   E +F++   ++ +  + +W++I +++I F +A   QGI  + L Y +  
Sbjct: 445 LLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMT 504

Query: 476 QPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYK--IV 529
               +W  +   L + LV +F   L    G   D  +F  GY+  P+ I+C+V +K  I 
Sbjct: 505 GVSGSWYGV-IVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIR 563

Query: 530 HKTKWIKSANVDLFTYKTAIDLE--EEEGKLEMMRLKEE 566
            K   I  A++DL + +  +D+E   EE ++E  +L + 
Sbjct: 564 KKRLLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKR 602

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  243 bits (620), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 168/540 (31%), Positives = 262/540 (48%), Gaps = 35/540 (6%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
             K   LKK ++ RHV M                    +AGP A++I Y+IMG  ++ ++
Sbjct: 114 NEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCII 173

Query: 112 SCLGEMAA-YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
              GE+A  Y  L+G F +Y +   DPALGF+V + Y  ++L + P +L  A++ ++YW 
Sbjct: 174 QAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWT 233

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
              KV+P V++ +F  +I+ IN  G + + E EF+ +  K                GG  
Sbjct: 234 T--KVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAG 291

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           +   LG +YW DPG F   +G  SI     +F      FV A FA+  TE   + AAE  
Sbjct: 292 NDGYLGAKYWHDPGAF---NGDKSID----RFKGVMDTFVTAAFAFGATEFIALTAAEQS 344

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR+ +P A K  LYRIV  +L ++ L+G  V YN   LL            PYV+A+ +
Sbjct: 345 NPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLL--GSGGSGIKASPYVIAVSS 402

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
            G+ V+PH  NA +L  V S  NS  Y  SR L  LA    APK F   +  G P+ ++ 
Sbjct: 403 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAML 462

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           +  LF  +A+   S     +FS+ + ++ +  L +WI+I +++I F RA +VQG     +
Sbjct: 463 MSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEV 522

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFVC 525
            Y +    V         L +AL+  F V +        D + F   Y+ +P+ I  +  
Sbjct: 523 GYLSQ-SGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFG 581

Query: 526 YKIVHKTKW---IKSANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQHGWTWKQF 577
           Y+ V K  W   I++ ++DL T++   D      E+EE K        E+ ++G  W++F
Sbjct: 582 YR-VWKRDWKLFIRAKDIDLDTHRQIFDENILRQEDEEYK--------EKLRNGPMWRRF 632

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  242 bits (617), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 167/545 (30%), Positives = 267/545 (48%), Gaps = 29/545 (5%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           D      +L K+L  RH+                        GP +ILIA++++   +FT
Sbjct: 101 DAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFT 160

Query: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
           +++ LGE+A+  P+  GF  Y TR+ +P+ GFAV  +YL ++ VL P +L AA++ ++YW
Sbjct: 161 IVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYW 220

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
               K+N   W+ +F   I   N++ VK FGE EF LS  K                GGG
Sbjct: 221 --NNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGG 278

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P    +G +YW DPG F         PG +  F    SVFV A F+Y GTEL G+ AAE 
Sbjct: 279 PVGGFIGAKYWHDPGAF-----VGDTPGAQ--FKGLCSVFVTAAFSYSGTELVGVSAAES 331

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR  +PRA K + + I   YL  + + G  V  NDP LL            P V+AI+
Sbjct: 332 INPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAAS-PLVIAIE 390

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           N GI  +P + NA +L  + S  NS +Y  SR +  +A     PK+F   +  G P  ++
Sbjct: 391 NGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAI 450

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
               +F  L+++  S   E +F++   ++ +  L  W +I I++I F RA   Q    + 
Sbjct: 451 LATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDE 510

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVC 525
           L Y +    + +W      L V ++  +T            ++F  GY+  P++++C++ 
Sbjct: 511 LPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYIS 570

Query: 526 YKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEER-KQHGWTWKQFYDYI 581
           +K+ +K  W   I +  +D+ + + A+D+EE         LKE++ ++   T K+ + Y+
Sbjct: 571 HKL-YKRDWRLFIPAGQIDVDSGRRALDIEE---------LKEQKLREQAETAKKPF-YV 619

Query: 582 FGWIF 586
             WIF
Sbjct: 620 RWWIF 624

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  243 bits (619), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 164/540 (30%), Positives = 270/540 (50%), Gaps = 28/540 (5%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
           ++K   LKK ++ RHV M                     AGP  +L+ + IMG  ++ ++
Sbjct: 143 ENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCII 202

Query: 112 SCLGEMA-AYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
             +GEMA AY  L  GF +Y +   DPA GF+V + Y  ++L + P +L  A++ ++YW 
Sbjct: 203 QAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWT 262

Query: 170 GRGKVNPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
              KV+P V++ +F  +IL INIVG    + E EF  +S K                GG 
Sbjct: 263 T--KVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGA 320

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
            +   +G +YW +PG F+   G  +I     +F    +  V A FA+  +E  G+ A+E 
Sbjct: 321 GNDGYIGGKYWHEPGAFR---GEHAI----DRFKGVMATLVNAAFAFGMSEFIGVTASEQ 373

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR+ +P A K  LYRIV  +L ++ ++G  V Y+   LL            PYV+A+ 
Sbjct: 374 SNPRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLL--GSSGGGVKASPYVLAVS 431

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
             G+ V+PH  NA +L  V S  NS  Y  SR L  LA    APKIF   +  G P   +
Sbjct: 432 THGVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGM 491

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
           A+ +LF  +A+   S   + +F + + ++ +  L +WI+I ++++ F RA  VQG     
Sbjct: 492 AMASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGE 551

Query: 469 LSYQAPFQPVTAWIA-----LGFCLMVALVKNFTVFLGD-TFDYKTFITGYIGIPVYILC 522
           L +++    V AW +     +  C+++A        +G+   D K F   Y+ +P+ +  
Sbjct: 552 LGFRS---QVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLAL 608

Query: 523 FVCYKIVHK--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           +  YKI  K  T +I++ ++DL +++   D E  + + E  R   E+ ++G  W++ YD+
Sbjct: 609 YFGYKIYTKNWTIFIRAKDIDLVSHRNIFDEEIIKQEEEEYR---EKLRNGPMWRRVYDF 665

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  240 bits (613), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 165/529 (31%), Positives = 260/529 (49%), Gaps = 24/529 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L KDL  RH+                        GP +++I + I+   +FTV++ LGE
Sbjct: 85  NLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGE 144

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           ++A  P+  GF  Y+ R+ +P+  FAV   YL ++LVL P +L AA++ ++YW    K+N
Sbjct: 145 LSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKIN 202

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F A I   N++ VK FGE EF LS  K                GGGP    +G
Sbjct: 203 SDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIG 262

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F  +S          +F    SVFV A F+Y G E+  + AAE KNPR  +
Sbjct: 263 GKYWHDPGAFVGHSSGT-------QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + I   Y+  + L+G  V  NDP LL            P V+AI+N GI  L
Sbjct: 316 PKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKGL 374

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  V S  NS +Y  SR +  +A     PK   + +  G P N++ L   F 
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S     +F++   ++ +  +  W++I +++I F +A +VQ    + L + +  
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQT 494

Query: 476 QPVTAWIALGFCLMVALVKNF--TVF-LGDT-FDYKTFITGYIGIPVYILCFVCYKIVHK 531
               +W      L + L+ +F  ++F LG +  + ++F  GY+  P+ I+C+  +KI  +
Sbjct: 495 GVKGSWYGF-IVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTR 553

Query: 532 --TKWIKSANVDLFTYKTAID--LEEEEGKLEMMRLKEE----RKQHGW 572
             T  +K  ++DL T +  +D  L  EE K+E   L +     R  H W
Sbjct: 554 NWTLMVKLEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRFLHFW 602

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  240 bits (613), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 157/535 (29%), Positives = 264/535 (49%), Gaps = 28/535 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LKK +Q RHV M                     AGP  ++I Y+IM   ++ VM  +GE
Sbjct: 98  KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGE 157

Query: 117 MAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA  Y+ L  GF++Y     DP L FAV + Y  ++  + P +L  A++ +QYW    KV
Sbjct: 158 MAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTT--KV 215

Query: 175 NPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR 233
           N  +++ +F  +++ INI G  + + E EF+ +  K                GG  +   
Sbjct: 216 NADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGF 275

Query: 234 LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRR 293
           +G RYW  PG F+  +G         +F    S  V A FA+ GTE   I A+E  NPR+
Sbjct: 276 IGARYWHSPGAFRGDNGI-------NRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRK 328

Query: 294 NVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIP 353
            +P A K  +YR ++ Y+ ++ ++G  V YN   LL            PYV+A+ + GI 
Sbjct: 329 AIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKAS--PYVIAVASHGIR 386

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
           V+PH  NA +L  VFS  +S  Y  SR L  LA    APKIF   +  G P     +  +
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAI 446

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
              +++   SS    +F++ ++++ +  + +W  I +++I F RA +VQG   + + +++
Sbjct: 447 IAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKS 506

Query: 474 PFQPVTAWIAL-GFCLMV-ALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYK 527
                  W ++  F +M+  L+  F V +     D+ D  +F   Y+ +PV+I+ +  YK
Sbjct: 507 ---QAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYK 563

Query: 528 IVHKT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           I ++    +I++ N+DL  ++   D E    + + MR   ER ++   W++ Y++
Sbjct: 564 IWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMR---ERARNAPLWRKIYNF 615

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  241 bits (614), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 155/535 (28%), Positives = 263/535 (49%), Gaps = 28/535 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            LKK ++ RH+ M                     AGP  ++I Y+IMG  ++ ++   GE
Sbjct: 142 NLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGE 201

Query: 117 MAAYIP--LDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           +A      + GF +Y +   DPALGF+V + Y  ++L + P +L  A++ ++YW    KV
Sbjct: 202 LAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTV--KV 259

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           +P V++ +F  +I+ IN+ G K + E +F+ +  K                GG  +   +
Sbjct: 260 DPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYI 319

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G RYW +PG F+  +G         +F    + FV A FA+  +E   + A+E  NPR+ 
Sbjct: 320 GSRYWHNPGAFRGNTGI-------QRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKA 372

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           +P A K  +YRI+  +L ++ L+G  V Y    LL            PYV+A+ + G+ V
Sbjct: 373 IPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLL--GASGSATKASPYVIAVASHGVRV 430

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PH  NA +L  V S  N   Y  SR L  LA    APK F   +  G P  ++ + ++F
Sbjct: 431 VPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIF 490

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             +A+   S   E +F++ + ++ +  L +WI+I +++I F RA +VQG     + Y++ 
Sbjct: 491 GIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKS- 549

Query: 475 FQPVTAWIAL-GFCLMV-ALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYK 527
              V  W ++    +MV AL+  F V +     G     ++F   Y+ +P+ I  +V YK
Sbjct: 550 --QVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYK 607

Query: 528 IVHK--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           +  K  T +I +  +DL T +   D E  + + E     +E+ ++G  WK+  D+
Sbjct: 608 VWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEEY---QEKLRNGPYWKRVVDF 659

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  239 bits (610), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 164/530 (30%), Positives = 259/530 (48%), Gaps = 26/530 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L KDL  RH+                        GP +++I + I+G  +FTV++ LGE
Sbjct: 85  NLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGE 144

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           ++A  P+  GF  Y  R+ +P+  FAV   YL ++LVL P +L AA++ ++YW    K+N
Sbjct: 145 LSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKIN 202

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F A I   N++ VK FGE EF LS  K                GGGP    +G
Sbjct: 203 SDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIG 262

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW++PG F  ++          KF    SVFV A F+Y G E+  + AAE KNPR  +
Sbjct: 263 GKYWRNPGAFVGHNSGT-------KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + I   Y+  + L+G  V  NDP LL            P V+AI+N  I  L
Sbjct: 316 PKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKGL 374

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  V S  NS +Y  SR +  +A     PK   + +  G P N++ L   F 
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S+    +F++   ++ +  +  W++I +++I F +A +VQ    + L + +  
Sbjct: 435 LLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQT 494

Query: 476 QPVTAWIALGF-CLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
             + +W   GF  L + L+ +F   L          ++F  GY+  P+ I+C+  +KI  
Sbjct: 495 GVLGSW--YGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYT 552

Query: 531 K--TKWIKSANVDLFTYKTAID--LEEEEGKLEMMRLKEE----RKQHGW 572
           +  T  +K  ++DL T +  +D  L  EE K+E   L ++    R  H W
Sbjct: 553 RNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLAKKSFITRFLHFW 602

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  239 bits (610), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/536 (29%), Positives = 264/536 (49%), Gaps = 30/536 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LKK +Q RHV M                     AGP  ++I Y+IM   ++ ++  +GE
Sbjct: 98  KLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGE 157

Query: 117 MAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA  Y+ L  GF +Y     DPAL F++ + Y  ++  + P +L  A++ +QYW    KV
Sbjct: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTT--KV 215

Query: 175 NPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR 233
           N  +++ +F  ++L INI G  + + E EF  +S K                GG  +   
Sbjct: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275

Query: 234 LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRR 293
           +G +YW+DPG F+   G         +F    S  V A F++  TE   I A+E  NPR+
Sbjct: 276 IGGKYWRDPGAFRGSDG-------PNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328

Query: 294 NVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIP 353
            +P A K  +YR ++ YL ++ ++GL V Y+   LL            PYV+A+   G+ 
Sbjct: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELL--GSSSAATKASPYVLAVSTHGVR 386

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
           V+PH  NA +L  VFS  +S  Y  SR L  LA    APK+F   +  G P     +  +
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
              +A+   SS    +F++ + ++ +  + +W  I +++I F RA +VQG   + + Y++
Sbjct: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506

Query: 474 PFQPVTAW-IALGFCLMVALVKNF----TVFLGD-TFDYKTFITGYIGIPVYILCFVCYK 527
               V  W  A  F +M+ ++        V +G+ + D + F   Y+ +PV+I+ ++ YK
Sbjct: 507 ---QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563

Query: 528 IVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           I  K  W   I++ ++DL +++   D E    + E     +E+ ++G  W++ YD+
Sbjct: 564 I-WKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY---QEKLRNGPVWRRVYDF 615

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  239 bits (609), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 157/518 (30%), Positives = 250/518 (48%), Gaps = 18/518 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            + +DL  RH+                        GP +++I ++I+   +FTV++ LGE
Sbjct: 85  NMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGE 144

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +AA  P+  GF  Y TR+ DP+  F+V   YL ++LVL P +L AA+L ++YW     +N
Sbjct: 145 LAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYW--DDTIN 202

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F  +IL  N++ VK FGE EF LS  K                GGGP    +G
Sbjct: 203 SDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIG 262

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F   S          +F    SVFV A F+Y G E+  + AAE +NPR+ +
Sbjct: 263 GKYWHDPGAFVGDSAGT-------QFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTI 315

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P A K T + I   Y+  + L+G  VAYND  LL            P V+AI+N GI  L
Sbjct: 316 PTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAAS-PLVIAIENGGIKGL 374

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  + S  NS +Y  SR +  +A+    PK  +  +  G P  ++     F 
Sbjct: 375 PSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFG 434

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S   E +F++   ++ +  +  W+ I I +I F +A  VQ    + + Y +  
Sbjct: 435 LLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQT 494

Query: 476 QPVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKT 532
               ++       +V +   +T      GD  D + F  GY+  P+ I C++ +K+  K 
Sbjct: 495 GIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKN 554

Query: 533 KWIKS--ANVDLFTYKTAIDLE--EEEGKLEMMRLKEE 566
             I +    +DL T +  +D++  +EE K+E   L++ 
Sbjct: 555 WRIMTPLEEIDLLTGRKEVDIDILKEELKIEREALRQS 592

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  238 bits (608), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 157/533 (29%), Positives = 264/533 (49%), Gaps = 21/533 (3%)

Query: 48  GYDGKHKGI-RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWV 106
           G D   KG  +LKK +++RHV M                      GP  ++I Y+IMG  
Sbjct: 85  GSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSC 144

Query: 107 VFTVMSCLGEMAA-YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALV 164
           ++ ++   GE+A  Y  L G F +Y +   DPALGF+V + Y  ++L + P +L  A++ 
Sbjct: 145 LYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASIT 204

Query: 165 MQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 224
           ++YW     VNP +++ +F  + + IN+ G + + E EF+ ++ K               
Sbjct: 205 IKYWTT--SVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVN 262

Query: 225 XGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIV 284
            GG  +   +G +YW DPG F   SG   I   KG      S  V A FA+  TE   + 
Sbjct: 263 CGGAGNDGYIGGKYWNDPGSF---SGDKPIDHFKG----VVSTLVTAAFAFGATEFIALT 315

Query: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYV 344
           AAE  NPR+++P A K  LYRI+V +L ++ L+G  V +N   L+            PYV
Sbjct: 316 AAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHAS--PYV 373

Query: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404
           +AI + G+ V+PH  NA +L  V S  NS  Y  SR L  LA    AP      +  G P
Sbjct: 374 IAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRP 433

Query: 405 YNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGI 464
             ++ +  +F  ++++  S   ET+F++ + ++ +  L +W +I +++I F RA +VQG 
Sbjct: 434 TLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGR 493

Query: 465 DKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVF--LGD-TFDYKTFITGYIGIPVYIL 521
               L +++      ++ A G  L++ + + +T    +G+   D + F   Y+ +P+ I 
Sbjct: 494 SLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIA 553

Query: 522 CFVCYKIVHK--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            +  YK+  +  T +I ++ +DL + +   D  E+  K E    +E+ +  GW
Sbjct: 554 LYFGYKVWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEFREKLRNSGW 604

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  239 bits (610), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 166/539 (30%), Positives = 264/539 (48%), Gaps = 34/539 (6%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           + KDL  RH+                        GP +++I + I+   +FTV++ LGE+
Sbjct: 141 MNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGEL 200

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           AA  P+  GF+ Y  ++ DP+  FAV   YL ++LVL P +L AA++ ++YW     +N 
Sbjct: 201 AAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYW--NSSINS 258

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             W+++F   I   N++ VK FGE EF LS  K                GGGPSH  +G 
Sbjct: 259 DAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGG 318

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F      V    G  KF    SVFV A F++ G E+  + AAE +NPR  +P
Sbjct: 319 KYWHDPGAF------VGTTSGS-KFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIP 371

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K T + I   Y+  + L+G  V YNDP L+            P V+AI+N  I  LP
Sbjct: 372 KAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASS-PLVIAIENGHIHGLP 430

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + NA +L  + S  NS +Y  SR +  ++  +  PK+FAK +  G P  ++     F  
Sbjct: 431 SLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGL 490

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           L+++  S     +F++   ++ +  +  W+ I + +I F +   VQ I  + L    PF 
Sbjct: 491 LSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDEL----PFL 546

Query: 477 PVTA-WIAL-GFCLM-VALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
             T  W ++ G  ++ + LV +F   L        +  +F  GY+  P+ + C++ +K+ 
Sbjct: 547 SQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVY 606

Query: 530 HKT-KW-IKSANVDLFTYKTAIDLE--EEEGKLEMMRLKEERKQHGWTWKQFYDYIFGW 584
            K  +W I ++ +DL + +  +DLE   EE +LE    KE   Q  +    FY ++  W
Sbjct: 607 FKNWRWYIPASKMDLHSGRKQVDLEVVREELRLE----KEHLAQRSF----FYRFLHVW 657

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  239 bits (609), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 164/539 (30%), Positives = 263/539 (48%), Gaps = 30/539 (5%)

Query: 54  KGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSC 113
           K   LKK ++ RH  M                     AGP  ++I Y+IMG  V+ ++  
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 114 LGEMAAYIP--LDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
            GE+A      + GF +Y +   DPA+GF+V + +  ++L + P +L  A++ ++YW   
Sbjct: 201 CGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTV- 259

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
            KVN  V++ +F  +IL INI G K + E +F+ +  K                GG  + 
Sbjct: 260 -KVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTD 318

Query: 232 NRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNP 291
             +G RYW+DPG F+   G  SI     +F    + FV A FA+  +E   + A+E  NP
Sbjct: 319 GYIGSRYWRDPGAFR---GDTSIQ----RFKGVVATFVTAAFAFGMSEQLAMTASEQSNP 371

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAG 351
           R+ +P A K  +YRI+  +L ++ L+G  V Y    LL            PYV+A+ + G
Sbjct: 372 RKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLL--GAAGSATKASPYVIAVSSHG 429

Query: 352 IPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALC 411
           + V+PH  NA +L  V S  NS  Y  SR L  LA    APK F   +  G P  ++ + 
Sbjct: 430 VRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVS 489

Query: 412 TLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSY 471
            +F  +A+   S   E +F++ + ++ +  L +WI+I +++I F +  +VQG     + Y
Sbjct: 490 AVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGY 549

Query: 472 QAPFQPVTAW-IALGFCLMV-ALVKNFTVFL----GD-TFDYKTFITGYIGIPVYILCFV 524
           ++    V  W  A    LMV AL+  F V +    GD     ++F   Y+ +P+ I  ++
Sbjct: 550 KS---QVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYI 606

Query: 525 CYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
            YK V K  W   I +  +DL +++   D  EE  K E    K +R ++G  WK+  D+
Sbjct: 607 FYK-VWKRDWSLFIPADKIDLVSHRNIFD--EELLKQEDEEYK-DRLRNGPFWKRVLDF 661

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  236 bits (602), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 156/497 (31%), Positives = 245/497 (49%), Gaps = 20/497 (4%)

Query: 55  GIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCL 114
           G  L KDL  RH+                        GP +++I + I+   +FTV++ L
Sbjct: 75  GENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINAL 134

Query: 115 GEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGK 173
           GE+AA  P+  GF  Y TR+ DP+  FAV   YL  ++V  P +L AA++ ++YW    +
Sbjct: 135 GELAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW--NRE 192

Query: 174 VNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR 233
           +N   W+T+F   I  +N++ VKFF E EF +S  K                GGGP+   
Sbjct: 193 INSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGY 252

Query: 234 LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRR 293
           +G +YW DPG F   S          +F    SVFV A F+Y G E+  + AAE KNPR+
Sbjct: 253 IGGKYWNDPGAFHGDSAG-------SRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRK 305

Query: 294 NVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIP 353
            +P+A K T + I   Y+  + L+G+ V YND  LL            P V+AI+NAGI 
Sbjct: 306 TIPKATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASAS-PLVIAIENAGIK 364

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
            LP + NA +L  + S  NS +YV SR +  +A+    PK+F+K +  G P  S+     
Sbjct: 365 GLPSLMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLF 424

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
              L+++  S   E +F++   +  +  +  WI I + +I F  A + Q    + L+Y +
Sbjct: 425 VGLLSFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYIS 484

Query: 474 PFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
                 +W  +   L++ L+ +F V L      + D + F  GY+  P+ I  ++ +K+ 
Sbjct: 485 QSGIWGSWYGV-IILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVY 543

Query: 530 HKT-KWI---KSANVDL 542
            K  KW+   +  ++DL
Sbjct: 544 IKNWKWVIPLEEIDIDL 560

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  237 bits (604), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 164/506 (32%), Positives = 263/506 (51%), Gaps = 19/506 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L+  L++RH+ M                     AGP  ILI + I G ++FT++  LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGEL 147

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G F +YATR+ D + GFA  + Y+F++LV  P ++ AA++ + YW    +   
Sbjct: 148 AVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTD 207

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  V++ IN+ GV+ +GE EF  S  K                GGGP    +G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGG 266

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW DPG F  +S     PG +  F  F SVFV A F++ G+EL GI +AE KNPR++VP
Sbjct: 267 RYWHDPGAFAGHS-----PGRR--FKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVP 319

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K   +RI++FY+  + L+GL V Y DP LL            P+V+AI   GI  LP
Sbjct: 320 QAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASAS--PFVIAIVTHGISGLP 377

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR+L  L+     PK  A  +  G P   +A+C+ F  
Sbjct: 378 SVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGL 437

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S+  E MF++ + ++ I   L+W SI   +I F  A +V G   + L +++P  
Sbjct: 438 IAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVG 497

Query: 477 PVTAW--IALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKW 534
            + ++  + L   ++VA   N    +G + +   F + Y+  P+ +  ++ +K+  K  W
Sbjct: 498 IIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKL-WKRNW 556

Query: 535 -----IKSANVDLFTYKTAIDLEEEE 555
                +K  ++D    +T I+L ++E
Sbjct: 557 KLLIPLKDIDIDTGRRETDINLLKQE 582

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  236 bits (603), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/502 (31%), Positives = 246/502 (49%), Gaps = 18/502 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L KDL  RH+                        GP +++I + I+   +FTV++ LGE
Sbjct: 85  NLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGE 144

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           ++A  P+  GF  Y+ R+ +P+  FAV   YL ++LVL P +L AA++ ++YW    K+N
Sbjct: 145 LSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKIN 202

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F A I   N++ VK FGE EF LS  K                GGGP    +G
Sbjct: 203 SDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIG 262

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F  +S          +F    SVFV A F+Y G E+  + AAE KNPR  +
Sbjct: 263 GKYWHDPGAFVGHSSGT-------QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + I   Y+  + L+G  V  NDP LL            P V+AI+N GI  L
Sbjct: 316 PKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKGL 374

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  V S  NS +Y  SR +  +A     PK   + +  G P N++ L   F 
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S     +F++   ++ +  +  W++I +++I F +A +VQ    + L + +  
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQT 494

Query: 476 QPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
               +W      L + L+ +F   L    G     ++F  GY+  P+ I+C+V +K+  +
Sbjct: 495 GVKGSWYGF-IVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTR 553

Query: 532 --TKWIKSANVDLFTYKTAIDL 551
             T  +K  ++DL T +  +DL
Sbjct: 554 NWTLMVKLEDMDLDTGRKQVDL 575

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  236 bits (602), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 164/516 (31%), Positives = 261/516 (50%), Gaps = 22/516 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L+  L+ RH+ M                     AGP  ILI + I G +++ ++  + E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+  GFT+YATR+ D + GFA  + Y+ +++V  P ++ AA++ + YW    K   
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GV+ +GE EF  S  K                GGGP    +G 
Sbjct: 204 G-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGA 262

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW  PG F   +G  S   G+ KF  F SVFV A F++ G+EL G+ AAE  NPR++VP
Sbjct: 263 RYWYHPGAF---AGDTS---GR-KFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVP 315

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A K   +RI +FY+  + L+G+ V Y DP L+            P+V+AIKN GI  LP
Sbjct: 316 GAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLI--GGSSVDAAASPFVIAIKNQGISGLP 373

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR+L  LA     PK F+  +  G P   +A+ + F  
Sbjct: 374 TLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGL 433

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S     +F + + ++ +  L +W +I + +I F RA   QG   N L++ +P  
Sbjct: 434 IAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAG 493

Query: 477 PVTAWIALGFCLMVALVKNFTVF--LGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKW 534
              A   L  C+++   + +     LG       F  GY+ +P+ +  ++ +KI  K  W
Sbjct: 494 VWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKI-WKKNW 552

Query: 535 ---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEER 567
              IK+ ++D+ T +  +DL+     L   +++EER
Sbjct: 553 KLFIKAEDMDIDTGRRELDLD-----LLRQQVEEER 583

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  236 bits (602), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 152/502 (30%), Positives = 254/502 (50%), Gaps = 19/502 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK  L+ RH+ M                      GP ++LI +  MG +++ ++  LGE+
Sbjct: 85  LKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGEL 144

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + GFA  + Y+ ++LV  P ++ +A++ + YW    K   
Sbjct: 145 AVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRD 204

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GVK +GE EF  S  K                GGGP    +G 
Sbjct: 205 G-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGG 263

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +Y+ DPG F     A   PG K  F    SVFV A F++ G+EL G+ A+E  +PR++VP
Sbjct: 264 KYFHDPGAF-----AGDTPGAK--FKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVP 316

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K   +RI +FY+ ++ ++GL V YND  L+            P+V+AI   GI  LP
Sbjct: 317 KAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAAS--PFVIAIVTHGIKGLP 374

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS ++  SR+   LA     P+IFA  +  G P   + + +    
Sbjct: 375 SVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGL 434

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S+  E +F++ + ++ +  L +W  I I +I F +A   QG   + LS+++P  
Sbjct: 435 IAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTG 494

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++  L F +++  +  F V L     +   + F   Y+  P+ +  ++ +KI +K  
Sbjct: 495 VWGSYWGL-FMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKI-YKRN 552

Query: 534 W---IKSANVDLFTYKTAIDLE 552
           W   I +  +D+ + +  +DLE
Sbjct: 553 WKLLIPAGEMDIDSGRREVDLE 574

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  236 bits (602), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 159/530 (30%), Positives = 262/530 (49%), Gaps = 27/530 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK  L+ RH+ M                     AGP  I+I + +   +++ ++  LGE+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + GFA  + Y  ++L   P ++ +A++ + YW    +   
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GV+ FGE EF  S+ K                GGGP    +G 
Sbjct: 215 G-FVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGG 273

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW +PG F   +          +F    SVFV A F++ G+EL GI AAE  NPR++VP
Sbjct: 274 RYWHNPGAFVGDNAGT-------QFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVP 326

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           RA K  ++RIV+FY+ ++ ++GL V Y DP L+            P+V+AI   GI  LP
Sbjct: 327 RAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLI--GASSVDASASPFVIAIVTHGIRGLP 384

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS ++ GSR++  L+     P+IF   +  G P   + + + F  
Sbjct: 385 SVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGL 444

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S     +F++ + ++ +  L +W  I + +I F  A + QG   N L + +P  
Sbjct: 445 IAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAG 504

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
            + +   L F L++  +  F V L   G     + F   Y+  P+ +  +  +KI +K  
Sbjct: 505 IIGSSWGL-FMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKI-YKKN 562

Query: 534 W---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEER---KQHGWTWKQF 577
           W   IK+ ++D+ T +   DLE     L    ++EE+      GW ++Q+
Sbjct: 563 WKLFIKAEDMDIDTGRRETDLE-----LLKQEIEEEKAILATKGWWYRQY 607

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  236 bits (601), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 151/542 (27%), Positives = 261/542 (48%), Gaps = 34/542 (6%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
            KG  LK+D++ RHV M                      GP  + I Y+IMG  +++++ 
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 113 CLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
             GE+A AY  L G F +Y +   DPA+ FA    Y  ++L + P ++ +AA+ ++YW  
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW-- 214

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
              +NP VW  +F  +I+ IN+ G   + E +F+ ++ K                GG   
Sbjct: 215 NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGD 274

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
              +G +YW DPG F   +G         +F +  S  V A FA+  +E   + A+E  N
Sbjct: 275 SVYIGGKYWNDPGAFNGDTGI-------SRFKAIVSTLVTAAFAFGASEAVALTASEQAN 327

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR+ +P A K  LYRI+  YL ++ L+G  V YN P L+            PYV+A+ + 
Sbjct: 328 PRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSS--PYVIAVASH 385

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           G+ V+P   NA +L  V S  N   Y  SR L  L+    APK F   +  G P  ++ +
Sbjct: 386 GVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIV 445

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
             L  C+ +++ SS+ E++F++ + V+ +  L +W +I I+++ F +A +VQ      L 
Sbjct: 446 GALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELG 505

Query: 471 YQAPFQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVC 525
           +++      ++  + F +++  +  F V L      D  D + F   Y+ +PV++  +  
Sbjct: 506 FRSQVGVWGSYYGI-FMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFG 564

Query: 526 YKIVHKT--KWIKSANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQHGWTWKQFY 578
           +KI  K    +I ++ +DL +++   D      E+EE K++M        +H   W +  
Sbjct: 565 FKIWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEEYKIKM--------KHASIWVKLS 616

Query: 579 DY 580
           ++
Sbjct: 617 NF 618

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  235 bits (600), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 151/477 (31%), Positives = 235/477 (49%), Gaps = 16/477 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L KDL  RH+                        GP +++I + I+   +FTV++ LGE
Sbjct: 87  NLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGE 146

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +AA  P+  GF  Y TR+ +P+  FA+   YL ++LVL P +L AA++ ++YW    K+N
Sbjct: 147 LAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYW--NDKIN 204

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F   I   N++ VK FGE EF LS  K                GGGP    +G
Sbjct: 205 SDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIG 264

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW +PG F  +S          +F    SVFV A F+Y G E+  + AAE +NP+  +
Sbjct: 265 GKYWHNPGAFVGHSAG-------SQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETI 317

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + I V Y+  + L+G  V YNDP LL            P V+AI+N GI  L
Sbjct: 318 PKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS-PLVIAIENGGIKGL 376

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  + S  NS +Y  SR +  +A     PK  +K +  G P N++ L   F 
Sbjct: 377 PSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFG 436

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S   E +F++   ++ +  +  W++I ++ I F  A + QG   + + + +  
Sbjct: 437 LLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQS 496

Query: 476 QPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYKI 528
               AW  +   L + LV +F   L      T   K+F  GY+ +P+ I C+V +K+
Sbjct: 497 GTWGAWYGV-IVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKL 552

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  236 bits (601), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 265/534 (49%), Gaps = 25/534 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+ ++ RHV +                     AGP  ++I YSIMG  ++ ++   GE+
Sbjct: 117 LKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGEL 176

Query: 118 A---AYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           A   + +P   F  Y T   D A GFAV + Y  ++L + P +L  A++ ++YW     V
Sbjct: 177 AVCYSSLP-SNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SV 233

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP +++++F  +I+ IN  G + + E EF+ +S K                GG  +   +
Sbjct: 234 NPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGYI 293

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW  PG F   +G   I   KG      + F  A FA+  +E   + AAE  NPR+ 
Sbjct: 294 GAKYWHSPGAF---NGNRPIDHFKG----VMATFTTAAFAFGASEFISLTAAEQSNPRKA 346

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           +P+A K+ +YRI+  +L ++ L+G  V YN P LL            PYVVA+ + G+ V
Sbjct: 347 IPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLL--GSGSDATKASPYVVAVASHGVRV 404

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PH  NA +L  V S  NS  Y  SR L  LA    APK+F   +  G P  ++   TLF
Sbjct: 405 VPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLF 464

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             +A+   S   E +F++ + ++ +  L +W++I I+++ F RA +VQG     + +++ 
Sbjct: 465 MTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQ 524

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
                +  A    L++AL+  F V L    G+  D + F   Y+ +P+ ++ +  YKI  
Sbjct: 525 VGIYGSLYAATM-LILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRK 583

Query: 531 K--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIF 582
           +    WI +  +DL +++   D  E+  K E+  +++E+K    T ++  ++ F
Sbjct: 584 RDWKFWIPAHRIDLVSHRKVFD--EDILKQEVAEIEQEKKNLS-TGRKIQEFFF 634

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  235 bits (599), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 157/509 (30%), Positives = 250/509 (49%), Gaps = 18/509 (3%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L KDL  RH+                        GP +++I + I+   +FTV++ LGE
Sbjct: 91  NLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGE 150

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +AA  P+  GF  Y TR+ DP++ FA+   YL ++LVL P +L AA++ ++YW     +N
Sbjct: 151 LAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYW--NDTIN 208

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F +VI   N++ VK FGE EF LS  K                GGGP    LG
Sbjct: 209 SDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLG 268

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
             YW DPG F         PG +  F    SVFV A F+Y G EL  + AAE K+PR+ +
Sbjct: 269 GHYWHDPGSF-----VGDKPGTQ--FKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTI 321

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + +   Y+  + ++G  V ++DP LL            P V++IKNAGI  L
Sbjct: 322 PKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAAS-PLVISIKNAGIKGL 380

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
             + NA +L  + S  NS +Y  SR +  +A     PK+ ++ +  G P N++     F 
Sbjct: 381 DSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFG 440

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S     +F++   ++ +  +  W++I  ++I F  A +VQ    + L Y +  
Sbjct: 441 LLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQC 500

Query: 476 QPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
             + +W  +   L + LV +F   L      T D  +F  GY+ +P+ I C+V +K+  +
Sbjct: 501 GVIGSWYGV-IVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVR 559

Query: 532 T--KWIKSANVDLFTYKTAIDLEEEEGKL 558
                +K  ++DL T +  ID  E   ++
Sbjct: 560 NLQVLVKLEDMDLETGRKHIDAHEHRAEI 588

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  234 bits (598), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 160/502 (31%), Positives = 258/502 (51%), Gaps = 19/502 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+ L+ RH+ M                     AGP  ILI +++ G +++ ++  +GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + G+A  + Y+ ++LV+ P ++ AA++ + YW    K   
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI++IN+ GVK +GE EF  S  K                GGGP    +G 
Sbjct: 197 G-FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGG 255

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
             W +PG F      V    GK +F    SVFV A F++ G+EL G+ +AE  NPR+++P
Sbjct: 256 ANWHNPGAF------VGNTAGK-RFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLP 308

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           RA K   +RI +FY+ ++ L+GL V YND  L+            P+V+AIKN GI  LP
Sbjct: 309 RAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS--PFVLAIKNHGIKGLP 366

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS ++  SR+L  LA     PKIF   +  G P   +   + F  
Sbjct: 367 SVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGL 426

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           L+++  S     +F + + ++ +  L +W++I I ++ F RA   QG   + LS+ +P  
Sbjct: 427 LSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSP-A 485

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
            V   I     +M+ L   F + L   G   D K F   Y+ +PV ++ ++ +K  +K  
Sbjct: 486 GVWGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHK-CYKRN 544

Query: 534 W---IKSANVDLFTYKTAIDLE 552
           W   I++ N+D+ T +  +D+E
Sbjct: 545 WKLFIRAENIDIDTGRREVDIE 566

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  235 bits (600), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 153/515 (29%), Positives = 255/515 (49%), Gaps = 20/515 (3%)

Query: 46  DWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGW 105
           D     K +   L+K +Q RHV M                    +AGP  ++I Y+IMG 
Sbjct: 115 DVAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGT 174

Query: 106 VVFTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
            ++ ++   GEMA +Y  L G F +Y T   D   GFAV + Y  ++L + P +L  A++
Sbjct: 175 CLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASM 234

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 223
            + YW    KVN  +++ +F  +I+ IN+ G K + E +F+ ++ K              
Sbjct: 235 TIDYWTT--KVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIII 292

Query: 224 XXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGI 283
             GG  +   +G +YW DPG F+   G  SI     +F    + F  A FA+  +E   I
Sbjct: 293 NAGGAGTSGYIGAKYWHDPGAFR---GDRSID----RFKDVMATFTTAAFAFGASEFIAI 345

Query: 284 VAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPY 343
            A+E  NPRR +P A K+ +YRI+  +L ++ L+G  V Y+   L+            PY
Sbjct: 346 GASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM--GSGSGGTKASPY 403

Query: 344 VVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGV 403
           V+AI + G+ V+PH  NA +L  V S  NS  Y   R L+ L+    AP+ F   +  G 
Sbjct: 404 VLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGR 463

Query: 404 PYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQG 463
           P  ++ +  LF  +A+   SS  E +F++ + ++ +  + +W++I +++I F RA  VQG
Sbjct: 464 PARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQG 523

Query: 464 IDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVY 519
              + L +++    V   +     L +AL+  F V +     D  D K+F   Y+ +P+ 
Sbjct: 524 RSISELGFRSQLG-VWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPIL 582

Query: 520 ILCFVCYKIVHKT--KWIKSANVDLFTYKTAIDLE 552
           I+ +  YKI ++    +I++ N+DL T++   D E
Sbjct: 583 IVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAE 617

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  234 bits (596), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/517 (30%), Positives = 254/517 (49%), Gaps = 23/517 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L+  L+ RH+ M                     AGP  ILI + + G ++++++  LGE+
Sbjct: 81  LQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGEL 140

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + GFA    Y+ ++LV+ P ++ AA++ + YW    +   
Sbjct: 141 AVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRD 200

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F   I  IN+ GVK +GE EF  S  K                GGGP    +G 
Sbjct: 201 G-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGG 259

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW       PY   V    G  +F    SVFV A F++ G+EL G+ +AE  NPR++VP
Sbjct: 260 RYWH-----HPYGAFVGDSAG-ARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVP 313

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K   +RI +FYL  + ++GL V Y +  L+            P+V+AI   GI  LP
Sbjct: 314 KAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS--PFVIAITTHGIRGLP 371

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR+L  LA     PK F   +  G P  S+ + + F  
Sbjct: 372 SVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGL 431

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S     +F++ + ++ +  L +W  I + +I F +A   QG   + LS+ +P  
Sbjct: 432 VAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAG 491

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++  L F +++  +  F V L   G   + K F   Y+  P+ I C++ +KI +K  
Sbjct: 492 VYGSYWGL-FMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKI-YKKN 549

Query: 534 W---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEER 567
           W   IK+ ++D+ T +   DL+     L    + EER
Sbjct: 550 WKIFIKAEDMDIDTGRKDDDLD-----LLRQEVAEER 581

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  234 bits (596), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 157/507 (30%), Positives = 258/507 (50%), Gaps = 21/507 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L+  L++RH+ M                     AGP  ILI +SI G ++FT++  LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + GFA  + Y+ ++LV+ P ++ AA++ + YW    +   
Sbjct: 148 AVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTD 207

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  V++ IN+ GV+ +GE EF  S  K                GGGP    +G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGA 266

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW +PG F      V    G+ KF  F SVFV A F++ G+EL G+  +E KNPR+ VP
Sbjct: 267 RYWHNPGAF------VGSTSGQ-KFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVP 319

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A K   +RI++FY+  + L+G  V YNDP L+            P+V+AI   GI  LP
Sbjct: 320 SAAKQVFWRILLFYIICLLLIGFLVPYNDPRLIS--SSSVDASASPFVIAIVTHGISGLP 377

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR+L  L+     PKI +  +  G P   +A+ + F  
Sbjct: 378 SVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGL 437

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S+    MF++ + ++ +    +W +I I +I F  A + QG   + L + +P  
Sbjct: 438 IAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAG 497

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
            + ++  L F  ++ L+  F + L   G +     F + Y+  PV +  ++ +K+  K  
Sbjct: 498 VIGSYWGL-FLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKL-WKKN 555

Query: 534 W-----IKSANVDLFTYKTAIDLEEEE 555
           W     ++  ++D     T ++L ++E
Sbjct: 556 WKFLIPLEDVDIDTGRRDTDVNLLKQE 582

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  234 bits (596), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 150/502 (29%), Positives = 253/502 (50%), Gaps = 19/502 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L++ L+ RH+ M                     AGP  ILI + +M  ++  +   LGEM
Sbjct: 84  LQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEM 143

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G +T+YATR+ D + GFA    Y+ + LV+ P ++ AA++ + YW  + +   
Sbjct: 144 AVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYR- 202

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             ++ +F   I++IN+ GVK +GE EF  S  K                GGGP+H  +G 
Sbjct: 203 AAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGS 262

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           ++W +PG F      V    G+ KF    SVFV A F++  TEL G+ AAE ++PR++VP
Sbjct: 263 KFWSNPGAF------VGDTAGQ-KFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVP 315

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K   +RI +FY+ ++ ++GL V Y DP LL            P+V+A+KN GI  LP
Sbjct: 316 KAAKQVFWRITLFYILSLLMVGLLVPYTDPRLL--GSSIVDAAASPFVLALKNHGIKGLP 373

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +LT V S  NS ++  SR L  L+     P +F   +  G P  S+   + F  
Sbjct: 374 SVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGL 433

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           L ++ VS   + +F + ++++ +  L  W++I + +I F +A   Q    + L++ +P  
Sbjct: 434 LCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIG 493

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++ ++ F ++V L+  F + L           F   Y+ +P+ +  ++ +KI  K  
Sbjct: 494 IWGSYYSV-FLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKN- 551

Query: 534 W---IKSANVDLFTYKTAIDLE 552
           W   I    +D+ T +  +D+E
Sbjct: 552 WKLLIDPKYMDIDTGRRELDIE 573

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  233 bits (595), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 156/502 (31%), Positives = 262/502 (52%), Gaps = 19/502 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK  L+ RH+ M                      GP ++LI +   G ++++++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGEL 145

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + G+A  + Y+ ++LV+ P ++ +A++ + +W    K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GVK +GE EF  S  K                GGGP    +G 
Sbjct: 206 G-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F     A   PG K  F    SVFV + F++ G+EL G+ A+E  +PR++VP
Sbjct: 265 KYWHDPGAF-----AGDTPGAK--FKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVP 317

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K   +RI +FY+ ++ ++GL V YNDP L+            P+V+AIK  GI  LP
Sbjct: 318 KAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAAS--PFVIAIKTHGIKGLP 375

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR++  LA  +  P+IFA  +  G P   +A+ + F  
Sbjct: 376 TVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGL 435

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S     +F++ + ++ +  L +W  I I +I F +A   QG D + LS+++P  
Sbjct: 436 IAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTG 495

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++  L F +++  +  F V L   G +   + F   Y+  P+ +  ++ +KI +K  
Sbjct: 496 VWGSYWGL-FMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKI-YKRN 553

Query: 534 W---IKSANVDLFTYKTAIDLE 552
           W   I + ++D+ T +  +DLE
Sbjct: 554 WKLFIPAEDMDIDTGRREVDLE 575

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  235 bits (599), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 155/539 (28%), Positives = 259/539 (48%), Gaps = 23/539 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           + + +  +LK+ ++ RHV M                    QAGP  ++I Y IMG  ++ 
Sbjct: 142 EQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYC 201

Query: 110 VMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           ++   GE+A AY  ++G F ++ +   DP   FAV + Y  ++L + P +L  +++ ++Y
Sbjct: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W    KV+P V++ +F  +IL IN  G K + E EF+ +  K                G 
Sbjct: 262 WTT--KVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
             +   +G +YW DPG F+   G   I     +F      FV A FA+  TE   + AAE
Sbjct: 320 AGTDGYIGAKYWNDPGAFR---GQTKIE----RFKGVMDTFVTAAFAFGATEFIALTAAE 372

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR+ +P A K   YRI++ +L ++ L+G  V YN   L+            PYV+A 
Sbjct: 373 QSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSAS--PYVLAA 430

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
              G+ V+ H  NA +L  V S  NS  Y  SR L GLA    APK F   +  G P  S
Sbjct: 431 SLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRS 490

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +    +   +A+   S     +F++ + ++ +  + +W +I +++I F R  +VQG    
Sbjct: 491 MLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLG 550

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCF 523
            L ++A    + ++ A    L +ALV  F V L      T D + F   Y+ +P+ +  +
Sbjct: 551 ELGFRAQTGVLGSYYA-AIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALY 609

Query: 524 VCYKIVHKT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           V +K+  +    +I++ N+DL +++   D  EE  + E    KE+ + +G  WK+  D+
Sbjct: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLR-NGPKWKRVVDF 665

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  233 bits (595), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 156/531 (29%), Positives = 258/531 (48%), Gaps = 27/531 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LKK +++RHV M                      GP A++I Y ++ +V + ++   GE
Sbjct: 90  KLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGE 149

Query: 117 MAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA   P     F +Y++ +   + GFA  + Y F++L + P +L  A++ +Q+W    K+
Sbjct: 150 MAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFW--NDKI 207

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP ++I +F   ++ I+  GVK +GE EF  +  K                GG  +   +
Sbjct: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI 267

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G  YW +PG F   +G  SI    G+F +   + V A F++ G EL  +   E  NPR++
Sbjct: 268 GATYWHNPGAF---AGDTSI----GRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKS 320

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRIVV YL T+ L+G +V YND  L+            PYV+A    G+ +
Sbjct: 321 TPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLM--GAGGSATHASPYVLAASIHGVKI 378

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY G R +  LA    APK     +  G P  +L +C +F
Sbjct: 379 VPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVF 438

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             +A++  SS  E +F++   +  +  L +W SI+++++ F +A +VQG   + L Y+A 
Sbjct: 439 GVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKAT 498

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
                +   + F ++V  V  F V L     G   D ++F   Y+  P+++  +  Y + 
Sbjct: 499 TGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVY 557

Query: 530 HK--TKWIKSANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQ-HGW 572
           ++  T       +DL  ++   D      E+EE K ++  +   RK  H W
Sbjct: 558 NRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMSLMRKAYHFW 608

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  234 bits (598), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 159/538 (29%), Positives = 254/538 (47%), Gaps = 25/538 (4%)

Query: 48  GYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVV 107
           G   +     L++ ++ RHV M                     AGP  ++I Y IMG  +
Sbjct: 149 GQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCI 208

Query: 108 FTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVM 165
           + ++   GEMA AY  L G F ++ +   DP   FAV + Y  ++L + P +L  A++ +
Sbjct: 209 YCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTI 268

Query: 166 QYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 225
           QYW    KV+P V++ +F  +IL IN  G K + E EF  ++ K                
Sbjct: 269 QYWTT--KVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDT 326

Query: 226 GGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVA 285
           G   +   +G +YW DPG F+   G   I     +F      FV A FA+  TE   + A
Sbjct: 327 GAAGTDGYIGAKYWNDPGAFR---GQTKIE----RFKGVMDTFVTAAFAFGATEFIALTA 379

Query: 286 AECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVV 345
           AE  NPR+ +P A K  +YR++V +L T+ L+G  V Y+   LL            PYV+
Sbjct: 380 AEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLL--GSGGSATKASPYVL 437

Query: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405
           AI   G+ V  H  NA +L  V S  NS  Y  SR L  LA    APKIF   +  G P 
Sbjct: 438 AISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPL 497

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
            ++    +   +A+   S     +F++ + +  +  L +W +I ++++ F RA +VQG  
Sbjct: 498 IAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRS 557

Query: 466 KNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYIL 521
              + Y +    + +  A    +++AL+  F V L      T D  +F + Y+ +P+ I+
Sbjct: 558 LGEMGYLSQTGILGSLYA-AIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIV 616

Query: 522 CFVCYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQ 576
            +  YKI  K  W   I++ ++DL +++T  D E    + E  R   E+ ++G  WK+
Sbjct: 617 FYFGYKI-WKRDWRLFIRAKDIDLISHRTIYDEELLRQEDEEYR---EKLRNGPKWKR 670

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  231 bits (590), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 154/511 (30%), Positives = 252/511 (49%), Gaps = 18/511 (3%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           ++     + L K+L  RH+                        GP +++I + I+   +F
Sbjct: 66  HEDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLF 125

Query: 109 TVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           TV++ LGEMAA  P+  GF  Y TR+ DP++GFAV   YL ++LVL P +L AA++ ++Y
Sbjct: 126 TVINALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKY 185

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W     +N   W+ +F  VI   N++ VK FGE EF LS  K                GG
Sbjct: 186 W--NETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGG 243

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
           GP    +G +YW  PG F  ++          KF    SVFV A F+Y G E+  + AAE
Sbjct: 244 GPHGGFIGGKYWNHPGSFVGHNSGT-------KFKGLCSVFVTAAFSYSGIEMTAVSAAE 296

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
            K+PR  +P+A K T + I   Y+  + L+G  V Y+DP LL            P V+AI
Sbjct: 297 SKDPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASS-PLVIAI 355

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           +N GI  LP + NA +L  + S  NS +Y  SR +  +A     P+I  + ++ G P N+
Sbjct: 356 ENDGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNA 415

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +     F  L+++  S     +F++   ++ +  +  W++I +++I F ++   Q    +
Sbjct: 416 IIFTLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLD 475

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCF 523
            L + +      +W      L + LV +F   L    G + D ++F  GY+  P+ + C+
Sbjct: 476 ELPFLSQTGVWGSWYGT-IVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACY 534

Query: 524 VCYKI-VHKTKWIKS-ANVDLFTYKTAIDLE 552
             +K+ V K +++   A++DL T +  +DL+
Sbjct: 535 FGHKLYVRKREFMVGLADMDLDTGRRQVDLD 565

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  232 bits (592), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 155/536 (28%), Positives = 256/536 (47%), Gaps = 24/536 (4%)

Query: 54  KGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSC 113
           K   LK  ++ RHV M                     +GP  ++I Y+IMG  ++ ++  
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 114 LGEMAAYIP--LDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
            GEMA      + GF SY +   +PALGF+V + Y  ++L + P +L  A++ ++YW   
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTT- 237

Query: 172 GKVNPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
            KV+P V++ +F  +I+ IN++G    + E EF+ +S K                GG   
Sbjct: 238 -KVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGD 296

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
              +G RYW DPG F+   G  +I     +F    S  V A FA+  +E+ G+ A+E  N
Sbjct: 297 DGYIGGRYWHDPGAFR---GEHAID----RFKGVVSTLVNAAFAFGLSEMIGVTASEQSN 349

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR+ +P A K  +YRIV  YL +V ++G  V +N   LL            PYV+A+   
Sbjct: 350 PRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLL--GSSGGGVKASPYVLAVSTH 407

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           G+ V+PH  NA +L  V S  NS  Y  SR L GLA    APKIF   +  G P   + +
Sbjct: 408 GVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCV 467

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
             L   +++   S   + +F + + ++ +  L +W +I +++I F RA  VQG     + 
Sbjct: 468 AALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIG 527

Query: 471 YQAPFQPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFVCY 526
           +++      +W A    +M+ L+  F V +        D + F   Y+  P+ I  +  Y
Sbjct: 528 FKSQCGVWGSWYAF-IMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGY 586

Query: 527 KIVHKT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           KI  K    +I++ ++DL   +   D E    + E  +   E+ ++   W++ Y++
Sbjct: 587 KIYTKDWRLFIRAKDIDLDINRDVFDEELIRQEEEEYK---EKMRNAPIWQKIYEF 639

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  231 bits (590), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 151/520 (29%), Positives = 259/520 (49%), Gaps = 29/520 (5%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           + KH+   LK+ +++RH+ M                      GP    I + IMG  V+ 
Sbjct: 84  NAKHE--NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYC 141

Query: 110 VMSCLGEMAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           V+   GE+A  Y  L  GF +Y +   DPALGFA  + Y  ++L + P +L  A++ +++
Sbjct: 142 VIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKF 201

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W G   VNP +++ +F  +I+ IN  G + + E EF+ +S K                G 
Sbjct: 202 WPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGA 261

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASV---FVYALFAYLGTELCGIV 284
             +   +G +YW+DPG            GG+  F  F  +    V A F+   +E   + 
Sbjct: 262 VGTSGYIGGKYWRDPGSL----------GGRTHFDHFKGIVATLVNAAFSLGCSEFVALT 311

Query: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYV 344
           AAE  NPR+++P A K  +Y+I V +L +V L+G  V  +   L+            PYV
Sbjct: 312 AAEQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVS--PYV 369

Query: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404
           +A++  G+ V+P   NA +L  V S  NS  Y  SR L+ LA    APKIF   +  G P
Sbjct: 370 IAVRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRP 429

Query: 405 YNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGI 464
             ++ +  LF  + ++  S   E +F + + ++ +  L +W +I +++I F RA  VQG 
Sbjct: 430 LMAMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGY 489

Query: 465 DKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL---GDTF-DYKTFITGYIGIPVYI 520
             + L ++A    + ++++    +++AL+  F V L   G T  D ++F TGY+ +P+++
Sbjct: 490 STDELGFKAQTGIIGSYVS-AIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFL 548

Query: 521 LCFVCYKIVHKT--KWIKSANVDLFTYKTAID---LEEEE 555
           L +  YKI +K    +I++  +DL +++   D   L++E+
Sbjct: 549 LFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDADVLKQED 588

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  230 bits (587), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 157/544 (28%), Positives = 257/544 (47%), Gaps = 34/544 (6%)

Query: 48  GYDGKH-KGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWV 106
           GYD +     ++KK +++RH+ M                    +AGP  ++I Y +   +
Sbjct: 53  GYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAM 112

Query: 107 VFTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALV 164
           ++ ++   GE+   Y  + G +T+Y++   DPALGF+V + Y  +++ + P QL  AA+ 
Sbjct: 113 LYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAIT 172

Query: 165 MQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 224
           ++YW      NP +++ +   +I+ IN+ G K + E EF  ++ K               
Sbjct: 173 IKYWT---DTNPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIIN 229

Query: 225 XGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIV 284
            GG  +   +G RYW  PG F               F     VF YA FAY G E+  + 
Sbjct: 230 CGGAGNDGYIGARYWHTPGAFST------------GFKGVCYVFCYAAFAYGGIEVMVLT 277

Query: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYV 344
           A+E +NPR+++P A K  +YRI++ Y+ T  ++   V Y+ P   +           P+V
Sbjct: 278 ASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAP---ELTSTGSASRASPFV 334

Query: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404
           +AI + GI V+PHI NA +L  V S  NS LY   R L  L+    APK+F   +  G P
Sbjct: 335 IAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRP 394

Query: 405 YNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGI 464
                +      LA++  S + E +FS+ + ++ +  L  WISI ++++ F  A + QG 
Sbjct: 395 LLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGR 454

Query: 465 DKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVY 519
               + Y++      +W A+   L V LV  F V +     G     K F   Y+  PV 
Sbjct: 455 SLGEVGYKSQTGYWGSWFAIIVSLFV-LVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVL 513

Query: 520 ILCFVCYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQ 576
           I  +  YKI +K  W   I +  VDL +++   D  E+E K E +  KE+ +     W +
Sbjct: 514 IFIYFGYKIYYK-DWRLCIPATEVDLNSHRKIFD--EDELKQEDLDWKEKMRTAS-IWVK 569

Query: 577 FYDY 580
            Y +
Sbjct: 570 IYHF 573

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  231 bits (590), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 159/534 (29%), Positives = 254/534 (47%), Gaps = 29/534 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+ ++ RHV M                     AGP  ++I YSIMG +++ ++   GEM
Sbjct: 130 LKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEM 189

Query: 118 A-AYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           A AY  L  G+  Y +   +   GFA+ + Y  ++L + P +L  A+L ++YW     VN
Sbjct: 190 AIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTT--SVN 247

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
             +++ +F A+I+ IN+ G K + E EF+ +  K                GG  +   LG
Sbjct: 248 SDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLG 307

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
             YW  PG F+   G  SI   KG         V A FAY GTE   + AAE  NPR  +
Sbjct: 308 GLYWHTPGAFR---GDSSIDHFKG----ICGTLVTAAFAYGGTEFLALTAAEQSNPRAAI 360

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P A K  LYRI+  YL ++ ++G  V ++   LL            PYV+A    G+ V+
Sbjct: 361 PSAAKKVLYRIICVYLISILMIGFLVPFDSTRLL--GSDGSATSASPYVLAASLHGVRVV 418

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PH  NA +L  V S  NS  Y  SR L  LA    APK F   +  G P  ++ +  LF 
Sbjct: 419 PHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFG 478

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            +A+   S     +F++ + ++ +  L +W +I +++I F  A +VQG     + Y A  
Sbjct: 479 VIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQT 538

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
               +W AL F + +  +  F V +          + F   Y+ +P+ I+ ++ YKI +K
Sbjct: 539 GVWGSWYAL-FMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYK 597

Query: 532 --TKWIKSANVDLFTYKTAID---LEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
             T  IK+ ++DL +++   D   L+EE+ +        +R ++G  W++  D+
Sbjct: 598 DWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEY------RQRLKNGPFWRRVVDF 645

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  231 bits (588), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 155/531 (29%), Positives = 251/531 (47%), Gaps = 26/531 (4%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
             K   LK+ ++ RHV +                     AGP  +LI YSIMG  ++ ++
Sbjct: 100 NQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCII 159

Query: 112 SCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
              GE+A +Y  L G F  Y +   DPA GF+V + Y  ++L + P +L  A++ ++YW 
Sbjct: 160 QAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWT 219

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
               VN  +++ +F  +I+ IN  G + + E EF+ +  K                GG  
Sbjct: 220 T--TVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAG 277

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           +   +G RYW  PG F   +G   I   KG      +  V A FA+  TE   + AAE  
Sbjct: 278 NDGYIGDRYWHTPGAF---AGDRPIDHFKG----IMATMVTAAFAFGATEFIALTAAEQS 330

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NPR+ +P A K  LYRI+  +L ++ L+G  V Y+   L+            PYV+A+  
Sbjct: 331 NPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLM--GSGGSATKASPYVLAVST 388

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
            G+ V+PH  NA +L  V S  NS  Y  SR LY LA    APK F   +  G P+ ++ 
Sbjct: 389 HGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMV 448

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
              +F  +++   S   E +F++ + ++ +  + +W +I +++I F +A  VQ      +
Sbjct: 449 CAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEI 508

Query: 470 SYQAPFQPVTAWIALGFCLMVA--LVKNFTVFLG----DTFDYKTFITGYIGIPVYILCF 523
            ++A       W +   C M+   L+  F V +        D + F   Y+ +P+ IL +
Sbjct: 509 GFKA---QTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFY 565

Query: 524 VCYKIVHK--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
           V YKI  K  + +I++ N+DL  ++   D  EE  K E    +E+ K  G+
Sbjct: 566 VGYKIWKKDWSLFIRANNIDLDKHRQIFD--EELLKQEDEEYREKLKNGGY 614

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  230 bits (586), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 154/517 (29%), Positives = 263/517 (50%), Gaps = 22/517 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK  L++RH+ M                     AGP +++I +SI G ++++++  + EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + GFA  + Y+ ++LV+ P ++ +A++ + YW    K   
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GVK +GE EF  S+ K                GGGP+   +G 
Sbjct: 209 G-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGA 267

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F    GA +      +F  F SVFV A F++ G+EL GI  +E +NPR+ VP
Sbjct: 268 KYWHDPGAF---VGATA----GAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVP 320

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A K   +RI++FY+ ++  +GL V  ND  L+            P+V+AI   GI  LP
Sbjct: 321 PAAKQVFWRILLFYILSLLFIGLLVPSNDSRLI--GSSNVDAAASPFVIAITVHGIRGLP 378

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR+L  LA     PK+ +  +  G P   +A+ + F  
Sbjct: 379 SVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGL 438

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S     +F++ + ++ +    +W +I + +I F  A + Q    + L + +P  
Sbjct: 439 VAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLG 498

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++  L F +++ L   F V +   GDT     F + Y+ +PV ++ ++ +K+     
Sbjct: 499 VFGSYWGL-FLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKL----- 552

Query: 534 WIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
           W K  N  +F     +DL+    +L++  L++E  + 
Sbjct: 553 WTK--NWKIFIPLGQLDLDTGRKQLDLDLLRQEVAEE 587

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  230 bits (587), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 161/540 (29%), Positives = 258/540 (47%), Gaps = 24/540 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           D    G +LKK +Q RHV +                    QAGP  ++I Y IMG +++ 
Sbjct: 108 DEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYC 167

Query: 110 VMSCLGEMAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           ++   GEMA  Y+ L  GF +Y T   DP   FA  + Y  ++L + P +L  A++ ++Y
Sbjct: 168 IIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKY 227

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
           W    KV+P V++ +F   IL INI+G  + + E EF  +S K                G
Sbjct: 228 WTT--KVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICG 285

Query: 227 GGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286
           G  +   +G RYW DPG F+   G  ++     +F    +  V A F++  +E   + A+
Sbjct: 286 GAGTDGYIGGRYWHDPGAFR---GERAVD----RFKGVVATLVTAAFSFGQSEFIAVTAS 338

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVA 346
           E  NPRR +P A K  +YR +  YL ++ LLG  V YN   LL            PYV+A
Sbjct: 339 EQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLL--GAQSNGIKASPYVLA 396

Query: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYN 406
           + N G+ V+PH  NA ++  V S  NS  Y   R L  L+    APKIF+  +  G P  
Sbjct: 397 VANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTM 456

Query: 407 SLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDK 466
            + + +LF  +A+   S   + +F++ + V+ +  + +W+SI ++++ F RA  VQG   
Sbjct: 457 GIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSL 516

Query: 467 NTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILC 522
               + +      +  +  F L + LV  F V L        D  +F   Y+  P++I  
Sbjct: 517 GECGFLSQVGIYGSAYSF-FVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIAL 575

Query: 523 FVCYKIVHKT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           ++ YK   K    +IKS ++DL  ++   D   E+   +    + ER ++G  WK+ Y +
Sbjct: 576 YIGYKCYTKDWRLYIKSQDIDLVAHRQIYD---EDILRQEREEETERLKNGPYWKRAYSF 632

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  229 bits (585), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 162/523 (30%), Positives = 259/523 (49%), Gaps = 28/523 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L K+L  RH+                        GP +++I + I+   +FTV++ LGE
Sbjct: 85  NLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGE 144

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           ++A  P+  GF  Y+ R+ +P+  FAV   YL ++LVL P +L AA++ ++YW    K+N
Sbjct: 145 LSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKIN 202

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F A I   N++ VK FGE EF LS  K                GGGP    +G
Sbjct: 203 SDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIG 262

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F  +           KF    SVFV A F+Y G E+  + AAE KNPR  +
Sbjct: 263 GKYWNDPGAFVGHDSGT-------KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + I + Y+  + L+G  V  NDP LL            P V+AI+N  I  L
Sbjct: 316 PKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKGL 374

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  V S  NS +Y  SR +  +A     PK   + +  G P N++ L   F 
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFG 434

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S     +F++   ++ +  +  W++I +++I F +A + Q    + L    PF
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDEL----PF 490

Query: 476 QPVTA-WIAL-GF-CLMVALVKNF--TVF-LGDT-FDYKTFITGYIGIPVYILCFVCYKI 528
              T  W ++ GF  L + L+ +F  ++F +G +  + ++F  GY+  P+ I+C+  +KI
Sbjct: 491 ISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKI 550

Query: 529 VHKTKW---IKSANVDLFTYKTAID--LEEEEGKLEMMRLKEE 566
            +   W   +K  ++DL T +  +D  L  +E K+E   L + 
Sbjct: 551 -YTRDWRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKR 592

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  229 bits (583), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 149/502 (29%), Positives = 246/502 (49%), Gaps = 19/502 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK  L+ RH+ M                     AGP  ILI + + G ++++++  +GE+
Sbjct: 79  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGEL 138

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+  GFT+YATR+ D + GFA  + Y+ ++LV+ P ++ AA++ + YW    K   
Sbjct: 139 AVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 198

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GVK +GE EF  S  K                GGG  H  +G 
Sbjct: 199 G-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGA 257

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW +PG F      V    G+ +F  F +VFV A F++ G+EL G+  +E + PR++VP
Sbjct: 258 QYWYNPGAF------VGDTAGQ-QFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVP 310

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A K   +RI +FY+  + L+G+ V  + P L+            P+V+AI N GI  LP
Sbjct: 311 GAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAAS--PFVIAIVNHGIKGLP 368

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR+L  LA     P I    +  G P   +A+   F  
Sbjct: 369 SVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGL 428

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S     +F++ + ++ +  L +W  I + +I +  A   QG   + L +QAP  
Sbjct: 429 IAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAG 488

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++     C+++  +  F V L   G   +   F   Y+   ++I  +  +KI  K  
Sbjct: 489 VWGSYWGFFMCILM-FIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKI-WKRN 546

Query: 534 W---IKSANVDLFTYKTAIDLE 552
           W   I   ++D+ T +  +DL+
Sbjct: 547 WKLFIPLKDLDIDTGRREVDLD 568

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  226 bits (577), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 154/510 (30%), Positives = 241/510 (47%), Gaps = 38/510 (7%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
           H G+  K+ L+ RH+S+                    + GP+A+L+ + I+G V F++M 
Sbjct: 39  HSGV--KRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIME 96

Query: 113 CLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
            +GE+    P  G F + A R+    L    GY Y+  +  +  N+    + ++Q+W   
Sbjct: 97  SIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFW--- 153

Query: 172 GKVNPGV----WITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
               P V    +  +F    L   ++GV  FGE E+WL+ FK                GG
Sbjct: 154 ---GPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGG 210

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
            P    +GF+YWK+PG                 F   A VFV+    Y GTE   + A E
Sbjct: 211 IPGKPPIGFQYWKNPGALSH------------GFRGIAVVFVFCSTFYSGTESVALAATE 258

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
            +NPR+ VP A++ T +RI++ YL   F  G++V YNDP L             P  +A+
Sbjct: 259 SRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTL----GAQTKSLKSPISIAL 314

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
             AG     H+ NA +L    SA NS LY+GSR+L  LA +  AP+I A T+  GVP  +
Sbjct: 315 SRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPA 374

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           L +      ++ MNVS  A   ++Y VN++ +   + W +I IT++ F +A+  QG   +
Sbjct: 375 LIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLS 434

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK 527
            L Y+A F P T   +L   + +AL++ +T  +   F  K F+  YI +P   L +V   
Sbjct: 435 ELPYRALFYPWTTIFSLAANIFLALIQGWTSLV--PFVAKDFVDAYILLPAAGLLYVGIN 492

Query: 528 IVHKTKWIKSANVDLFTYKTAIDLEEEEGK 557
              K +  K+ N+        I+LEE + +
Sbjct: 493 F-WKNRNFKTVNIH------GINLEEGQRR 515

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  228 bits (580), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 157/539 (29%), Positives = 247/539 (45%), Gaps = 27/539 (5%)

Query: 48  GYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVV 107
           G +       LKK +++RHV M                     AGP +++I Y ++ ++ 
Sbjct: 67  GTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFIT 126

Query: 108 FTVMSCLGEMAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVM 165
           + V+   GEMA   P    GF +YA+ +     GFA  + +  ++L + P +L  A++ +
Sbjct: 127 YFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTI 186

Query: 166 QYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 225
           +YW    K+N  V++ +    +L I+  GV+ +GE EF  +S K                
Sbjct: 187 KYW--NDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNC 244

Query: 226 GGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVA 285
           GG      +G +YW+DPG F   + A        +F   A V V A F+Y G EL  +  
Sbjct: 245 GGAGVDGYIGGKYWRDPGAFASDNAA-------SRFKGVAFVLVTAYFSYGGVELFALSV 297

Query: 286 AECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVV 345
            E +NPRR+ P A K ++YRI++ YL T+ L+G +V +N   L+            PYV+
Sbjct: 298 NEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHAS--PYVL 355

Query: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405
           A+   G+ V+PHI NA +L  V S  NS LY   R L  LA    APK F   +  G P 
Sbjct: 356 AVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPL 415

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
            +L LC++F  +A+   S   E +F++   +  +  L +W SIL++++ F  A + QG  
Sbjct: 416 RALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKS 475

Query: 466 KNTLSYQAPFQPVTAWIALGFCLMVALV--KNFTVFLG-----DTFDYKTFITGYIGIPV 518
            N L Y         W +L  C    LV    F V L        +  + F   Y+  PV
Sbjct: 476 LNELGY---ISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPV 532

Query: 519 YILCFVCYKIVHK--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWK 575
           ++  ++ Y +  +  T       +DL  ++   D   E  + E    KE  +  GWT K
Sbjct: 533 WLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYD--PELLRQEDEETKERIRNGGWTQK 589

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  228 bits (580), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 246/502 (49%), Gaps = 22/502 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L KDL  RH+                        GP +++I + I+   +FTV++ LGE+
Sbjct: 78  LNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGEL 137

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           AA  P+  GF  Y TR+ DP+  FAV   YL ++LVL P +L AA++ ++YW     +N 
Sbjct: 138 AAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NSTINS 195

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             W+ +F  VI   N++ VK FGE EF LS  K                GGGP    LG 
Sbjct: 196 DAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGG 255

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW +PG F  ++          KF    SVFV A F+Y G E+  + AAE K+PR+ +P
Sbjct: 256 KYWHNPGAFVGHTSGT-------KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIP 308

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K T + I   Y+  + L+G  V Y+DP L+            P V+AI+N GI  L 
Sbjct: 309 KAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAAS-PLVIAIENGGIKGLD 367

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + NA +L  + S  NS +Y  SR +  +A     PK   K +  G P N+  +   F  
Sbjct: 368 SLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGL 427

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           L+++  S     +F++   ++ +  +  W++I I++I F +A   Q    + + Y     
Sbjct: 428 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPY---LS 484

Query: 477 PVTAWIAL--GFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
               W +L     L + LV +F   L    GD+ D ++F  GY+ +P+ I+C++ +K+  
Sbjct: 485 QTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYF 544

Query: 531 KT-KWIKS-ANVDLFTYKTAID 550
           K   W+ +   +DL T + A+D
Sbjct: 545 KNWSWVVTLEEMDLDTGRKALD 566

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  228 bits (580), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 156/528 (29%), Positives = 262/528 (49%), Gaps = 28/528 (5%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
           + +  R  KDL  RH+                        GP +++I + I+   +FT++
Sbjct: 66  EDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIV 125

Query: 112 SCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVG 170
           + LGE+++  P+  GF  Y +R+ +P+ GFAV   YL ++ VL P +L AA+L ++YW  
Sbjct: 126 NALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW-- 183

Query: 171 RGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPS 230
              +N   W+ +F  +IL  N++ VK FGE EF LS  K                GGGP 
Sbjct: 184 NHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPK 243

Query: 231 HNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
              +G +YW +PG F  ++          +F    SVFV A F+Y GTEL  + AAE  N
Sbjct: 244 GGYIGGKYWSNPGAFVGHTAG-------DRFHGLCSVFVTAAFSYSGTELIAVSAAESVN 296

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNA 350
           PR  +P+A K T + I V Y+  + L+G  V+ +DP LL            P V+AI+N 
Sbjct: 297 PRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAAS-PLVIAIENG 355

Query: 351 GIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLAL 410
           GI  LP + NA +L  V S  NS +Y  SR +  +A     PK+F   +  G P  ++  
Sbjct: 356 GIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVA 415

Query: 411 CTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLS 470
             +F  L+++  S   E +F++   ++ +  L  W +I +++I F R  + +G   + L 
Sbjct: 416 TLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDEL- 474

Query: 471 YQAPFQPVTA-WIALGFCLM--VALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCF 523
              PF  +T  W +   C++  + LV  F   L    G+  + ++F   Y+  P+ + C+
Sbjct: 475 ---PFVSMTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACY 531

Query: 524 VCYKIVHKTKW---IKSANVDLFTYKTAIDLE--EEEGKLEMMRLKEE 566
             +K+  ++ W     +  +DL + + A+DLE  ++E ++E   ++++
Sbjct: 532 FGHKLYTRS-WRLLTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQK 578

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  228 bits (580), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 163/529 (30%), Positives = 257/529 (48%), Gaps = 30/529 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           + K+ +++RHV M                      GP  +LI YS++  V + +M   GE
Sbjct: 81  KFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGE 140

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA AY  L G F  Y++ +   + GFA  + Y  ++L + P +L  A+L ++YW     +
Sbjct: 141 MAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYW--NSSI 198

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP  +I +F AVI+ I+  G   +GE EF  S+ K                GG  +   +
Sbjct: 199 NPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYI 258

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G  YW++PG F   +G   I    G F   A V V A F+Y G EL  +   E  NPR+ 
Sbjct: 259 GGEYWRNPGAF---AGGSPI----GHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKA 311

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           VP A K  +YRI++ Y+ T+ L+G  V YN   L+            PYV+A+ + G+ V
Sbjct: 312 VPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHAS-PYVIAVASHGVKV 370

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS +Y   R L  LA    APKIF+  +  G P  +L  C++F
Sbjct: 371 VPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIF 430

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L+++  S   E +F++   +  +  L +W +I ++++ F  A + QG   + L Y++ 
Sbjct: 431 GLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSK 490

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
                +  A+ F ++V  V  F V L     G   D + F   Y+  P++I C+V YKI 
Sbjct: 491 TGYWGSIYAIFFNIIV-FVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYKIY 549

Query: 530 HKTKW---IKSANVDLFTYKTAID---LEEEEGKLEMMRLKEERKQHGW 572
            K +W   +    +DL +++   D   L++E+ +      KE+ K  GW
Sbjct: 550 SK-EWKLLVPLDEIDLNSHRHIFDKHILQQEDDE-----HKEKLKNSGW 592

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  228 bits (580), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 256/536 (47%), Gaps = 30/536 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +L+K +Q RHV M                     AGP  +LI Y IM   ++ ++   GE
Sbjct: 79  QLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138

Query: 117 MAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA  Y+ L  GF +Y +   D A  FAV + Y  ++L + P +L  A++ ++YW    KV
Sbjct: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKV 196

Query: 175 NPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR 233
           +P V++T+F  +I+ IN+ G  + + E EF+ +  K                GG  +   
Sbjct: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGY 256

Query: 234 LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRR 293
           +G  YW +PG F+ ++     PG +  F    S  V A F++  TE   I A+E  NPR+
Sbjct: 257 IGVSYWNNPGAFRGHT-----PGTR--FKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309

Query: 294 NVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIP 353
            +P A K  +YR +  Y+ ++ ++G  V YN P LL            PYV+A+ + GI 
Sbjct: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL--GSKSSQTKASPYVIAVASHGIR 367

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
           + PH  NA +L  V S  NS  Y  SR L  LA    APKIF   +  G P   +   +L
Sbjct: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
              +A+   S     +FS+ + ++ +  + +W +I +++I F RA ++QG   N L Y++
Sbjct: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487

Query: 474 PFQPVTAW--IALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVCYK 527
               V  W  I     + + L+  F V L     +  +   F   Y+ +P+ +L +  YK
Sbjct: 488 ---QVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK 544

Query: 528 IVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
              K  W   I++ ++DL +++   D  E+  K E  + KE  K +G  W + Y +
Sbjct: 545 -TWKKDWNLFIRAKDIDLISHRHIYD--EDVLKQEKNQYKENLK-NGSLWLKIYAF 596

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  227 bits (578), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 150/533 (28%), Positives = 258/533 (48%), Gaps = 34/533 (6%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++KK ++ RH+ M                    +AGP  +++ Y +   +++ ++   GE
Sbjct: 64  KMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGE 123

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           +   Y  + G +T+Y++   DPA+GF+V + Y  +++ + P QL  AA+++QYW     +
Sbjct: 124 LGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWT---DI 180

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP +++ +  AVI+ IN+ G K + E EF+ +  K                GG  +   +
Sbjct: 181 NPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYI 240

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW +P   +P+            F     VF YA FAY G E+  + A+E +NPR++
Sbjct: 241 GDKYWHEP---RPFMNG---------FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKS 288

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           +  A K  +YRIV+ YL T  ++   V  + P L             P V+A+   G+ +
Sbjct: 289 ISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSL-----ASEGSRASPLVIAVSFHGVKI 343

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY   R L  LA    APKIF   +  G P  +  +  +F
Sbjct: 344 VPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVF 403

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             LA++  S + + +F + + ++ +  +  W+SI I++I F  A + QG     + Y+A 
Sbjct: 404 GLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKAR 463

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDT----FDYKTFITGYIGIPVYILCFVCYKIVH 530
                +WIA+    ++ L+  F V +        D ++F   Y+  P+ +L +  YKI H
Sbjct: 464 TGYWGSWIAVVTAFLI-LIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYH 522

Query: 531 KTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           K  W   I ++ VDL +++   D  E+E K E +  K + K     W + Y +
Sbjct: 523 K-DWRICIPASEVDLISHRQVFD--EDELKQEDLEWKLKLKSSP-IWVRIYHF 571

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  227 bits (579), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 160/537 (29%), Positives = 253/537 (47%), Gaps = 45/537 (8%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG      LK+ L+ARH+ M                      GP+A++I +SI G  +  
Sbjct: 77  DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVG 136

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
            +  LGE+    P+ G F +Y+TR+ DP++ F +   Y+ ++  + P ++ A+A+ +QYW
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW 196

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                ++P VW+ +F  VI++IN+ G + FGE EF  SS K                GGG
Sbjct: 197 --NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGG 254

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P H+ +G RYW DPG                 F    SV V A ++  GTE+  + + E 
Sbjct: 255 PDHDFVGARYWHDPGCLSH------------GFPGVLSVLVVASYSLGGTEMVCLASGE- 301

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPR  +P AIK T +RI+ F+L ++ L+G  V Y +P LL            P+V+AIK
Sbjct: 302 TNPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLL----GGSSVNNSPFVIAIK 356

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
              I  LP I NA +L  + S  NS ++  SR+L  +A     PK F   +  G P   +
Sbjct: 357 LHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGI 416

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
              +LF  LA++  SSS   +F + + +  +   + W+SI I++I F  A + QG   + 
Sbjct: 417 LTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDE 476

Query: 469 LSYQAPFQPVTAWIALGFCLM--VALVKNFTVFL-------GDTFDYKTFITGYIGIPVY 519
           L +      V  W +    L+  + L+  F   L         +   KTF   Y+   + 
Sbjct: 477 LEF---VSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIM 533

Query: 520 ILCFVCYKIVHK---TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKE---ERKQH 570
              FVC+K+ ++    KW    ++D       IDLE +   +++  LK+   ER +H
Sbjct: 534 AFLFVCHKVFYRYKTGKWWAIMDLD------KIDLETDRKNIDIDVLKQEIAERNRH 584

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  227 bits (579), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 153/522 (29%), Positives = 256/522 (49%), Gaps = 34/522 (6%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+ L+ RH+ M                      GP A+++A+ + G +V++V+  +GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
              +P+ G + SY +R+ DP+ GFA+ Y YL   LV  P ++ AA++ + YW    K   
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR-LG 235
           G ++ +F   +L IN +GVK +GE EF  S  K                GGG ++   +G
Sbjct: 204 G-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW +PGGF               F  FA++FV + F++ G+E+  + AAE KNPRR++
Sbjct: 263 TKYWHNPGGFAH------------GFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDL 310

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K   +RI +FYL ++ L+G  V Y +  L             P+V+AIK AGI  L
Sbjct: 311 PKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAIKEAGISGL 368

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + N  +L  V S  N+ ++  SR+   LA     PK FA  +  G P   L L  +F 
Sbjct: 369 PSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFG 428

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L++++ S     +F + + V+ +    +W SI + ++ F +  R QG   + L+++A  
Sbjct: 429 LLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKA-- 486

Query: 476 QPVTAWIALGFCLMVALVKNFTVF-----LGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
                W ++    ++++V  F  +     L  +     F   Y+ +PV I+ ++ +K V+
Sbjct: 487 -QTGIWGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHK-VY 544

Query: 531 KTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQ 569
              W   I +  +DL T +  +DLE     L    +KEE + 
Sbjct: 545 SRNWRLVIPAKELDLDTGRREVDLE-----LLKQEIKEENES 581

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  227 bits (579), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 157/530 (29%), Positives = 252/530 (47%), Gaps = 24/530 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LKK +++RHV M                    +AGP  ++IAY ++ +V + ++   GE
Sbjct: 74  QLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGE 133

Query: 117 MAAYIP-LDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA   P L G F +Y + +     GFA  + +  ++L + P +L  AA+ +QYW     +
Sbjct: 134 MAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYW--NDSI 191

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  V++ +F   +L I+  GVK +GE EF  +  K                GG  +   +
Sbjct: 192 NADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYI 251

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW DPG F   + A       G+F     V V A F+Y G EL  +   E +NPRR+
Sbjct: 252 GAKYWHDPGAFTSDTNA-------GRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRS 304

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRIVV YL T+ L+G +V  N   L+            PYV+A    G+ V
Sbjct: 305 TPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELM--GSGGSVTHASPYVLAASIHGVKV 362

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  + S  NS LY   R +  LA    APK     +  G P  +L +C++F
Sbjct: 363 VPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVF 422

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             + ++  SS  E +F++   +  +  L +W  I+I++I F +A ++Q    + + Y++P
Sbjct: 423 GVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSP 482

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFVCYKIVH 530
           F    ++  + F L+V  V  F V L           TF   Y+  P++   +  Y I  
Sbjct: 483 FGVYGSYFGVFFNLLV-FVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWK 541

Query: 531 K--TKWIKSANVDLFTYKTAIDLE----EEEGKLEMMRLKEERKQHGWTW 574
           +  T +    +VDL  ++   D E    E+E K EM++     K+  + W
Sbjct: 542 RDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKKEMLKNSPMWKRMYYFW 591

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  227 bits (579), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 158/533 (29%), Positives = 257/533 (48%), Gaps = 24/533 (4%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           D   K   LK++++ RHV M                      GP ++LI Y+I+  +++ 
Sbjct: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138

Query: 110 VMSCLGEMAA-YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           V+    E+A  Y  L G F +Y     D A  F+V + Y  ++L + P +L  A++ ++Y
Sbjct: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W     +NP  ++ +F  V++ IN +G   + E EF+ ++ K                GG
Sbjct: 199 W--NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGG 256

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
             +   LG  YW DPG F+  +G         +F    +V V A FAY G E   + AAE
Sbjct: 257 AGNDGYLGSVYWHDPGAFRGNNGI-------NRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
            +NP++++  A K  +YRI+  YL T  LLG  V YN P LL            P+V+AI
Sbjct: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL--GSGSAATHASPFVIAI 367

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
            + G+ V+PHI NA +L  V S  NS LY  SR L  L+    APK+F   +  G P   
Sbjct: 368 ASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRC 427

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           L +  +F  L ++  S   ET+F++ + ++ +  L +W SI ++++ F R+  VQG   +
Sbjct: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCF 523
            L YQ+      A+ A+   L++ L+  F V +     +  D   F   Y+ +P+ I  +
Sbjct: 488 ELGYQSWTGVWGAYYAMIMILLI-LIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLY 546

Query: 524 VCYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWT 573
           + YK+ ++  W   I +  VDL +++   D E  +   E +  KE+ +   WT
Sbjct: 547 LGYKLWYR-DWRVIIPANEVDLVSHRKIFDAEIMQS--EQLEEKEQLRHASWT 596

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  227 bits (578), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 151/541 (27%), Positives = 255/541 (47%), Gaps = 31/541 (5%)

Query: 45  VDWGYD-GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIM 103
           V++G +  +    +LK+ +  RHV M                      GP  ++I Y+IM
Sbjct: 76  VEFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIM 135

Query: 104 GWVVFTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAA 161
           G  ++ ++   GE+A +Y  L G F +Y +   + A GF+V + Y  ++L + P +L  A
Sbjct: 136 GSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTA 195

Query: 162 ALVMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXX 221
           ++ ++YW     VNP +++ +F  +I+ +N+ G + + E EF+ +  K            
Sbjct: 196 SITIKYWTT--SVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGI 253

Query: 222 XXXXGGGPSHNRLGFRYWKDPGGF---KPYSGAVSIPGGKGKFVSFASVFVYALFAYLGT 278
               GG  +   +G RYW +PG F   KP             F    S  V A FA+  T
Sbjct: 254 IVNCGGAGNDGYIGGRYWNNPGAFYGTKPIH----------HFKGIISTMVTAAFAFGAT 303

Query: 279 ELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXX 338
           E   + AAE  NPRR +P A K  +YRI++ +L  + L+G  V +N P L+         
Sbjct: 304 EFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELM--GSGSSAT 361

Query: 339 XXXPYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKT 398
              PYV+A+ + G+ V+PH  NA +L  V S  NS  Y  SR L  LA    AP      
Sbjct: 362 HASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFI 421

Query: 399 NSWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRA 458
           +  G P  ++ +  +F  ++++  S   ET+F++ + ++ +  L +WISI +++I F +A
Sbjct: 422 DRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKA 481

Query: 459 FRVQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGD----TFDYKTFITGYI 514
             VQG     L Y++      ++ A  F +   L+  F V +        D  +F   Y+
Sbjct: 482 LIVQGKPIGELGYKSQTGVAGSYYAT-FIMGCILIGQFWVAIAPMGSAKLDANSFFENYL 540

Query: 515 GIPVYILCFVCYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHG 571
            +P++++ +  +KI  K  W   I    +DL +++   D  EE  K E    +E  +  G
Sbjct: 541 ALPLFVVLYFGFKI-WKRDWRLYIPLEQIDLDSHRKTFD--EELLKQEDAEYEENIRNKG 597

Query: 572 W 572
           W
Sbjct: 598 W 598

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  226 bits (576), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 150/533 (28%), Positives = 253/533 (47%), Gaps = 31/533 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LKK +++RHV M                      GP A++I Y ++ +V + ++   GE
Sbjct: 90  KLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGE 149

Query: 117 MAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA   P     F +Y++ +     GFA  + Y F++L + P +L  AA+ +++W     +
Sbjct: 150 MAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFW--NDTI 207

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP ++I +F   +L I+  GVK +GE EF  +  K                GG  +   +
Sbjct: 208 NPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYI 267

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW++PG F   + A       G+F +   + V A F++ G EL  +   E  NPR+ 
Sbjct: 268 GGKYWRNPGAFAGDTSA-------GRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKT 320

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRI+V YL T+ L+G +V YND  L+            PYV+A    G+ V
Sbjct: 321 TPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLM--GAGGSATHASPYVLAASIHGVKV 378

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY G R +  LA     PK     +  G P  +L +C++F
Sbjct: 379 VPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVF 438

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             + ++  SS  E +F++   +  +  L +W SI+++++ F +A +VQG   + L Y+A 
Sbjct: 439 GVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKAT 498

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
                +   + F ++V  +  F V L     G     ++F   Y+  P++I  ++ Y I 
Sbjct: 499 TGIWGSAYGVFFNILV-FIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIY 557

Query: 530 HKT----KWIKSANVDLFTY------KTAIDLEEEEGKLEMMRLKEERKQHGW 572
           ++       +   ++D   +          DLE EE K +M  ++  +  H W
Sbjct: 558 NRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEERKRDMSLMR--KTYHFW 608

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  226 bits (576), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 152/502 (30%), Positives = 259/502 (51%), Gaps = 19/502 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK  L+ RH+ M                      GP ++LI +   G +++ ++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + G+A  + Y+ ++LV+ P ++ +A++ + +W    K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F   I+ IN+ GVK +GE EF  S  K                GGGP+   +G 
Sbjct: 206 G-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGG 264

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F     A   PG K  F    SVFV A F++ G+EL G+ A+E   PR++VP
Sbjct: 265 KYWHDPGAF-----AGDTPGAK--FKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVP 317

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K   +RI +FY+ ++ ++GL V YND  L+            P+V+AIK  GI  LP
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAAS--PFVIAIKTHGIKGLP 375

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR++  LA  +  P+IF+  +  G P   +A+ + F  
Sbjct: 376 SVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGL 435

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S     +F++ + ++ +  L +W  I I +I F +A   QG   + LS+++P  
Sbjct: 436 IAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTG 495

Query: 477 PVTAWIALGFCLMVALVKNFTVF---LGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++  L F +++  +  F V    +GD+   + F   Y+  P+ ++ ++ +KI +K  
Sbjct: 496 VWGSYWGL-FMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKI-YKRN 553

Query: 534 W---IKSANVDLFTYKTAIDLE 552
           W   I +  +D+ T +  +DL+
Sbjct: 554 WKLFIPAEKMDIDTGRREVDLD 575

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  226 bits (575), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 152/513 (29%), Positives = 256/513 (49%), Gaps = 22/513 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L++ L+ RH+ M                      GP  +LI + ++G +++ V+  +GE+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + GFA+ Y Y+ ++LV+ P ++ AA++ + +W    K   
Sbjct: 137 AVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN  GV+ +GE EF  S  K                GGGP    +G 
Sbjct: 197 G-FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGG 255

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW +PG F       S      +F    SVFV A F++ GTEL G+ +AE  NPR+ +P
Sbjct: 256 KYWHNPGAF-------SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALP 308

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           RA K   +RI++FY+ ++ L+GL V +    L+            P+V+AI+  GI  LP
Sbjct: 309 RAAKQVFWRILLFYIISLCLIGLLVPHTSERLI--GTSSVDAAASPFVLAIQTHGIKGLP 366

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SRS+  LA     P IFA  +  G P  ++    +F  
Sbjct: 367 SVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGL 426

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           L+++  S     +F++ + ++ +  L SW +I I +I F RA   QG   + L++ +   
Sbjct: 427 LSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAG 486

Query: 477 PVTAWIALGFCLMVALVKNFTVF---LGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++  +   L+V L+  F V    +G + + + F + Y+  PV +  ++ +KI  +  
Sbjct: 487 IAGSYFGVILVLLV-LIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKR-- 543

Query: 534 WIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE 566
                N  LFT    ID++    +++   L++E
Sbjct: 544 -----NWKLFTRAKDIDIDTGRREMDTEALRQE 571

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  226 bits (576), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 153/517 (29%), Positives = 251/517 (48%), Gaps = 24/517 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L + L+ RH+ M                     AGP  +LI + +   ++  +   LGE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G + +YA R+ D + GFA  + Y+ + +V+ P ++ AA++ + YW    K   
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             ++ +F  VI++IN+ GV+ FGE E   S  K                GGGP H  +G 
Sbjct: 203 A-FVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGG 261

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG   P+ G         KF    SVFV A F++ G+EL G+ AAE + PR+++P
Sbjct: 262 KYWNDPG---PFVGNAP----SDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIP 314

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K   +RI +FY+ ++ ++GL V  N+  LL            P+V+A+    I VLP
Sbjct: 315 KAAKQVFWRITLFYILSLLIVGLLVPSNNEHLL--APQQIDAAHSPFVIAMDMHRIRVLP 372

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            I N  +LT V S  NS +Y  SR++  LA     PKIF   +  G P  ++   +LF  
Sbjct: 373 SIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGL 432

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           L ++  +     +F + + ++ +    +W++I + ++ F  A + QG   N LS+ +P  
Sbjct: 433 LCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTG 492

Query: 477 PVTAWIALGFCLMVALVKNFTVFL----GDTFDYKT----FITGYIGIPVYILCFVCYKI 528
            + +  A+G  + V LV  F V L     D    K     F   Y+   V I+ ++ +KI
Sbjct: 493 FIGSCYAVGL-ICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKI 551

Query: 529 VHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMR 562
             +  W   IK+  +D+ T +  +DLE  + +L   R
Sbjct: 552 WSRN-WKFFIKAKEMDIDTGRRELDLELFKEELAQER 587

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  225 bits (573), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 153/501 (30%), Positives = 236/501 (47%), Gaps = 40/501 (7%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K+ L+ RH+S+                      GP+A+L+ + I+G + F +M  +GEM
Sbjct: 56  VKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEM 115

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
               P  G FT+   R+   AL    GY Y   +  +  N+    + +MQ+W       P
Sbjct: 116 ITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFW------GP 169

Query: 177 GV----WITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN 232
            V    +I +F A      ++GV  FGE E+WL+ FK                GG  +  
Sbjct: 170 QVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRP 229

Query: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292
             GF+YW DPG                 F   A+VFV+    Y GTE   + A E KNPR
Sbjct: 230 AFGFQYWNDPGALS------------NGFKGIANVFVFCSTFYSGTESVALAATESKNPR 277

Query: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI 352
           R VP AI+ T +RI++ YL      G++V YND    +           P  +AI  AG 
Sbjct: 278 RAVPIAIRQTFWRILIVYLGISIFYGVTVPYND----ENLNFATKVLKSPIAIAISRAGW 333

Query: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412
           P   H+ NA +L    SA N  LY+GSR+L  LA +  APK+ A T+  GVP  ++ +  
Sbjct: 334 PAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFN 393

Query: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472
               ++ MNVS +A   ++Y VN++ +   + W  I +T++ F +A+++QG  ++ L Y+
Sbjct: 394 ALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYK 453

Query: 473 APFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKT 532
           A   PV   +++   + + LV+ ++ F    FD K F+  YI IP  I+ ++      KT
Sbjct: 454 AKLFPVFPIVSIIANIFLGLVQGWSYF--KPFDAKNFVDAYILIPAGIILYLGVS-YWKT 510

Query: 533 KWIKSANVDLFTYKTAIDLEE 553
           K           + TA+DL E
Sbjct: 511 K----------GFLTAVDLSE 521

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  228 bits (580), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 162/548 (29%), Positives = 261/548 (47%), Gaps = 29/548 (5%)

Query: 46  DWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGW 105
           D   +   K   LKK ++ RHV M                    QAGP  ++I + IMG 
Sbjct: 146 DAQINDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGS 205

Query: 106 VVFTVMSCLGEMA-AYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAAL 163
            ++ ++  +GE+A AY  L  GF +Y +   D A  FAV + Y  ++L + P +L  A++
Sbjct: 206 CLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASM 265

Query: 164 VMQYWVGRGKVNPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXX 222
            ++YW    KV+P +++ +F  +I+ IN++G    + E EF  +S K             
Sbjct: 266 TIKYWTT--KVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGIT 323

Query: 223 XXXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCG 282
              GG  +   +G +YW DPG  +   G  SI     +F    +  V A FA+  +E  G
Sbjct: 324 VICGGAGTDGYIGAKYWHDPGALR---GDTSIQ----RFKGCMATLVNAAFAFGMSEFIG 376

Query: 283 IVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXP 342
           + A+E  NPR+ +P A K  +YRI+  +L ++ ++G  V YN   LL            P
Sbjct: 377 VTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLL--GSTGSGVKASP 434

Query: 343 YVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWG 402
           YV+AI   G+ V+PH  NA +L  V S  NS  Y  SR L  LA    APKI++  +  G
Sbjct: 435 YVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREG 494

Query: 403 VPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQ 462
            P   +A   +F  +A+   S   + +F + + ++ +  L +W++I I++I F RA  VQ
Sbjct: 495 RPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQ 554

Query: 463 GIDKNTLS-------YQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIG 515
           G     L        Y + +  +  ++ L     VALV      L    D K F   Y+ 
Sbjct: 555 GRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVP-INADLTIKLDAKNFFENYLA 613

Query: 516 IPVYILCFVCYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
           +P+ +  +  YKI  K  W   I++ N+DL +++   D E  + + +  R   ER + G 
Sbjct: 614 MPILLAFYFGYKI-WKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDEYR---ERLRTGP 669

Query: 573 TWKQFYDY 580
            W++ YD+
Sbjct: 670 KWRRVYDF 677

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  223 bits (569), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 155/501 (30%), Positives = 235/501 (46%), Gaps = 36/501 (7%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K+ L+ RH+S+                    + GP+A+L+ +SI+G + FT+M  +GEM
Sbjct: 51  VKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEM 110

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
               P  G FT+ A R+   +L    GY Y+  +  +  N+    + + Q+W       P
Sbjct: 111 ITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFW------GP 164

Query: 177 GV----WITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN 232
            V    +I +F A      + GV  FGE E+WLS FK                GG     
Sbjct: 165 QVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRP 224

Query: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292
             GF YW +PG                 F   A VFV+    Y GTE     A+E KNP 
Sbjct: 225 AFGFHYWNNPGALSH------------GFKGIAEVFVFCSTFYSGTESVAYSASESKNPN 272

Query: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI 352
           R +P AI+ T +RI+V Y+   F  G++V YND  L             P  +AI  AG 
Sbjct: 273 RAIPLAIRQTFWRILVVYIGIGFFYGVTVPYNDHNL----NAGTKALKSPISIAITRAGW 328

Query: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412
               H+ NA +L    SA N  L++GSR++  LA +  APK  A T+  GVP  ++ L  
Sbjct: 329 EGGTHLVNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFN 388

Query: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472
               ++ MNVS  A T +SY VN++ +   + W +I +T++ F +A+  QG     L Y+
Sbjct: 389 ALGLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYK 448

Query: 473 APFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKT 532
           A F P T  I +   + +AL++ +T F+   F    F+  Y+ +P   + ++   ++ KT
Sbjct: 449 ALFYPYTQIIGIAANIFLALIQGWTSFV--PFKAGDFVDAYVLLPAAAVLYIGISLL-KT 505

Query: 533 KWIKSANVDLFTYKTAIDLEE 553
              K+  VDL T    IDL+E
Sbjct: 506 HSFKT--VDLLT----IDLDE 520

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  224 bits (571), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 151/528 (28%), Positives = 251/528 (47%), Gaps = 26/528 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LKK +++RHV M                      GP A++I Y ++ ++ + ++   GE
Sbjct: 90  KLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGE 149

Query: 117 MAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA   P     F +Y++ +     GFA  + Y F++  + P +L  A++ +Q+W    K+
Sbjct: 150 MAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFW--NDKI 207

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP ++I +F   +L ++  GVK +GE EF  +  K                GG  +   +
Sbjct: 208 NPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYI 267

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G  YW  PG F   +G  SI     +F +   + V A F++ G EL  +   E  NPR++
Sbjct: 268 GGAYWHKPGAF---AGDTSI----ARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKS 320

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRIVV YL T+ L+G +V YND  LL            PYV+A    G+ +
Sbjct: 321 TPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLL--GAGGSATHASPYVLAASIHGVRI 378

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY G R +  LA    APK     +  G P  +L +C + 
Sbjct: 379 VPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVI 438

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             +A++  SS  E +F++   +  +  L +W SI+++++ F +A +VQG   N L Y+A 
Sbjct: 439 GVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKAT 498

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
              +   I   F  ++  +  F V L     G   + + F   Y+  P++++ ++ Y I 
Sbjct: 499 -TGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIY 557

Query: 530 HK--TKWIKSANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQH 570
           ++  T       +DL  ++   D      E+EE K ++  +    K H
Sbjct: 558 NRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENKEKIKNMSFLSKAH 605

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  224 bits (571), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/519 (28%), Positives = 249/519 (47%), Gaps = 21/519 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            LKK +++RHV M                     +GP  +++AY ++ +V + ++   GE
Sbjct: 100 HLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGE 159

Query: 117 MAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA   P     F SY + +     GFA  + +L ++L + P +L  ++L ++YW    K+
Sbjct: 160 MAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYW--NDKI 217

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  V++ +F   +L I+  GV+ +GE EF  +S K                GG      +
Sbjct: 218 NSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYI 277

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW DPG F  ++         G+F     + V A F+Y GTEL  +   E +NPR++
Sbjct: 278 GGKYWHDPGAFTSHTNI-------GRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKS 330

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P+A K ++YRIVV YL T+ L+G +V +++  L+            PYV+A    G+ +
Sbjct: 331 TPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLM--GSHGSATHASPYVLAASIHGVRI 388

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PH  NA +L  V S  NS LY   R L  LA    APK     +  G P  +LA C+LF
Sbjct: 389 VPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLF 448

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             + +   S+  E +F++   +  +  L +W  I+++++ F +A +VQG D N L Y+A 
Sbjct: 449 GVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAV 508

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
                +   + F ++V   + F V L   G      +F   Y+  P++   +  Y + +K
Sbjct: 509 SGVWGSVYGVFFNILVFFAQ-FWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNK 567

Query: 532 --TKWIKSANVDLFTYKTAIDLE--EEEGKLEMMRLKEE 566
             T  I   ++DL  ++   D E   +E + + ++LK  
Sbjct: 568 DFTFLIPLESIDLDFHRRVYDPEFIRQEREEKKIKLKNS 606

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  222 bits (566), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 249/519 (47%), Gaps = 24/519 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L++ L+ RH++M                    Q GP ++ + Y+IMG VV+  + CLGEM
Sbjct: 54  LQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEM 113

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           + Y+P+ G F SYA ++   +   A+ + Y F   V   + +TA  LVM YW       P
Sbjct: 114 STYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGFP 173

Query: 177 GVWIT--VFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
             W    +F  +++ +N++ V+F+GE E+WL+  K                G  P H  +
Sbjct: 174 -YWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYI 232

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           GF+ W    G  P+     + G KG    FAS+FV A FAY GTE   +   E  NP RN
Sbjct: 233 GFKNWNH--GEAPF-----VDGFKG----FASLFVSASFAYGGTESITLTNGEAANPLRN 281

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P+ +K   +RI+VFY+ + F + +++ Y+ P L             P+ +  + AG   
Sbjct: 282 TPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGL-----DTKSVVTSPFTLVFQMAGTKA 336

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAP-KIFAKTNSWGVPYNSLALCTL 413
                NA ++T V SACN  L+ GSR +Y + ++   P KI ++TN + VPY S+ + + 
Sbjct: 337 AGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSS 396

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
              L +      A T++++  N+  +   ++W+ I IT I F +    QG   + L Y+ 
Sbjct: 397 IGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQG-KTHELRYKN 455

Query: 474 PFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              P   +  + F   + LV+ ++ F  D +D   F + Y+ + V+  CF+ + +  + +
Sbjct: 456 WTYPYGPYFLVIFVTFIILVQGWSAF--DPWDVTNFFSYYLDLFVFPFCFIIWWLYKRDR 513

Query: 534 WIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
           ++K  ++D  T +     E  E    +  LK  ++   W
Sbjct: 514 FVKLEDMDFVTDRYIPTKEIIELNENLDHLKGWKRTRQW 552

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  223 bits (569), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 153/531 (28%), Positives = 252/531 (47%), Gaps = 27/531 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +LKK +++RHV M                      GP A++I Y ++ +V + ++   GE
Sbjct: 90  KLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAAGE 149

Query: 117 MAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA   P     F +Y++ +     GFA  + Y F++L + P +L  A++ +QYW    K+
Sbjct: 150 MAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYW--NDKL 207

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP V+I +F   +L I++ GVK +GE EF  +  K                GG      +
Sbjct: 208 NPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYI 267

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G  YW +PG F   +G  SI     +F +   + V   F++ G EL  +   E  NPR++
Sbjct: 268 GGAYWHNPGAF---AGDTSI----ARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKS 320

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRIV+ YL T+ L+G +V YND  L+            PYV+A    G+ +
Sbjct: 321 TPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLM--GAGGSATHASPYVLAASIHGVKI 378

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY G R +  L+    APK     +  G P  +L +C +F
Sbjct: 379 VPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIF 438

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             +A++  SS  E +F++   +  +  L +W SI+++++ F +A +VQG   + L Y+A 
Sbjct: 439 GVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKAT 498

Query: 475 FQPVTAWIALGFCLMVALVKNFTVF--LGDT--FDYKTFITGYIGIPVYILCFVCYKIVH 530
                +     F ++V + + +     LG+      ++F   Y+  P+++  F  Y I +
Sbjct: 499 TGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYN 558

Query: 531 K--TKWIKSANVDLFTYKTAIDLE-------EEEGKLEMMRLKEERKQHGW 572
           +  T       +DL  ++   D E       E E K + M L   +  H W
Sbjct: 559 RDFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEKTKNMSLM-RKAYHFW 608

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  223 bits (567), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 155/532 (29%), Positives = 252/532 (47%), Gaps = 24/532 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK +++ RH++M                      GP  ++I Y     +++ V+    E+
Sbjct: 68  LKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127

Query: 118 A-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
             AY  L G + +Y T   D   GFAV   Y  ++  + P +L  A++ ++YW     VN
Sbjct: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTS--SVN 185

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
           P V++ +F   +L I+  G + + E EF  +S K                 G      +G
Sbjct: 186 PDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLT-AGASEQGYIG 244

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F    G  +I     +F    SV+V A FAY G+E   + AAE  NPR +V
Sbjct: 245 GQYWHDPGAF---GGDRAID----RFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESV 297

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K  LYR+VV +L  V L+G  V +N   LL            P+V+A    G+ V+
Sbjct: 298 PKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRAS-PFVIAAALHGVRVV 356

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHI N  +LT V S  NS +Y   R L  LA     PKIF   +  G P  +L   +LF 
Sbjct: 357 PHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFG 416

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            +A++  S+  E +F++   +  +  L +W +I ++++ F RA RVQG     L Y+A  
Sbjct: 417 LIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANT 476

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLG-----DTFDYKTFITGYIGIPVYILCFVCYKIVH 530
             + ++ A+ F ++V L+  F + +         D + F   Y+  PV ++ ++ YK+  
Sbjct: 477 GALGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWK 535

Query: 531 KT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           +     I S+ VDL +++   D   EE  L+    ++ER ++   +K+  D+
Sbjct: 536 RDFRLVIPSSEVDLLSHRQIFD---EEVLLQEEAERKERLRNSTLFKRLLDF 584

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  224 bits (570), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 157/544 (28%), Positives = 264/544 (48%), Gaps = 33/544 (6%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           +GK K   LKK ++ RHV M                     AGP  + I Y+IMG  ++ 
Sbjct: 117 EGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYC 176

Query: 110 VMSCLGEMAAYIP--LDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167
           ++   GEMA      + GF +Y +    P LGFAV + Y  ++  + P +L  A++ ++Y
Sbjct: 177 IIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKY 236

Query: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGG 227
           W    KVNP V++ +F  +I+ IN+ G + + E EF+ +  K                GG
Sbjct: 237 WTT--KVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGG 294

Query: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287
             +   +G +YW DPG F+   G  +I     +F   A+  V A FA+ G+E   + A+E
Sbjct: 295 AGNDGYIGGKYWHDPGAFR---GDKAID----RFKGVAATLVTAAFAFGGSEFIALTASE 347

Query: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAI 347
             NPR+ +P A K  LYRI++ +L ++ ++G  V +N   L+            PYV+AI
Sbjct: 348 QSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLM--GSDSSKTKASPYVIAI 405

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
            + G+ V+PH  NA +L  V S  NS  Y  SR L  L+    APK F   +  G P  +
Sbjct: 406 SSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARA 465

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           + +  LF  +A+   SS  E +F++ + ++ +  + +W +I +++I F RA  VQG    
Sbjct: 466 MVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLG 525

Query: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCF 523
            + +++      ++ A G   +V L+  F V L     +  D ++F   Y+ + + I  +
Sbjct: 526 EIGFKSELGVWGSYYAAGMMFLV-LIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFY 584

Query: 524 VCYKIVHK--TKWIKSANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQHGWTWKQ 576
           V Y    K  T +I++ ++DL  ++   D      E+EE K        E+ ++G  WK+
Sbjct: 585 VGYMFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETK--------EKLRNGPLWKR 636

Query: 577 FYDY 580
             ++
Sbjct: 637 ILNF 640

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  223 bits (569), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 158/538 (29%), Positives = 260/538 (48%), Gaps = 34/538 (6%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            LKK ++ RHV M                     +GP  ++I Y+IMG  ++ ++   GE
Sbjct: 108 ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 167

Query: 117 MAA-YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           +A  Y  L G F +Y +   DPA GFAV + Y  ++L + P +L  A++ ++YW    KV
Sbjct: 168 LAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTT--KV 225

Query: 175 NPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR 233
           +P V++ +F  +IL IN++G    + E EF+ +SFK                GG  +   
Sbjct: 226 DPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGY 285

Query: 234 LGFRYWKDPGGFKPYSGAVSIPGGK--GKFVSFASVFVYALFAYLGTELCGIVAAECKNP 291
           +G R W +PG F+         G K   +F    S  V A FA+  +E  G+ A+E  NP
Sbjct: 286 IGTRLWHNPGSFR---------GDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNP 336

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAG 351
           R+ +P A K  LYRI+  YL +V ++G  V Y+   LL            PYV+AI   G
Sbjct: 337 RKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLL--GSSGAATKASPYVLAISLHG 394

Query: 352 IPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALC 411
           + V+PH  NA +L  V S  NS  Y  SR L  L+    AP      +  G P  +  + 
Sbjct: 395 VRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVS 454

Query: 412 TLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSY 471
            L   +A+   S   + +F + + ++ +  L +W SI ++++ F RA RVQG     + +
Sbjct: 455 ALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGF 514

Query: 472 QAPFQPVTAWIALGFCLMVALVK-----NFTVFLGD-TFDYKTFITGYIGIPVYILCFVC 525
           ++    V  + +L  C+M+ L+         V +G+   D + F   Y+ +P++I+ +  
Sbjct: 515 KS---QVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFG 571

Query: 526 YKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           +KI  K  W   I++ ++DL +++   D E  + + E  R K    + G  W++ YD+
Sbjct: 572 FKI-WKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEEYRRK---LRDGPMWRRVYDF 625

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  222 bits (566), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 143/511 (27%), Positives = 248/511 (48%), Gaps = 12/511 (2%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +  + L  RHV +                      GP  +LIA+++    +  +     E
Sbjct: 66  KTHRKLLNRHVQLIAISGVIGTALFVAIGKALYHGGPAFLLIAFALWCIPILCITVSTAE 125

Query: 117 MAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           M +++P+   F   A++ AD +L     + + F   V  P ++ +   ++ YW  R   N
Sbjct: 126 MVSFLPVASPFLRLASKCADESLAVTASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYN 183

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
             + + V + + L I+I  VK++GE EFWL+SFK                GG P H+R G
Sbjct: 184 AAIPLVVQVVLYLFISIATVKYYGEMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDRYG 243

Query: 236 FRYW-KDPGGFKPYSGAVSIPGGK--GKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292
           FRYW ++P  FK Y    +  G    G F  F +  + A F   G E   ++A E K PR
Sbjct: 244 FRYWGEEP--FKKYYPDNNTNGTDSLGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLPR 301

Query: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XXPYVVAIKNAG 351
           + +P+A K   +R+ + +L T   LG+  + NDP L              P+V+A+ N  
Sbjct: 302 KVLPKAFKQVFWRLTIIFLGTCLCLGIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNLR 361

Query: 352 IPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALC 411
           I VLP I NA ++T  FSA N+  Y  SR+LYG+A+D  APKIF + N +GVP  ++ + 
Sbjct: 362 IRVLPDIVNAALITSAFSAGNAYTYCSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGVS 421

Query: 412 TLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSY 471
            L+  ++ + ++S++  + ++ VN+ +   L++++ + + Y+ F RA+  Q      L +
Sbjct: 422 LLWALISLLQLNSNSAIVLNWLVNLITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLPF 481

Query: 472 QAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV-- 529
           ++  QP TA   L     +  ++ +TVF+   ++ + F+  Y+ + + +  ++ YK +  
Sbjct: 482 RSWGQPYTAIFGLVCAFSMIFIQGYTVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIWK 541

Query: 530 -HKTKWIKSANVDLFTYKTAIDLEEEEGKLE 559
             K K+I    VD  T    I+  E +   E
Sbjct: 542 RGKDKFIDPHKVDFITDLKEIEAHELDFAFE 572

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  222 bits (566), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 153/531 (28%), Positives = 246/531 (46%), Gaps = 30/531 (5%)

Query: 54  KGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSC 113
           +  +LK+ + +RH+ M                      GP  + I Y+IMG  ++ ++  
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 114 LGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
            GEMA +Y  L G F +Y +   DPALGF+V + Y  ++L + P +L  A + ++YW   
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTT- 193

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
             VNP V++ +F  + + +N+ G + + E EF+ ++ K                GG  + 
Sbjct: 194 -AVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGND 252

Query: 232 NRLGFRYWKDPG---GFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
             LG +YW DPG   G KP             F    +  V A FA+  TE   + AAE 
Sbjct: 253 GYLGGKYWHDPGALYGTKPIH----------HFKGIIATMVTAAFAFGATEFIALTAAEQ 302

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            NPRR +P A K  +YR+++ +L  + LLG  V YN   L+            PYV+AI 
Sbjct: 303 ANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELM--GSGGSATHASPYVIAIA 360

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
           + G+ V+PH  NA +L  V S  NS  Y  SR L  L+    AP      +  G P  ++
Sbjct: 361 SHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAM 420

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            +  +F  +A++  S   ET+F++ + ++ +  L +WI I +++I F +A  VQG     
Sbjct: 421 LVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGE 480

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFV 524
           L Y++    V ++ A    +   L   F V +     D  D   F   Y+ +P+ I  + 
Sbjct: 481 LGYKSQTGVVGSYYAT-VIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYF 539

Query: 525 CYKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            Y+ V K  W   I    +DL +++   D  E+  K E    +E  +  GW
Sbjct: 540 GYR-VWKRDWKLYIPLEQIDLVSHRKVFD--EDLLKQEDAEYEESIRNSGW 587

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  222 bits (565), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 137/506 (27%), Positives = 242/506 (47%), Gaps = 28/506 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           ++KK +++RH+ M                    +AGP  ++I Y++   +++ ++   GE
Sbjct: 69  KMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGE 128

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           +   Y  + G +T+Y++   DPALGF+V + Y  +++ + P QL  AA+ ++YW      
Sbjct: 129 LGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWT---NA 185

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP +++ VF  VI+ IN+ G K + E EF  +  K                GG  +   +
Sbjct: 186 NPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYI 245

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW  PG F               F     VF YA F+Y G E+  + A+E +NPR++
Sbjct: 246 GAKYWHSPGSFA------------AGFKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKS 293

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           +P A K  +YRI++ Y+ T  ++   V YN   L+            P V+A+ + G+ +
Sbjct: 294 IPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELM-GSSGESASHASPLVIAVASHGVKI 352

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS +Y   R L  L+    APK     +  G P    A+  L 
Sbjct: 353 VPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLV 412

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             +A++  S + E +F++ + ++ +  +  W SI ++++ F  A   QG+    + Y++ 
Sbjct: 413 ALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQ 472

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLG-----DTFDYKTFITGYIGIPVYILCFVCYKIV 529
                +W A+   ++V L+  F V +         + +TF   Y+  P+ +  +  YK+ 
Sbjct: 473 TGYWGSWFAIVISVLV-LIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVY 531

Query: 530 HKTKW---IKSANVDLFTYKTAIDLE 552
           HK  W   I ++ VDL +++   D E
Sbjct: 532 HK-DWRLCIPASEVDLSSHRNISDEE 556

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  221 bits (564), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 144/518 (27%), Positives = 254/518 (49%), Gaps = 11/518 (2%)

Query: 48  GYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVV 107
           G+ GK+     K  L+ RHV +                    + G +++L+ +++    +
Sbjct: 45  GFAGKYHSTYRK--LENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPI 102

Query: 108 FTVMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQ 166
             +     EM  Y+PL+  F   A+R  + +L    G+ + F   V  P ++ A   ++ 
Sbjct: 103 LCITVSTAEMVCYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIH 162

Query: 167 YWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
           YW  R   +  + + V + + L I++  V+++GE EFWL+SFK                G
Sbjct: 163 YW--RDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVG 220

Query: 227 GGPSHNRLGFRYWKDPGGFKPYSGAVS-IPGGKGKFVSFASVFVYALFAYLGTELCGIVA 285
           G P  +R GFRY  +   FK YS  +  I    G F  F +  + A F   G +   ++A
Sbjct: 221 GNPKRDRYGFRYIGE-APFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIA 279

Query: 286 AECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYV 344
            E K PR+ +P A K    R+ V +L     +G+  + NDP L              PYV
Sbjct: 280 GETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYV 339

Query: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404
           +A+ + GI +LP I NA ++T  FSA N+  Y  SRSLYGLA+D  AP IF + N +GVP
Sbjct: 340 IAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVP 399

Query: 405 YNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGI 464
             ++++  ++  L+ + ++S++  + ++ +++ +   L+++  + + Y+ F RA+  Q  
Sbjct: 400 IYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQD 459

Query: 465 DKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFV 524
           +   LS+++ +QP TA++ L   L++ +V+ +TVF    ++ K F+  Y+ + + I  ++
Sbjct: 460 NLPELSFKSWWQPYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAIYL 519

Query: 525 CYKIV---HKTKWIKSANVDLFTYKTAIDLEEEEGKLE 559
            Y+ +    K   I    VDL T    I+L E     E
Sbjct: 520 GYRYIWRRGKDAVIPPTEVDLTTGLLEIELHERHHGFE 557

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  222 bits (565), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 137/508 (26%), Positives = 243/508 (47%), Gaps = 10/508 (1%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           ++ L+ RHV +                    + GP ++L+A+++    +  +     EM 
Sbjct: 85  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 144

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            + P+   F   AT+  D +L     + + F   V  P ++ +   ++ YW  R   + G
Sbjct: 145 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 202

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + V + + L I+I  VK++GE EFWL+SFK                GG P H+R GFR
Sbjct: 203 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGFR 262

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
            + +    K +     +    G F  F +  + A F   G E   ++A E K PR+ +P+
Sbjct: 263 NYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 322

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           A K    R+   +L +   +G+  + NDP L              PYV+A+ N  I +LP
Sbjct: 323 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 382

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            I N  ++T  FSA N+  Y  SR+ YG+A+D  APKIF + N  GVP  S+A+  ++  
Sbjct: 383 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWAL 442

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           ++ + ++S++  + ++ +N+ +   L++++ + I Y+ F RA+ VQ      L +++  Q
Sbjct: 443 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRSWGQ 502

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIK 536
           P TA I L  C  + L++ +TVF    ++ + F+  Y+ + + I  +V YK + K     
Sbjct: 503 PYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWKR---- 558

Query: 537 SANVDLFTYKTAIDLEEEEGKLEMMRLK 564
               D F     ID  +E  ++E   ++
Sbjct: 559 --GKDHFKNPHEIDFSKELTEIENHEIE 584

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  221 bits (563), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 156/530 (29%), Positives = 248/530 (46%), Gaps = 31/530 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+DL  RH++M                      GP ++ + YSI G VV+  M CLGEM
Sbjct: 68  LKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGEM 127

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           + Y+P+ G F SYA ++   +   A+ + Y F   V   + LTA  LV+ YW  +    P
Sbjct: 128 STYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHHFP 187

Query: 177 GVWIT--VFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
             W    +F   +L +N++ V+ +GE E+WL+  K                G  P H  +
Sbjct: 188 -YWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHKYI 246

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           GF  W    G  P+     + G KG    FAS+FV A FAY GTE   +   E  NP RN
Sbjct: 247 GFHNWNH--GDAPF-----VNGFKG----FASLFVSASFAYGGTESITLTNGEATNPVRN 295

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P+ IK   +RI++FY+ + F + ++V Y+ P L             P+ +  + AG   
Sbjct: 296 TPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGL-----ATKSVMTSPFTIVFQMAGSKG 350

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
                NA ++T V SACN  L+ GSR +Y +++D   PK   KTN +  PY ++A+    
Sbjct: 351 AGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAV 410

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L +      A T++ +  N+  +   ++W+ I IT I F R   +QG   + L ++  
Sbjct: 411 GGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQG-KTHELKFKNW 469

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKW 534
             P   +  + F   V L++ ++ F  D +    F + Y+ + V+  C++ + +  + K+
Sbjct: 470 TYPWGPYFLVVFVSFVILIQGWSAF--DPWSTSNFFSVYLELFVFPACYLIWWLYKRDKF 527

Query: 535 IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW-TWKQFY-DYIF 582
           IK  ++D  T K     +  E    +  LK      GW  W+Q+  DY F
Sbjct: 528 IKYEDMDFVTDKYIPSKKVNELNERLDNLK------GWPKWRQYMSDYFF 571

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  221 bits (564), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 158/533 (29%), Positives = 263/533 (49%), Gaps = 32/533 (6%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           R  KDL  RH+                        GP +++I + I+   +FT+++ LGE
Sbjct: 69  RYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGE 128

Query: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           +++  P+  GF  Y +R+ +P+ GFAV   YL ++ VL P +L AA+L ++YW     +N
Sbjct: 129 LSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW--NSTIN 186

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
              W+ +F  +I   N++ VK FGE EF LS  K                GGGP    +G
Sbjct: 187 SDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIG 246

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW +PG F   + +        +F    SVFV A F+Y GTEL  + AAE  NPR  +
Sbjct: 247 GKYWSNPGAFVGNTSS-------QRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITL 299

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P+A K T + I V Y+  + L+G  V  +DP LL            P V+AI+N GI  L
Sbjct: 300 PKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAAS-PLVIAIENGGIKGL 358

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + NA +L  V S  NS +Y  SR +  +A     PK F+  +  G P  ++    +F 
Sbjct: 359 PSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFG 418

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S+  ET+F++   ++ +  L  W +I +++I F    + +G   + L    PF
Sbjct: 419 LLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDEL----PF 474

Query: 476 QPVTA-WIALGFCLM--VALVKNFTVFLGDTFD----YKTFITGYIGIPVYILCFVCYKI 528
             +T  W +   C++  V LV  F   L  + +     ++F   Y+  P+ ++C++ +K+
Sbjct: 475 VSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKL 534

Query: 529 VHKTKW---IKSANVDLFTYKTAIDLE--EEEGKLEMMRLKEE----RKQHGW 572
             K+ W     +  +D+ + + A+D+E  ++E ++E   ++E+    R  H W
Sbjct: 535 YTKS-WRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRFLHLW 586

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  222 bits (565), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 152/513 (29%), Positives = 254/513 (49%), Gaps = 22/513 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L+  L+ R  +M                      GP  ++I + +   ++++++  LGE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+  GFT+YATR+ D + G+A  + Y  ++LV+ P ++ +A++ + YW    +   
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GVK FGE EF  S  K                GGGP    +G 
Sbjct: 223 G-FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGA 281

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F  +       G   +F    SVFV A F++ G+EL GI AAE  NPR+++P
Sbjct: 282 KYWHDPGAFVGH-------GSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIP 334

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A K  ++RIV+FY+ T+ ++GL V YND  L+            P+V+AI   GI  LP
Sbjct: 335 GAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLI--GASSVDAAASPFVIAIVTHGIKGLP 392

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS ++  SR++  L+     PK+F   +  G P   +A+ + F  
Sbjct: 393 SVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGL 452

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           LA++  S     +F++ + ++ +  L +W  I + +I F  A + QG D N L++ +P  
Sbjct: 453 LAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAG 512

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++  L F +++  +  F V L   G   D + F   Y+  P+ +  +  +KI +K  
Sbjct: 513 VAGSYWGL-FMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKI-YKRN 570

Query: 534 WIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE 566
           W       LF     +D++    + +M  LK+E
Sbjct: 571 W------KLFIPLEDMDIDTGRRETDMELLKQE 597

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  221 bits (563), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 153/538 (28%), Positives = 252/538 (46%), Gaps = 50/538 (9%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           +K L  RH+SM                     +GP A+LI Y ++G  +F V+    E+A
Sbjct: 71  QKVLHQRHLSMIAIGGTLGTGLFIGLGAALT-SGPAALLIGYLLVGTSMFCVIQSAAELA 129

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
              P+ G + S+ +R+ D +LGF V   Y   +LVL P++L   +L + YW     +NP 
Sbjct: 130 CQFPVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYW--NSSINPA 187

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR-LGF 236
           VW+++FL  +L IN+ GV+ F E EF LS  K                GGGP     +G 
Sbjct: 188 VWVSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGGYIGT 247

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG           P  K  F +    FV A F++ GTE+  +   E KN   ++ 
Sbjct: 248 KYWHDPG-----------PFAKPVFKNLCQTFVAAAFSFGGTEMVLLTGTESKNVS-SIA 295

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI--PV 354
           RA K T YRI +FY+ TV ++G  V YNDP LL            P+V+A+ N G     
Sbjct: 296 RAAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSSEDISAS-PFVIALSNTGSMGAK 354

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           + H  NA +L  V S CNS +Y  SR +  L    + PKIF   +  G P   +A+   F
Sbjct: 355 VSHFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATF 414

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L ++  +     +F++   + S+   ++W SI +  + +  A R +    ++++Y++ 
Sbjct: 415 GLLGFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKS- 473

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDTF------DYKTFITGY----IGIPVYILCFV 524
              +  W  +  C++     NF +  G+ +      + K+   G+    + IP+ I+ F+
Sbjct: 474 --ILGIWGGVVGCIV-----NFLLVAGEVYVSAFPANAKSSAEGFFKYTLSIPIMIVVFL 526

Query: 525 CYKIVHKTKW----IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFY 578
            +KI H+  W    +K  ++DL    T   +E+     E+ + ++E ++     +  Y
Sbjct: 527 GHKI-HRNDWGNWYVKRKDMDL---DTGCSIED----FELFQAQKEAEKRALASRPLY 576

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  221 bits (562), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 159/548 (29%), Positives = 264/548 (48%), Gaps = 44/548 (8%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG      LK+ L++RH+ M                      GP+A+LI +++ G  +  
Sbjct: 60  DGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVG 119

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
            +  LGE+    P+ G F +Y+TR+ DP++ F V   Y+ ++  + P ++ A+A+ M++W
Sbjct: 120 TIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFW 179

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                V+P VW+ VF  +I++IN+ GV++FG+ +F  S  K                GGG
Sbjct: 180 TT--SVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGG 237

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P+H  +G RYW DPG                 F   A+V V A ++  G+E+  + + E 
Sbjct: 238 PTHEFIGARYWHDPGALA------------NGFKGVAAVMVTASYSLGGSEMTCLASGET 285

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAY-NDPLLLQXXXXXXXXXXXPYVVAI 347
            +P+  +P AIK   +RI+ F+L ++ L+G  V Y ND LL             P+V+AI
Sbjct: 286 -DPK-EIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLL-----GGSNVNNSPFVIAI 338

Query: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407
           K   I VLPHI N  +L  + S  NS ++  SR+L  +A     P+IF   +  G P   
Sbjct: 339 KMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTG 398

Query: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467
           +   +LF  LA++  SSS  T+F++ + V  +   + W+SI +++I F  A + QG   +
Sbjct: 399 ILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLD 458

Query: 468 TLSYQAPFQPVTAWIAL--GFCLMVALVKNFTVFLGDTFDYK-------TFITGYIGIPV 518
            L +      V  W ++  G   +V LV  F V L     +K        F   Y+   +
Sbjct: 459 ELEF---VSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALI 515

Query: 519 YILCFVCYKIVHKT------KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            +  FV +KI +++      K +  A +DL + +  ID+E    K E+   K+   +  W
Sbjct: 516 LLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVV--KHEVAARKKYISEQRW 573

Query: 573 TWKQFYDY 580
            + ++Y Y
Sbjct: 574 -YIRYYHY 580

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  220 bits (561), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 136/506 (26%), Positives = 240/506 (47%), Gaps = 7/506 (1%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           ++ L+ RHV +                    + GP ++L+A+++    +  +     EM 
Sbjct: 87  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 146

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            + P+   F   AT+  D +      + + F   V  P ++ +   ++ YW  R   + G
Sbjct: 147 CFFPVSSPFLRLATKCVDDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 204

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + V + + L I+I  VK++GE EFWL+SFK                GG P H+R GFR
Sbjct: 205 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDRYGFR 264

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
            + +    K +     +    G F  F +  + A F   G E   ++A E K PR+ +P+
Sbjct: 265 NYGESPFKKYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 324

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           A K    R+   +L +   +G+  + NDP L              PYV+A+ N  I +LP
Sbjct: 325 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 384

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            I N  ++T  FSA N+  Y  SR+ YG+A+D  APK+F + N  GVP  S+A+  ++  
Sbjct: 385 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAISLVWAL 444

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           ++ + ++S++  + ++ +N+ +   L++++ + ITY+ F RA+ VQ      L +++  Q
Sbjct: 445 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLPFRSWGQ 504

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV---HKTK 533
           P TA I L  C  + L++ +TVF    +  + F+  Y+ + + I  +V YK +    K K
Sbjct: 505 PYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDK 564

Query: 534 WIKSANVDLFTYKTAIDLEEEEGKLE 559
           +     +D       I+  E E   E
Sbjct: 565 FKNPHEIDFSKELVEIENHEIESSFE 590

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  219 bits (558), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/479 (30%), Positives = 244/479 (50%), Gaps = 15/479 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK  L+ RH+ M                      GP ++LI +   G +++ ++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + G+A  + Y+ ++LV+ P ++ +A++ + +W    K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GVK +GE EF  S  K                GGGP    +G 
Sbjct: 206 G-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F     A   PG K  F    SVFV + F++ G+EL G+ A+E   PR++VP
Sbjct: 265 KYWHDPGAF-----AGDTPGAK--FKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVP 317

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           +A K   +RI +FY+ ++ ++GL V YND  L+            P+V+AIK  GI  LP
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAAS--PFVIAIKTHGIKGLP 375

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y  SR++  LA  +  P+IFA  +  G P   + + + F  
Sbjct: 376 SVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGL 435

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  S     +F++ + ++ +  L +W  I I +I F +A   QG D + LS+++P  
Sbjct: 436 IAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTG 495

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKT 532
              ++  L F +++  +  F V L   G +   + F   Y+  P+ +  ++ +KI  + 
Sbjct: 496 VWGSYWGL-FMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  219 bits (559), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 159/531 (29%), Positives = 265/531 (49%), Gaps = 31/531 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L++ L+ RH+ M                      GP A+LI + ++G ++++V+  +GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+  GFT+Y  R+ D + GFA+ Y Y+ ++LV+ P ++ AA++ + YW    K   
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN+ GVK +GE EF  S  K                GGGP    +G 
Sbjct: 200 G-FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGG 258

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW +PG F   +          +F +  SVFV A F++ GTEL G+ AAE +NPR+ +P
Sbjct: 259 KYWHNPGAFNGDNAG-------QRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           RA K   +RI +FY+ ++ L+GL V Y    L+            P+V+AIK  GI  LP
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIG--SSSVDAAASPFVLAIKTHGISGLP 369

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY-NSLALCTLFC 415
            + N  +L  V S  NS +Y  SR+L  LA     P+IF+  +  G P    LA CT F 
Sbjct: 370 SVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCT-FG 428

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L ++  S     +F++ + ++ +  L +W  I I ++ F RA   QG   + L++ +  
Sbjct: 429 LLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTS-- 486

Query: 476 QPVTAWIALGFCLMVALV--KNFTVF---LGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
             V  W +    +++ LV    F +    +G T +   F   Y+ + V +  ++ +K+ +
Sbjct: 487 -YVGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKL-Y 544

Query: 531 KTKWI---KSANVDLFTYKTAIDLE--EEEGKLEMMRLKEE----RKQHGW 572
              W    ++ ++D+ T +  +DL+  ++E   E +RL  +    R  H W
Sbjct: 545 TRNWTFAKRAKDIDIDTGRRELDLDALKQEIAEEKLRLSTKPWWYRVYHLW 595

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  218 bits (556), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 145/513 (28%), Positives = 244/513 (47%), Gaps = 29/513 (5%)

Query: 52  KHKGIR--LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
            H  IR  L + L  RH++M                      GP ++ I Y+IMG VV+ 
Sbjct: 49  DHDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYL 108

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
            M CLGEM+ ++P+ G F SYA ++   +  FA+   Y F   V   + LTA  LV+ YW
Sbjct: 109 TMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYW 168

Query: 169 VGRGKVNPGVWIT--VFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
               + N   W    +F   +L +N++ V+ +GE E+WL+  K                G
Sbjct: 169 -KSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVG 227

Query: 227 GGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286
             P H  +GF+YW        Y  A  + G KG    F ++FV + F+Y GTE   + A 
Sbjct: 228 HNPDHEYIGFKYWS-------YKEAPFVNGFKG----FVTIFVSSAFSYGGTESITLTAG 276

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVA 346
           E +NP RN PR +K   +RI++FY+ T+F + +++ Y+ P L             P+ + 
Sbjct: 277 EARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNL-----STKSVMTSPFTII 331

Query: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKA-PKIFAKTNSWGVPY 405
            + AG        NA +LT + SA N  L+ GSR LY + ++    PK+  KTN +  PY
Sbjct: 332 FQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPY 391

Query: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465
            ++ L      L +      A T++++  N+  +   ++W+SI +T I F +    QG  
Sbjct: 392 VAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQG-K 450

Query: 466 KNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVC 525
              L ++    P   +  + F  ++ LV+ ++ F  D +    F + Y+ + V+  C++ 
Sbjct: 451 TQELQFKNWTYPYGPYFLVIFVTLIILVQGWSAF--DPWSTSDFFSYYLELFVFPTCWLI 508

Query: 526 YKIVHKTKWIKSANVDLFT---YKTAIDLEEEE 555
           + I  + +++K  ++D  T    ++  ++EE E
Sbjct: 509 WWIFKRDRFVKPEDMDFITDRYIQSPQEIEENE 541

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  219 bits (557), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 155/504 (30%), Positives = 250/504 (49%), Gaps = 28/504 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+ L++RH+ M                     AGP  ILI +++ G +++ ++  +GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+  GFT+YA+R+ D + GFA    Y+ ++LV+ P ++ AA++ + YW    K   
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F  VI+ IN  GVK +GE EF  S  K                GGGP    +G 
Sbjct: 196 G-FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGG 254

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           R W +PG F               F    SVFV A F++ G+EL G+ AAE  NPR+++P
Sbjct: 255 RLWHNPGAFA------------NGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLP 302

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAY-NDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
            A K   +RI +FY+  + ++GL V Y +D L+ Q           P+V++I+NAGI  L
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS---PFVISIQNAGIKGL 359

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P + N  +L  V S  NS ++  SRS+  LA     PKIF   +  G P   + +  +F 
Sbjct: 360 PSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFG 419

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            L+++  S     +F + + ++ +  L +W  I++ +I   RA   Q      LS+ A  
Sbjct: 420 LLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTA-- 477

Query: 476 QPVTAWIAL-GFCLMV-ALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
            P   W ++ GF L++  L+  F + L   GD      F   Y+  P+ I  ++ +KI  
Sbjct: 478 -PTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWK 536

Query: 531 KT--KWIKSANVDLFTYKTAIDLE 552
           K    +I++ N+D+ T +   D+E
Sbjct: 537 KNWKLFIRAKNIDIDTGRRETDIE 560

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  218 bits (555), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 156/522 (29%), Positives = 241/522 (46%), Gaps = 34/522 (6%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K+ L+ RH+S+                    + GP+A+L+ +SI+G + F+VM  +GEM
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEM 108

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
               P  G FT+ A R+   AL    GY Y+  +  +  N+    + ++Q+W       P
Sbjct: 109 ITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFW------GP 162

Query: 177 GV----WITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN 232
            V    +I +F        +VGV  FGE E+WL+  K                G   +  
Sbjct: 163 QVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRP 222

Query: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292
             GF YW  PG                 F   A VFV+    Y GTE   + A E KNP 
Sbjct: 223 AFGFHYWNSPGALSH------------GFKGIAIVFVFCSTFYSGTESVALAATESKNPG 270

Query: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI 352
           + VP A++ TL+RI+V Y+      G +V ++DP L             P  +AI  AG 
Sbjct: 271 KAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL----SASTKVLKSPIAIAISRAGW 326

Query: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412
               H+ NA +L    SA N  LY+GSR+L  LA +  APKI A T+  GVP  ++ +  
Sbjct: 327 AGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFN 386

Query: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472
               ++ MNVS  A   +SY VN++ +   + W  I  T++   +A+  QG     L Y+
Sbjct: 387 ALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYE 446

Query: 473 APFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFV---CYKIV 529
           A F P T  ++L   + +AL++ ++ F+   FD   F+  YI +PV IL ++    +K  
Sbjct: 447 ALFYPWTPVLSLAANIFLALIQGWSYFV--PFDAGNFVDAYILLPVGILLYIGICVFKSN 504

Query: 530 H-KTKWIKSANVDLFTYKT-AIDLEEEEGKLEMMRLKEERKQ 569
           H +T  ++S N+D    K    DL ++E  L      ++ K 
Sbjct: 505 HFRTVDLRSINLDEGRRKDMEADLSDQESSLASSETMKDYKS 546

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  218 bits (556), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 135/522 (25%), Positives = 250/522 (47%), Gaps = 15/522 (2%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           ++ L+ RHV +                    + GP ++L+A+++    +  +     EM 
Sbjct: 79  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 138

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            + P+   F   AT+  D +L     + + F   V  P ++ +   ++ YW  R   + G
Sbjct: 139 CFFPVSSPFLRLATKCVDESLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 196

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + V + + L I+I  VK++GE EFWL+SFK                GG P H+R GFR
Sbjct: 197 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDRYGFR 256

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
           Y+ +    + +     +    G F  F +  + A F   G E   ++A E K PR+ +P+
Sbjct: 257 YYGESPFKQYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 316

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           A K    R+   +L +   +G+  + NDP L              PYV+A+ N  I +LP
Sbjct: 317 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMKIRILP 376

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  ++T  FSA N+  Y  SR+ YG+A+D  APKIF K N  GVP  ++ +  ++  
Sbjct: 377 DVVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGISLIWAL 436

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           ++ + ++S++  + ++ +N+ +   L++++ + I Y+ F R + +Q      L +++  Q
Sbjct: 437 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRSWGQ 496

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIK 536
           P TA I L  CL + +++ +TVF    ++ + F+  Y+ + + I  +V YK +    W +
Sbjct: 497 PYTAIIGLVSCLAMIMIQGYTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFI----WKR 552

Query: 537 SANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFY 578
             +     YK  ID  +     E++ ++    Q+ +   Q+Y
Sbjct: 553 GKDKVKDPYK--IDFSK-----ELIEIENHEIQYSFEKFQYY 587

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  217 bits (553), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 154/522 (29%), Positives = 240/522 (45%), Gaps = 34/522 (6%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K+ L+ RH+S+                    + GP+A+L+ +SI+G + F VM  +GE+
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEI 108

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
               P  G FT+ A R+   AL    GY Y+  +  +  N+    + ++Q+W       P
Sbjct: 109 ITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFW------GP 162

Query: 177 GV----WITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN 232
            V    +I +F        ++GV  FGE E+WLS FK                GG     
Sbjct: 163 QVPLYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRP 222

Query: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292
             GF YW  PG         S+  G   F   A VFV+    Y GTE   + A E KNP 
Sbjct: 223 AFGFHYWNSPG---------SLSHG---FKGIAVVFVFCSTFYSGTECVALAATESKNPG 270

Query: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI 352
           + VP A++ TL+R+++ Y+      G +V ++DP L             P  +AI  AG 
Sbjct: 271 KAVPLAVRQTLWRVLIVYIGIAVFYGATVPFDDPNL----SATTKVLKSPISIAISRAGW 326

Query: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412
               H+ NA +L    SA N  LY+GSR+L  LA +  APKI A T+  GVP  ++ +  
Sbjct: 327 AGGAHLVNAFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFN 386

Query: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472
               ++ MNVS  A   +SY VN++ +   + W  I  T++   +A+  QG     L Y+
Sbjct: 387 ALGLISLMNVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYK 446

Query: 473 APFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFV--CYKIVH 530
           A   P T   +L   + +AL++ +T F+   FD   F+  YI +PV I+ +V  C    H
Sbjct: 447 ALLYPWTPIFSLIANVFLALIQGWTSFV--PFDAGNFVDAYILLPVAIVLYVAICVFKNH 504

Query: 531 KTKWIKSANVDLFTYKTA---IDLEEEEGKLEMMRLKEERKQ 569
             + +   +VDL   +      D  ++E  L    + +++K 
Sbjct: 505 HFRIVDLKSVDLDEGRRKDIDADFSDQESSLASSEITKDKKS 546

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  218 bits (555), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/508 (26%), Positives = 241/508 (47%), Gaps = 10/508 (1%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           ++ L+ RHV +                    + GP ++L+A+++    +  +     EM 
Sbjct: 86  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 145

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            + P+   F   AT+  D +L     + + F   V  P ++ +   ++ YW  R   + G
Sbjct: 146 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 203

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + V + + L I+I  VK++GE EFWL+SFK                GG P H+R GFR
Sbjct: 204 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPRHDRYGFR 263

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
            + +    K +     +    G F  F +  + A F   G E   ++A E K PR+ +P+
Sbjct: 264 NYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 323

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
           A K    R+   +L +   +G+  + NDP L              PYV+A+ N  I +LP
Sbjct: 324 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 383

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            I N  ++T  FSA N+  Y  SR+ YG+A+D  APK+F + N  GVP  S+ +  ++  
Sbjct: 384 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVGISLIWAL 443

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           ++ + ++S++  + ++ +N+ +   L++++ + I Y+ F RA+RVQ      L +++  Q
Sbjct: 444 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLPFRSWGQ 503

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIK 536
           P TA I L  C  + L++ +TVF    +  + F+  Y+ + + I  +V YK + K     
Sbjct: 504 PYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKR---- 559

Query: 537 SANVDLFTYKTAIDLEEEEGKLEMMRLK 564
               D       ID  +E  ++E   ++
Sbjct: 560 --GKDSLKNPHDIDFSKELTEIENHEIE 585

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  218 bits (554), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 159/533 (29%), Positives = 257/533 (48%), Gaps = 26/533 (4%)

Query: 52  KHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVM 111
           KHK   LK++++ RHV M                      GP +++I Y+I+  +++ V+
Sbjct: 77  KHK--TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134

Query: 112 SCLGEMAA-YIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
               E+A  Y  L  GF +Y +   D A GF+V + Y  ++L + P +L  A++ ++YW 
Sbjct: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW- 193

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP 229
               +NP  ++T+F  V++ IN VG   + E EF+ +  K                GG  
Sbjct: 194 -NQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAG 252

Query: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289
           +   LG RYW DPG F+   G+ SI     +F    +V V A FAY G E   + AAE +
Sbjct: 253 NDGYLGARYWHDPGAFR---GSDSI----NRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305

Query: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKN 349
           NP++++  A K  +YRI+  Y+ T  LLG  V +N   LL            P+V+A+ +
Sbjct: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL--GSGGSATHASPFVIAVAS 363

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
            G+ V+PH  NA +L  V S  NS LY  SR L  L+    AP+     +  G P   L 
Sbjct: 364 HGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLL 423

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           +  +F  L+++  S   ET+F++ + ++ +  L +W SI ++++   RA  VQG   + L
Sbjct: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVYILCFVC 525
            Y A      A+ A+   + + LV  F V +     +  D   F   Y+ +P+ I  ++ 
Sbjct: 484 GYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542

Query: 526 YKIVHKTKW---IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWK 575
           YKI  +  W   I S+ VDL  ++   D E    + E +  KE+ +   WT +
Sbjct: 543 YKIWTR-DWRLLIPSSEVDLVAHRKIFDAEVL--RHEQLEEKEQLRHAPWTTR 592

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  216 bits (551), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 147/521 (28%), Positives = 248/521 (47%), Gaps = 32/521 (6%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L + L+ RH++M                    + GP ++ I YS++G +V+  + CL EM
Sbjct: 50  LTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEM 109

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           + Y+P+ G F +YA ++   +   A+ + Y F   V   + LTA  LVM YW       P
Sbjct: 110 STYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFP 169

Query: 177 GVWIT--VFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
             W    +F   +L++N++ V+F+GE E+WL+  K                G  P H  +
Sbjct: 170 -YWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYI 228

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           GF+ W    G  P+     + G KG    FAS+FV A FAY GTE   + + E  NP RN
Sbjct: 229 GFKNWTV--GEAPF-----VDGFKG----FASLFVSASFAYGGTESITLTSGESDNPLRN 277

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P+ +K   +RI+ FY+ T F + ++V YN P L             P+ +  K AG   
Sbjct: 278 TPKIVKTVFWRILFFYIGTTFFIAMNVPYNYPGL-----SSGSVVTSPFTIVFKMAGTAG 332

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPK-IFAKTNSWGVPYNSLALCTL 413
                NA ++T V SACN  L+ GSR +Y + ++   PK I ++TN + VPY ++ +   
Sbjct: 333 AGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWA 392

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
              L +      A T++++  N+  +   L+W+ I IT I F +    Q    + L ++ 
Sbjct: 393 VGGLCFGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQN-KTHELKFKN 451

Query: 474 ---PFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
              PF P    +A+ F ++V    +F       ++   F + YI + V+  CF+ + +  
Sbjct: 452 WTYPFGPYFLVVAVTFIILVQGWSSFA-----PWNVSNFFSVYIELFVFPFCFIIWWLYK 506

Query: 531 KTKWIKSANVDLFT--YKTAIDLEEEEGKLEMMRLKEERKQ 569
           +  ++K  ++D  T  Y  + ++ E   KL+ ++  +  +Q
Sbjct: 507 RDPFVKCKDMDFVTDKYVPSQEIIELNEKLDNLKGWKRVRQ 547

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  218 bits (556), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 155/536 (28%), Positives = 261/536 (48%), Gaps = 33/536 (6%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L+K ++ RHV M                     AGP  ++I YSIMG  ++ ++   GEM
Sbjct: 122 LQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEM 181

Query: 118 AA-YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           A  Y  L+G F +Y +   DPALGF+V + Y  ++L + P +L  A+L ++YW    KV+
Sbjct: 182 AVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTT--KVD 239

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
           P V++ +F  +I++IN+ G + + E EF+ +  K                GG  +   LG
Sbjct: 240 PDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLG 299

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW +PG F+   G  ++     +F      FV A FA+  TE   + AAE  NPR+ +
Sbjct: 300 AKYWHEPGAFR---GEHAVD----RFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAI 352

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P A K  LYRIV+ +L ++ +LG  V Y+   LL            PYV+A+   G+ V+
Sbjct: 353 PSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLL--GSSGSGVKASPYVLAVSLHGVRVV 410

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PH  NA +L  V S  NS  Y  SR L  L+    APK F   +  G P  ++ +  LF 
Sbjct: 411 PHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFG 470

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            +A+   S     +F++ + ++ +  L +W +I ++++ F  A +VQG     + + +  
Sbjct: 471 VIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQ- 529

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
             V   +     +++AL+  F V +        D + F   Y+ +P+ I  +  YK+ ++
Sbjct: 530 TGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYR 589

Query: 532 T--KWIKSANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
               +IK+  +DL +++   D      E+EE K        E+ ++G  W++  D+
Sbjct: 590 DWKLYIKADKIDLISHRQIFDENILKQEDEEYK--------EKLRNGPAWRRIADF 637

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  218 bits (554), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 151/519 (29%), Positives = 242/519 (46%), Gaps = 22/519 (4%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           KK +++RHV M                     AGP +++IAY ++ +V + ++   GEMA
Sbjct: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153

Query: 119 AYIP-LDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
              P L G F +Y + +     GFA  + +  ++L + P +L  AA+ ++YW     ++P
Sbjct: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
            V++ +F   ++ I+  GV+ +GE EF  ++ K                GG      +G 
Sbjct: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGG 271

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F   +GA        +F       V A F+Y G EL  +   + KNPR++ P
Sbjct: 272 KYWHDPGAFASSNGA-------SRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTP 324

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A K  +YRIVV YL T+ L+G  V +N   LL            PYV+A    GI V+P
Sbjct: 325 AAAKSNVYRIVVIYLLTMILIGFVVPHNSSELL-GASGGNGLHASPYVLAASIHGIKVVP 383

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
           HI NA +L  + S  NS LY G R L  LA    AP+  +  +  G P  +L L  L   
Sbjct: 384 HIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGV 443

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           + +   S   E +F++   ++ +  L +W SI+ ++I F RA ++Q    +TL Y+A   
Sbjct: 444 IGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTG 503

Query: 477 PVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
              ++  +GF ++V     F V L     G   D  +F   Y+ +P++++ +  Y   +K
Sbjct: 504 LWGSYFGVGFNILV-FAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYK 562

Query: 532 --TKWIKSANVDLFTYKTAIDLE--EEEGKLEMMRLKEE 566
             T       VDL  ++   D E   +E      RL+  
Sbjct: 563 DFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNS 601

>TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.342
           YDR160W
          Length = 840

 Score =  221 bits (564), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 147/591 (24%), Positives = 270/591 (45%), Gaps = 68/591 (11%)

Query: 53  HKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMS 112
           H    +++ L+ RH+ M                     AGP   L+ ++I G VVF  + 
Sbjct: 261 HAKYHVQRKLRVRHIQMIGIGACISVGICLTSGKAFSIAGPFGTLLGFAISGSVVFASLL 320

Query: 113 CLGEMAAYIPLD-GFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW--V 169
              E+A+ IP+  GF+  A+R+ + A GFA+G+TY F  ++  P Q+ A+   + Y+  +
Sbjct: 321 SFTELASLIPVSSGFSGLASRFVEDAFGFALGWTYWFSSMIALPAQVVASTFFLSYYSSM 380

Query: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG-GG 228
            R + +   ++T+FL   + IN++ V+  GE  +     K                G GG
Sbjct: 381 KRSRGSTAGFVTLFLLYPIFINLLDVRIMGEVVYVTGLIKIIISVVVIISMLIFNAGHGG 440

Query: 229 PSHNRLGFRYWKDPGGFKPYS----------------GAVSIPGGKGKFVSFASVFVYAL 272
            SH+++GFRYW     F  ++                    I G  G+F++  SV + + 
Sbjct: 441 ASHDQVGFRYWDSSKSFSQFTFGLFRPTFDLNDAGEGSTHGIEGATGRFLAVISVILIST 500

Query: 273 FAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXX 332
           FAY G E+  + + E  NPR+ +P AIK TL  +++ Y+ ++  +G+++   DP LL   
Sbjct: 501 FAYSGVEMTFVASGEAVNPRKTIPSAIKRTLNIVIIIYMLSLISVGVNIYCGDPRLLSYF 560

Query: 333 XXXXXXX--------------------------------XXPYVVAIKNAGIPVLPHIFN 360
                                                    P+V+A++N G+     + N
Sbjct: 561 SGSAERRFITAMNDDSIRWQVSERCRSGLHYETGYQRNGSSPWVLALQNFGMCTYASVLN 620

Query: 361 ACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCLAYM 420
             ++     A  S L+ GSR+LY +A+ +KAP I  +    GVPY S+   + F  ++Y+
Sbjct: 621 GIMIFITVGAEISSLFSGSRTLYAMAVQRKAPAILQRCTKAGVPYVSVLFTSAFGAISYL 680

Query: 421 NVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQ----GIDKNTLSYQAPFQ 476
            V ++A   F    N++S    + W+ + ++++ F  A +++      D  +  Y++PFQ
Sbjct: 681 AVDTTAIENFGVLSNISSASTSIIWMGLNVSFLRFYYALKLRQDIISRDDRSYPYRSPFQ 740

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIK 536
           P  +   L  C M  +   +T FL   ++ K+F + Y G+ ++  C++ YKI+  +K  +
Sbjct: 741 PYLSMYGLFGCCMFVIFMGYTNFLHKYWNTKSFFSAYGGLMLFSACYLGYKIIGTSKIQR 800

Query: 537 SANVDLFTYKTAIDLEEEEGKLEMMRLK-EERKQHGWTWKQFYDYIFGWIF 586
              +D+ T           G+ EM R+   E +Q+   +++    +F W++
Sbjct: 801 LDQLDMDT-----------GRREMDRIMWNEYRQYSGPYRERAKKLFTWLY 840

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  216 bits (551), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 154/538 (28%), Positives = 252/538 (46%), Gaps = 34/538 (6%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            LKK +++RHV M                     +GP +++I Y ++ +V + ++   GE
Sbjct: 52  HLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGE 111

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA AY  L G F SY + +     GFA  + +  ++L + P +L  A+L ++YW    K+
Sbjct: 112 MAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYW--NDKI 169

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  V+I +F A +L I+  GVK +GE EF  +S K                GG  +   +
Sbjct: 170 NADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYI 229

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW DPG F     A   P  + K V F  + V A F+Y G EL  +   E +NPR++
Sbjct: 230 GAKYWHDPGSF-----ADGPPITRFKGVCF--ILVSAYFSYGGAELFSLSVNEQENPRKS 282

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRI++ YL T+ L+G +V +N   L+            PYV+A     + V
Sbjct: 283 TPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHAS--PYVLAASLHSVKV 340

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PH  NA +L  V S  NS LY   R +  LA    APK     +  G P   L LC LF
Sbjct: 341 VPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALF 400

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             + +++ SS  E +F++   +  +  L +W  I++++I F +A +  G   + + ++A 
Sbjct: 401 GVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAV 460

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
                ++    F ++V  +  F V L     G   D + F   Y+  P++++ +  Y I 
Sbjct: 461 TGIWGSYYGCAFNILV-FIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIY 519

Query: 530 HKTKWIKS--ANVDLFTYKTAID-----LEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
            +   I +    +DL  ++   D      E+EE K        ER ++   W + Y +
Sbjct: 520 KRDFTILNPLEKIDLDFHRRIYDPDFIKQEDEENK--------ERLKNSSIWARIYHW 569

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  217 bits (552), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 144/535 (26%), Positives = 249/535 (46%), Gaps = 31/535 (5%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +KK L+ARHV M                      GP +++I Y I+ ++V+ ++   GEM
Sbjct: 90  MKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEM 149

Query: 118 AAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           A   P     F +Y + +   + GFA  + +  +++ + P +L  ++L +QYW     +N
Sbjct: 150 AVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWT---DLN 206

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
             +++ +F   +L I+ +GVK +GE EF  +  K                GG  +   +G
Sbjct: 207 GDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIG 266

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW  PG F          G   +F     V V   F+Y GTEL  +   E   PR+  
Sbjct: 267 GKYWHTPGSFAE-------GGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKAT 319

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
           P A K ++YRI+V YL T+ L+G +V +N   L+            PYV+A    G+ V+
Sbjct: 320 PAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHAS--PYVLAASIHGVKVV 377

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHI NA +L  V S  NS LY   R L  LA    APK     +  G P  +L LC +F 
Sbjct: 378 PHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFG 437

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
           C+A++  S   E +F++   +  +  + +W  I+ +++ F  A +VQ  D + + Y+A  
Sbjct: 438 CIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATA 497

Query: 476 QPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
               +W    F ++V L+  F V L     G     ++F   Y+ +P+++  ++ Y + +
Sbjct: 498 GIYGSWFGSIFGVLV-LIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYN 556

Query: 531 K--TKWIKSANVDLFTYKTAID---LEEEEGKLEMMRLKEERKQHGWTWKQFYDY 580
           K  T     + +DL  ++   D   + +E+ +       +E+ ++   W + Y++
Sbjct: 557 KEWTILTDLSKIDLDAHRRIYDPDLIRQEDAE------NKEKLKNSPFWVRVYNF 605

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  216 bits (551), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 152/532 (28%), Positives = 252/532 (47%), Gaps = 38/532 (7%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG +    LK+ L++RH+ M                      GP+A++I +SI G  +  
Sbjct: 62  DGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVG 121

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
            +  LGE+    P+ G F +Y+TR  DP++ F V   Y+ ++  + P +L A+A+ +Q+W
Sbjct: 122 TIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFW 181

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
               KV+P VW+ +F  +++++N+ GVK FGE EF  S  K                GGG
Sbjct: 182 TT--KVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGG 239

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P H  +G  YW  PG                 F   ASVFV A ++  G+E+  + +AE 
Sbjct: 240 PDHRFIGTEYWHHPGALA------------NGFKGVASVFVTASYSLGGSEMVCLCSAET 287

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            +P+  +P AIK   +RIV F+L ++ L+G  V Y +  LL            P+V+AIK
Sbjct: 288 -DPKE-LPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS----PFVIAIK 341

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
            +GI VLP I NA +L  + S  NS ++  SR+L  +A     P++F   +  G P   +
Sbjct: 342 LSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGI 401

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
            + +LF  LA++  S+S   +F + + +  +   + W+SI I++I F  A + Q    + 
Sbjct: 402 IVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDE 461

Query: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFL-------GDTFDYKTFITGYIGIPVYIL 521
           L +++    V   I      ++ L+  F + L             ++F   Y+   V + 
Sbjct: 462 LEFKSSVG-VYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVF 520

Query: 522 CFVCYKIVHKT---KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
            FV +KI  K    KW        F     IDLE +   +++  +K+E ++ 
Sbjct: 521 VFVTHKIYFKCSTGKWFD------FKPLAEIDLETDRKNIDIEIVKQEVRER 566

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  217 bits (553), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 153/521 (29%), Positives = 249/521 (47%), Gaps = 25/521 (4%)

Query: 54  KGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSC 113
           K   LK+D+  RH+                       AGP  +LI Y++MG  V+ V+  
Sbjct: 113 KKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQA 172

Query: 114 LGEMAAYIP--LDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGR 171
            GE+       + GF +Y      P+  F+VG+ Y  ++L +TP +L  A+L ++YW   
Sbjct: 173 AGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTT- 231

Query: 172 GKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSH 231
            KV+P V++ +F  +IL IN  G K + E +F+ +  K                GG    
Sbjct: 232 -KVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHD 290

Query: 232 NRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNP 291
             LG +YW +PG F+   G  +I   KG     +SVFV + FA+ G+E   + A+E  NP
Sbjct: 291 GYLGGKYWHNPGAFR---GEKAIDHFKG----VSSVFVTSAFAFGGSEFVALSASEQANP 343

Query: 292 RRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAG 351
           R+++P A KL LYRI+  YL ++ +LG  V ++ P   Q           PYVVAI   G
Sbjct: 344 RKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSP---QLQPSSDGKKTSPYVVAIAMHG 400

Query: 352 IPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALC 411
           + V+PH+ NA +L  V S  NS  +  SR L  L+    APK F   +  G P  ++ + 
Sbjct: 401 VKVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLIS 460

Query: 412 TLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSY 471
            LF  + +   S     +FS+ + ++ +  + ++ SI +++I    A +VQG     L +
Sbjct: 461 ALFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGF 520

Query: 472 QAPFQPVTAWIALGFCLMVALVKNFTVFLG----DTFDYKTFITGYIGIPVYILCFVCYK 527
           ++      ++ A    L+++L+  F V L        D ++F   Y+  P+ I+ +  Y 
Sbjct: 521 RSQVGTYGSFYAC-LLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYM 579

Query: 528 IVHKT--KWIKSANVDLFTYKTAID----LEEEEGKLEMMR 562
           I  K    +I+S ++DL   +   D     +E+E   E MR
Sbjct: 580 IWKKDFRIFIRSKDIDLDFKRQVFDEDLIKQEDEEYAEQMR 620

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  216 bits (551), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 160/540 (29%), Positives = 253/540 (46%), Gaps = 33/540 (6%)

Query: 45  VDWGYDGKHK-GIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIM 103
           +D   DG+ K GI LKK ++ RHV M                     AGP  ++I Y ++
Sbjct: 81  IDGFEDGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMV 140

Query: 104 GWVVFTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAA 161
            +V + ++   GE+A AY  L G F SY         GFA  +    ++L + P +  AA
Sbjct: 141 SFVTYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAA 200

Query: 162 ALVMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXX 221
           +L ++YW  R  ++  V++ +F   +L I+ VGV+ +GE EF  +  K            
Sbjct: 201 SLTIKYWNDR--ISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSI 258

Query: 222 XXXXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELC 281
               GG  +   +G +YW DPG F     A    G + K V +  + V   F+Y GTEL 
Sbjct: 259 VINAGGAGNDGYIGGKYWNDPGAF-----AGETAGSRFKGVCY--ILVTGYFSYGGTELF 311

Query: 282 GIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXX 341
            +   E +NPR++ P+A K ++YRIV+ YL T+ L+G +V YNDP L+            
Sbjct: 312 VLSVNEQENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHAS- 370

Query: 342 PYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSW 401
           PYV+A    G+ ++PH  NA VL  + S  NS LY   R +  LA    APKI A  +  
Sbjct: 371 PYVLAASIHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDRE 430

Query: 402 GVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRV 461
           G P  SL +C LF  + +   SS  E +F++   +  +  L +W +  I++I F  A ++
Sbjct: 431 GRPLVSLGICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKL 490

Query: 462 QGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYK----TFITGYIGIP 517
           QG D   + + A      ++  L F ++V     F V L      K    +F   Y+  P
Sbjct: 491 QGKDIKEVGFLASTGLYGSFYGLFFNILV-FAAQFWVALSPIGSKKVGAESFFESYLAFP 549

Query: 518 VYILCFVCYKIVHKTKWIKS-------ANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
           +++  +  Y +     W K         ++DL  ++   D EE     E+ R ++E  ++
Sbjct: 550 IWLFFYFGYMV-----WAKDFTFLNPLESIDLDFHRRIYDPEE---MAEINRQEKEEYKN 601

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  216 bits (549), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 158/528 (29%), Positives = 247/528 (46%), Gaps = 22/528 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            LKK ++ RHV M                      GP A++I Y ++  V + ++   GE
Sbjct: 90  HLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGE 149

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA AY  L G F +YA+ +     GFA  + +  ++L + P +L  A+L+++YW    KV
Sbjct: 150 MAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTE--KV 207

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  V++ +F   +L I+ +GVK +GE EF  +  K                GG      +
Sbjct: 208 NADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYI 267

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW  PG F   + A        +F     V V   F+Y GTEL  +   E +NPR++
Sbjct: 268 GGKYWHSPGAFAGTNAA-------ERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKS 320

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRI+V YL T+ L+G +V +ND  L+            PYV+A    G+ V
Sbjct: 321 TPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLM--GAGGSATHASPYVLAASIHGVRV 378

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY   R L  LA    APK     +  G P  +L  C +F
Sbjct: 379 VPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVF 438

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             +A+   S   E +F++   +  +  L +W SI+++++ F +A ++QG D N + Y A 
Sbjct: 439 GVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIAN 498

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLG---DTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
                +   + F ++V  +  F V L         ++F   Y+  P++I  +  Y I +K
Sbjct: 499 TGYWGSVYGVVFNILV-FIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNK 557

Query: 532 --TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQF 577
             T       +DL  ++   D   E  K E M  K ER ++G  W + 
Sbjct: 558 DYTFLNPLDKIDLDHHRRIYD--PEVLKQEDMENK-ERVRNGNIWTKL 602

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  215 bits (548), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 149/525 (28%), Positives = 239/525 (45%), Gaps = 23/525 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            +KK +++RHV M                     AGP  +++ Y ++ +V + ++   GE
Sbjct: 77  HMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGE 136

Query: 117 MAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA   P     F +YA+ +     GFA  + +  ++L + P +L  A++ ++YW     +
Sbjct: 137 MAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW--NDTI 194

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP V+I +F   +L I+  GVK +GE EF  +S K                GG      +
Sbjct: 195 NPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYI 254

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW +PG F   S A        +F   A + V   F+Y GTEL  +   E KNPR++
Sbjct: 255 GNKYWINPGAFASESPA-------ARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKS 307

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRI++ YL T+ L+G +V ++   L+            PYV+A    G+ V
Sbjct: 308 TPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHAS--PYVLAASLHGVKV 365

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PH  NA +L  V S  NS LY   R +  LA    APK F   +  G P  +L +C LF
Sbjct: 366 VPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLF 425

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             + ++  S   E  F++   +  +  L +W SI I++I F  A +VQG     L Y+A 
Sbjct: 426 GVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRAT 485

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
              +   +   F  M+  +  F V L        +D + F   Y+  P++++ +  Y I 
Sbjct: 486 -TGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIY 544

Query: 530 HK--TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGW 572
            +  T       +DL  ++   D   E  + E    KE  +  GW
Sbjct: 545 SRDFTFLTPLDKIDLDFHRRIYD--PELLRQEDAETKERLRNSGW 587

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  216 bits (550), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 143/499 (28%), Positives = 235/499 (47%), Gaps = 29/499 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           +L K ++ RH+ M                    ++GP  ++I Y +   +++ V+   GE
Sbjct: 105 QLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGE 164

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           +   Y  L G +T+Y T   DPA+GFAV   Y  ++L + P QL  AA+ ++YW     V
Sbjct: 165 LGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTT--NV 222

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           NP +++   L +++ IN+ G K + E EF+ +  K                GG      +
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW+ PG F               F   A+VF YA F+Y G E+  + A E  NPR+ 
Sbjct: 283 GVKYWQTPGAFA------------NGFKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKA 330

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           +P A +  +YR++  Y+ T  ++   V YN P LL            P+V+A+ + G+ V
Sbjct: 331 IPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQV 390

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY G R L  L+    APK F   +  G P   + +    
Sbjct: 391 VPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAM 450

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQ--GID-KNTLSY 471
             +A++    + E +F++ + V+ +  +  W+SI I+++ F  A R Q  G+  ++ + Y
Sbjct: 451 GLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEY 510

Query: 472 QAPFQPVTAWIALGFCLMVALVKNFTVFLG-----DTFDYKTFITGYIGIPVYILCFVCY 526
            A    V + +AL   + + LV  F V +         D + F   Y+  PV +  ++ Y
Sbjct: 511 TAQTGYVGSLVALAISIFI-LVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAY 569

Query: 527 KIVHKTKW---IKSANVDL 542
           KI H+  W   I +  +DL
Sbjct: 570 KIWHR-DWRLCIPANEIDL 587

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  215 bits (548), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 150/502 (29%), Positives = 257/502 (51%), Gaps = 19/502 (3%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK  L++RH+ M                     AGP  ILI +++ G ++++++  +GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G FT+YATR+ D + GFA+ + Y+ ++L+  P ++ +A++ + YW    K   
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
           G ++ +F    + IN+ GVK +GE EF  +  K                GGGP    +G 
Sbjct: 207 G-FVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGA 265

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW  PG F      V    G+ KF  F +VF+ A F++ G+E+ G+  +E +NPR++VP
Sbjct: 266 KYWHHPGAF------VGDTAGQ-KFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVP 318

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A K   +RI +FY+  + L+G+ V YND  L+            P+V+A+ N GI  LP
Sbjct: 319 GAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAAS--PFVIAVVNQGIRGLP 376

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + N  +L  V S  NS +Y+ SR+L  LA     PKI A  +  G P  ++ + + F  
Sbjct: 377 SVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGL 436

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A++  SS    +F++ + ++ +  L SW +I I +I F RA   QG   + L + +   
Sbjct: 437 IAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVG 496

Query: 477 PVTAWIALGFCLMVALVKNFTVFL---GDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
              ++  +  C+++ L+  F V L   G + + K F   Y+  P+ +L F  +  + K  
Sbjct: 497 IAGSYWGIFICVLM-LIAQFYVGLFPAGASPNAKDFFMAYLSFPI-VLAFYIFHKIWKKN 554

Query: 534 W---IKSANVDLFTYKTAIDLE 552
           W   IK+ ++D+ T +  +D +
Sbjct: 555 WKLYIKAEDMDIDTGRREVDRD 576

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  215 bits (547), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 149/522 (28%), Positives = 251/522 (48%), Gaps = 33/522 (6%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           KK L  RH++M                     +GP ++LI + ++G  +  V+ C  E++
Sbjct: 70  KKVLDQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELS 128

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
              P+ G +  +A+R+ DP++GF++G  YL  +L+  P++L   +L + YW     VNP 
Sbjct: 129 CQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAP--SVNPA 186

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP-SHNRLGF 236
            W+ +   + + +N+ G + F E EF++S FK                GGGP S   +G 
Sbjct: 187 AWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGT 246

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F     AV +      F +  + FV A +++ GTE+  + + E ++   +V 
Sbjct: 247 KYWHDPGSF-----AVPV------FKNLCNTFVSAAYSFSGTEMVVLTSTEARSVS-SVS 294

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI--PV 354
           RA K T +RI++FY+ TV ++G  V YNDP L+            P+V+A+ N G     
Sbjct: 295 RAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITAS-PFVIALSNTGAMGTR 353

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           + H  NA +L  VFS CNS +Y  SR + GLA   + PKI A  +  G P   +A+C  F
Sbjct: 354 VSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAF 413

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L ++ VS +  T+F++   + SI    +W  I    + F  A + QG  K+ + Y++ 
Sbjct: 414 GLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRST 473

Query: 475 FQPVTAWIA--LGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKT 532
                      L   L++  +      +G       F    + IP+ I  ++ ++I ++ 
Sbjct: 474 LGIYGGIFGCILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRI-YRR 532

Query: 533 KW----IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
            W    IK  ++DL +  +  D E    KLE    ++E K++
Sbjct: 533 DWRHWYIKRMDIDLDSGHSLEDFEAT--KLE----RDEDKKY 568

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  213 bits (543), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 152/505 (30%), Positives = 235/505 (46%), Gaps = 24/505 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K+ L+ RH+S+                    + GP+A+L+ + I+G + F VM  +GEM
Sbjct: 32  VKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESIGEM 91

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
               P  G FT+ A R+   AL    GY Y+  +  +  N+    + ++Q+W    +V  
Sbjct: 92  ITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFW--GPQVPL 149

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
             +  +F  V     ++GV  FGE E+WLS  K                GG  +    GF
Sbjct: 150 YAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFGF 209

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
            YWKDPG         S+  G   F   A VFV+    Y GTE   + A E KNP ++VP
Sbjct: 210 HYWKDPG---------SLSHG---FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSVP 257

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A++ TL+RIVV Y+      G +V +NDP L             P  +AI  AG     
Sbjct: 258 YAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL----SVNTKVLKSPIAIAISRAGWAGGS 313

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
           H+ NA +L    SA N  LY+GSR+L  LA +  APK  A T+  GVP  ++ +      
Sbjct: 314 HLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGL 373

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           ++ MN+S  A   +SY VN++ +   + W  I  T++   +A+  QG     L Y+A F 
Sbjct: 374 ISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFY 433

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCF--VCYKIVHKTKW 534
           P T   +L   + +AL++ +T  +   F    F+  YI +P  I+ +  VC    H  + 
Sbjct: 434 PWTPIFSLISNIFLALIQGWTSLV--PFKAPEFVDAYILLPAAIILYVGVCVFKNHNFRI 491

Query: 535 IKSANVDLFTYKTAIDLEEEEGKLE 559
           +   +V+L   +   D+E ++   E
Sbjct: 492 VDLTSVNLDEGRRK-DMENDQSDQE 515

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  219 bits (558), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 147/594 (24%), Positives = 268/594 (45%), Gaps = 70/594 (11%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
           G      +++ L+ RH+ M                     AGP   L+ +S+ G +V   
Sbjct: 255 GTGDSHHIQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLAT 314

Query: 111 MSCLGEMAAYIPLD-GFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169
           +    E++  IPL  GF+  A+R+ + A GFA+G+TY F  ++  P Q+ A    ++Y+ 
Sbjct: 315 LLSFTELSTLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYFD 374

Query: 170 GRGKVNPGV---WITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
               +N G    + T+F+   + +N++ V+  GE  +     K                G
Sbjct: 375 SL-NLNKGAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSG 433

Query: 227 GGPSHNRLGFRYWKDP--------GGFKPY--------SGAVSIPGGKGKFVSFASVFVY 270
            G  ++R+GFR+W           G F+P              I G  G+F++ AS  + 
Sbjct: 434 TGTKYDRVGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLI 493

Query: 271 ALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQ 330
           + FAY G E+  + + E  NPR+ +P A K T   ++V Y+ T+F + +++   DP L  
Sbjct: 494 STFAYTGVEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQP 553

Query: 331 ---------------------------------XXXXXXXXXXXPYVVAIKNAGIPVLPH 357
                                                       P+V+A++N G+     
Sbjct: 554 YFTGSYSARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAA 613

Query: 358 IFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCL 417
           +FN  ++ F   A  S L+  SR+LY +A+ +KAP IF + N  GVPY S+    +F  +
Sbjct: 614 VFNGILIFFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVV 673

Query: 418 AYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQ----GIDKNTLSYQA 473
            Y+ V S A   F+   N++S    + W+ + ++++ F  A + +      D+ +  Y++
Sbjct: 674 GYLAVDSGAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRS 733

Query: 474 PFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
           PFQP  A+  L  C +  +   FT F+   ++ K+F + Y G+ ++++C++ YK++  +K
Sbjct: 734 PFQPYLAFYGLFGCCLFIIFMGFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSK 793

Query: 534 WIKSANVDLFTYKTAIDLEEEEGKLEMMRLK-EERKQHGWTWKQFYDYIFGWIF 586
             +   +D+ T           G+ EM R+   E +Q+   +++   Y+F W+F
Sbjct: 794 IQRLDQLDMDT-----------GRREMDRVIWNEYRQYSGPYRERLKYLFNWLF 836

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  214 bits (546), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 148/519 (28%), Positives = 239/519 (46%), Gaps = 23/519 (4%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           LK+ ++ RHV+M                      GP  ++I Y+ +  V + +M   GEM
Sbjct: 83  LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEM 142

Query: 118 A-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175
           A AY  L G F +Y+++      GFA  + Y  ++L + P +L  A+L ++YW     +N
Sbjct: 143 AVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYW--NDSIN 200

Query: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLG 235
             V+I +F   IL I+  G + +GE EF     K                GG      +G
Sbjct: 201 ADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIG 260

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F   SGA        KF   A V V   F+Y GTEL  +   E  NPRR +
Sbjct: 261 AKYWYDPGAFAVGSGAT-------KFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAI 313

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVL 355
               K  +YRI++ Y+ T+ L+G  V +    L+            PYV+A+   G+ ++
Sbjct: 314 QSITKQCIYRILLIYMLTMILIGFLVPHTSSELM-GSSGKSATHASPYVLAVSLHGVKIV 372

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           PHI NA +L  V S  NS +Y G R L  LA    AP+  A  +  G P  +L  C++F 
Sbjct: 373 PHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFG 432

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            LA++  S   E +F++   +  +  L +W +I+++++ F +A R      + L Y+A  
Sbjct: 433 LLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANT 492

Query: 476 QPVTAWIALGFCLMVALVK---NFTVFLGD-TFDYKTFITGYIGIPVYILCFVCYKIVHK 531
             + + + L F ++V + +   +   F  D   D  +F   Y+  P++++ F  Y IV +
Sbjct: 493 GVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFR 552

Query: 532 TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
                  N ++      IDL+      +  RL +E  +H
Sbjct: 553 -------NWEIIKPLKDIDLDHYRSIYDQDRLYQEDLEH 584

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  213 bits (543), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 141/514 (27%), Positives = 241/514 (46%), Gaps = 10/514 (1%)

Query: 60  KDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMAA 119
           + L+ RHV +                    + GP  +LIA+++    +  +     EM  
Sbjct: 64  RRLKNRHVQLIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTAEMVC 123

Query: 120 YIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPGV 178
           ++P+   F   A R AD +L     + + F   V  P ++ +   ++ YW  R   +  +
Sbjct: 124 FLPVSSPFLRLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYW--RDDYSAAI 181

Query: 179 WITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFRY 238
            + V + +   I+I  VK++GE EFWL+SFK                GG P H+R GFRY
Sbjct: 182 PLVVQIVLYFLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRY 241

Query: 239 WKDPGGFKPY--SGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           + +   FK Y  +G        G F  F +  + A F   G E   ++A E K PR+ +P
Sbjct: 242 YGETP-FKKYYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLP 300

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XXPYVVAIKNAGIPVL 355
           RA K   YR+   +L +   +G+  + NDP L              PYV+A+ N GI VL
Sbjct: 301 RAFKQVFYRLTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVL 360

Query: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415
           P I NA ++T  FSA N+  Y  SR+LYG+A+D  AP+IF + N  GVP  S+ +  L+ 
Sbjct: 361 PDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWG 420

Query: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475
            ++ + ++ ++  + ++ +N+ +   L+++  + I Y+ F RA+ +       L +++  
Sbjct: 421 LISLLQLNDNSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWG 480

Query: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV---HKT 532
           QP TA + L     + L++ +TVF    +  + F+  Y+ + + I  ++ YK +    + 
Sbjct: 481 QPYTAIVGLVSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRD 540

Query: 533 KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE 566
           K+     VD       I+  E +   E  R   E
Sbjct: 541 KFKDPKTVDFSKDLKEIESHEVDHSFEKFRHYHE 574

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  213 bits (543), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 149/521 (28%), Positives = 247/521 (47%), Gaps = 33/521 (6%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           L+K L  RH+ M                     +GP ++LI + I+G ++F V+    E+
Sbjct: 85  LQKTLSQRHL-MMIAIGGTLGTGLFIGIGYSLSSGPGSLLIGFLIVGLMMFCVVQSAAEL 143

Query: 118 AAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
           A   P+ G +  + +R+ +P++GF V   Y   +L+  P++L   A+ +QYW     VNP
Sbjct: 144 ACQYPVSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYW--NKSVNP 201

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP-SHNRLG 235
            VW+ +F   I+++N+ GV+ +GE EFW+S FK                GGGP S   +G
Sbjct: 202 AVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTGYIG 261

Query: 236 FRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +YW DPG F            K  F    + FV A F++ G EL  + A+E +    +V
Sbjct: 262 TKYWHDPGSF-----------AKPVFKGLCNTFVSAAFSFGGAELVVLTASESRKVE-SV 309

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI--P 353
            RA K T +RI +FY+ TV ++G  V Y +  LL            P+V+A+   G    
Sbjct: 310 SRAAKGTFWRIAIFYITTVIVIGCLVPYTNEQLL-GGDNDEDITASPFVIALSGQGSMGT 368

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
              H  N  +L  V S CNS +Y  SR +  L +  + PKI    +  G P   +A+C +
Sbjct: 369 KASHFMNTVILIAVLSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGV 428

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
           F  L ++  S +   +F++   + SI    +W  I  + + F  A R QG   + +++++
Sbjct: 429 FGLLGFLVASDNEGDVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKS 488

Query: 474 PFQPVTAWIALGFCLMVALVKNFTVF-----LGDTFDYKTFITGYIGIPVYILCFVCYKI 528
                  ++    CL+ AL+    ++     LG     K F    + IP+ I  ++ +K+
Sbjct: 489 MLGIYGGFLG---CLLNALLIAGEIYVSIFPLGGDPSAKQFFQYCLSIPIMIAVYIGHKL 545

Query: 529 -VHKTK--WIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE 566
             +K+K   I +  +DL T +   DLE+   K E++  KE+
Sbjct: 546 FANKSKRVLIPAQEIDLETGRKIKDLEQF--KHEVLEDKEK 584

>KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 568

 Score =  213 bits (541), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 140/514 (27%), Positives = 244/514 (47%), Gaps = 12/514 (2%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
            + LQ RHV +                    + GP+++++ +S+    +  +     EM 
Sbjct: 54  SRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCIPILCITVSTAEMV 113

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            Y+P+   F   A R  + +L    G+ + F   V  P ++ A   ++ YW  R   +P 
Sbjct: 114 CYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVNTILHYW--RDDFSPA 171

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + V + + + I++  V+ +GE E +L+SFK                GG P H+R GFR
Sbjct: 172 IPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITMLGGNPKHDRYGFR 231

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
           Y  D   FK Y          G F  F +  + A F   G +   ++A ECK PR+ +P 
Sbjct: 232 YITDTK-FKQYFPNNEGSSSMGYFQGFLACVIQASFTIAGPDYVAMIAGECKLPRKVLPV 290

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XXPYVVAIKNAGIPVLP 356
           A K    R+ V +L     +G+  + NDP L              PYV+A+ N GI VLP
Sbjct: 291 AFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYVIAMNNLGIKVLP 350

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            + NA ++T  FSA N+  Y  SR+LYGL++D  APK+F      GVP N++ +   +  
Sbjct: 351 DVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVPINAVLVSLAWAF 410

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN--TLSYQAP 474
           ++ + + S++  + ++ +N+ +   L+++  + + Y+SF RA+  Q        L +++ 
Sbjct: 411 ISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHPSGELPELPFKSW 470

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGY----IGIPVYILCFVCYKIVH 530
            QP TA+  L    ++  V+ +TVFL  +++ ++F+  Y    I + +++LCF  YK   
Sbjct: 471 GQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFCYLMVFIDLGIFLLCFFVYKRT- 529

Query: 531 KTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLK 564
           +  W+K  + DL T    ++  E     E   L+
Sbjct: 530 RDPWVKPEDADLLTGMDEVEEHELSLGFEKYALR 563

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  212 bits (540), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 151/524 (28%), Positives = 236/524 (45%), Gaps = 38/524 (7%)

Query: 58  LKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEM 117
           +K+ L+ RH+S+                    + GP+++L+ + I+G V F VM  +GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
               P   GF++ + R+   AL    GY Y+  +  +  N+    + ++Q+W       P
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW------GP 157

Query: 177 GV----WITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN 232
            V    +I +F        ++GV  FGEFE+WL+ FK                GG  +  
Sbjct: 158 QVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRP 217

Query: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292
             GF YW +PG                 F   A VFV+    Y GTE   + A E +NP 
Sbjct: 218 AFGFHYWNNPGALAD------------GFKGIAVVFVFCSSFYSGTESVALAATESRNPG 265

Query: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI 352
           + VP AIK T +RI++ YL      G +V YND  L             P  +AI  AG 
Sbjct: 266 KAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSL----GAHTKALKSPIAIAITRAGW 321

Query: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412
               H+ NA +L    SA N  LY+GSR+L  LA +  APK    T+  GVP  ++ L  
Sbjct: 322 EGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFN 381

Query: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472
               ++ MNVS  A   +SY VN++ +   + W  I +T++ F +A+ +QG   + L Y+
Sbjct: 382 ALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYK 441

Query: 473 APFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVH-- 530
           +   P     +L   + + L++ +T F+   F  K F+  YI +P  ++ ++   +V   
Sbjct: 442 SLLFPWGPIFSLAANIFLGLIQGWTTFV--PFSAKDFVDAYILLPAAVILYIVISLVKIG 499

Query: 531 KTKWIKSANVDLFTYKTAIDL------EEEEGKLEMMRLKEERK 568
             K +    VDL   +   DL      E+ EGK   +R  +  K
Sbjct: 500 GFKLVDLRTVDLEEGRRE-DLDSDGTDEDSEGKDRSVRSAKRNK 542

>KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {ON}
           Anc_3.397 YBR132C
          Length = 582

 Score =  213 bits (542), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 143/517 (27%), Positives = 247/517 (47%), Gaps = 13/517 (2%)

Query: 54  KGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSC 113
           +     + L  RHV                      + GP  +LIA+++    +  +   
Sbjct: 61  RSTSTHRKLLNRHVQFIAISGVIGTALFVAIGKPLYRGGPAFLLIAFALWCIPILCITVS 120

Query: 114 LGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRG 172
             EM ++ P+D  F   + +  D +L     + + F   V  P ++ +   V+ YW  R 
Sbjct: 121 TAEMVSFFPVDSPFLRLSKKCCDESLAVMASWNFWFLECVQIPFEIVSVNTVINYW--RD 178

Query: 173 KVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHN 232
             +P + + + +A+   I++  VK++GE EFW+SSFK                GG P H 
Sbjct: 179 DYSPAIPLVIQVALYALISVCAVKYYGEMEFWMSSFKILLALGLFCFTFITMVGGNPKHK 238

Query: 233 RLGFRYWKDPGGFKPY--SGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKN 290
             GF+ ++    FK Y   G  +I    G F  F +  + A F   G E   ++A E K 
Sbjct: 239 AYGFQNYRK-NTFKKYFPDGNENIGSAAGYFQGFLACLIQASFTIAGGEYISMLAGEVKL 297

Query: 291 PRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYVVAIKN 349
           PR+ +PRA K   +R+ V +L +   +G+  + NDP L              PYV+A+ N
Sbjct: 298 PRKVMPRAFKQVFWRLTVLFLGSCLCVGIVCSANDPNLTAAISESRPGAGSSPYVIAMNN 357

Query: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409
            GI +LP + NA ++T  FSA N+  Y  SR+L+G+A+D  APK  A  N  GVP  S+A
Sbjct: 358 LGIKILPDVVNAALITAAFSAGNAYTYCSSRTLHGMALDGYAPKFLAVCNKQGVPIYSVA 417

Query: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469
           +  ++  L+ + ++S++  + ++ +N+ +   L+++  I ITY+ F RA+ +Q      L
Sbjct: 418 ISLIWALLSLLQLNSNSAVVLNWLINIITASQLINFACICITYLFFRRAYLLQRDTLPDL 477

Query: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529
            +++  QP TA   L   LM+ +V+ +TVF    ++ + F+  Y+ + +    ++ YK +
Sbjct: 478 PFKSWGQPYTAIFGLVCVLMMIIVQGYTVFFPKLWNVQDFLFYYLMVFIDAAIYLSYKFI 537

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE 566
               W + +  D F     I+ E E  ++EM  LK  
Sbjct: 538 ----WTRGS--DSFKDPLKINFEPELKEIEMHELKHS 568

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  213 bits (543), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 143/500 (28%), Positives = 236/500 (47%), Gaps = 26/500 (5%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            L+K +++RH+ M                     AGP  +++ Y I   +++ ++   GE
Sbjct: 89  NLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGE 148

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           +   Y  L G +T Y++   DP+LGFAV   Y  ++L + P QL  AA+ ++YW     V
Sbjct: 149 LGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT---NV 205

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  +++ V    ++ IN+ G + + E EF  +  K                GG      +
Sbjct: 206 NADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYI 265

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G  YW +PG F          G KG      +VF YA F+Y G E+  + AAE +NP  +
Sbjct: 266 GTEYWHNPGPFAH--------GFKG----VCTVFCYAAFSYGGIEVLLLSAAEQENPTES 313

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           +P A K  +YRI++ Y+ T  L+G  V YN   LL            P+V+A+ + G+ V
Sbjct: 314 IPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHAS-PFVIAVSSHGVKV 372

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PH  NA +L  V S  NS LY G R L  LA     PK  A  +  G P     +   F
Sbjct: 373 VPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAF 432

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
            C+ ++  S++ E +F++ + ++S+  L  W+S+ +++I F  A   QG   + + Y+A 
Sbjct: 433 GCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQ 492

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDT-----FDYKTFITGYIGIPVYILCFVCYKIV 529
                +WIA+   +   LV  F V +         D K F   Y+ +P+ +L +  +K+ 
Sbjct: 493 TGYWGSWIAVLIAVFF-LVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMY 551

Query: 530 HKT--KWIKSANVDLFTYKT 547
            K+   WI +  +DL +++ 
Sbjct: 552 FKSWRFWIPAEKIDLDSHRN 571

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  213 bits (542), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 155/537 (28%), Positives = 253/537 (47%), Gaps = 45/537 (8%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG      LK+ L+ARH+ M                      GP+A++I ++I G  +  
Sbjct: 77  DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIG 136

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
            +  LGE+    P+ G F +Y+TR+ DP+L F +   Y+ ++  + P ++ ++A+ +QYW
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW 196

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                ++P VW+ +F   I++IN+ G + FGE EF  SS K                GGG
Sbjct: 197 --NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGG 254

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P H+ +G +YW DPG       A   PG         SV V A ++  GTE+  + + E 
Sbjct: 255 PDHDFVGAKYWHDPGCL-----AHGFPG-------VLSVLVVASYSLGGTEMVCLASGE- 301

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            +P+  +P AIK T +RI+ F+L ++ L+G  V Y +  LL            P+V+AIK
Sbjct: 302 TDPKE-LPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS----PFVIAIK 356

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
              I VLP I NA +L  + S  NS ++  SR+L  +A     P+ F   +  G P   +
Sbjct: 357 LHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGI 416

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
              +LF  LA++  SSS   +F + + +  +   + W+SI I++I F  A + QG   + 
Sbjct: 417 ITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDE 476

Query: 469 LSYQAPFQPVTAWIALGFCLM--VALVKNFTVFL-------GDTFDYKTFITGYIGIPVY 519
           L +      V  W +    ++  + LV  F   L         +   K F   Y+   + 
Sbjct: 477 LEF---VSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIM 533

Query: 520 ILCFVCYKIVHK---TKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKE---ERKQH 570
           I+ FV +KI ++    KW     ++       IDLE +   +++  LK+   ER +H
Sbjct: 534 IVLFVGHKIFYRYKTGKWWSMLPLN------KIDLETDRKNIDIEILKQEIAERNRH 584

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  213 bits (541), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/514 (27%), Positives = 241/514 (46%), Gaps = 24/514 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            LKK +++RHV M                      GP +++I Y ++ +V + ++   GE
Sbjct: 74  HLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGE 133

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA AY  L G F SY + +     GFA  + +  ++L + P +L  A+L ++YW    K+
Sbjct: 134 MAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYW--NDKI 191

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  V+I +F   +L I+  GVK +GE EF  +S K                GG      +
Sbjct: 192 NADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYI 251

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW+DPG F              KF     + V A F+Y G EL  +   E +NPR++
Sbjct: 252 GAKYWRDPGSFAEGDSV-------EKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKS 304

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P+A K ++YRI++ YL T+ L+G +V +N+  L+            PYV+A    G+ V
Sbjct: 305 TPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLM--GSGGSATHASPYVLAASIHGVKV 362

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PH  NA +L  V S  NS LY   R +  LA    APK     +  G P  +L LC +F
Sbjct: 363 VPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVF 422

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             + +++ SS  E +F++   +  +  L +W  I+++++ F +  ++ G  +  + ++A 
Sbjct: 423 GVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAV 482

Query: 475 FQPVTAWIALGFCLMVALVKNFTVF----LGDTFDYKTFITGYIGIPVYILCFVCYKIVH 530
                +   + F ++V + + +       L    D ++F   Y+  P+++  +  Y +  
Sbjct: 483 TGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYK 542

Query: 531 K--TKWIKSANVDLFTYKTAID-----LEEEEGK 557
           +  T  +    +DL  ++   D      E+EE K
Sbjct: 543 RDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENK 576

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 148/507 (29%), Positives = 236/507 (46%), Gaps = 33/507 (6%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           K+ L  RH++M                     +GP  +LI ++I+G  +F V+ C  E++
Sbjct: 73  KRTLSQRHLTMISIGGTLGTGLFIGLGYSL-TSGPGNLLIGFTIIGISIFCVVQCAAELS 131

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
              P+ G F ++ +R+ D ++GF V   Y   +L+  P++L   A+ ++YW     VNP 
Sbjct: 132 CQYPVSGSFATHVSRFIDSSVGFTVSTNYALAWLISFPSELIGCAITLRYW--NDSVNPA 189

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNR-LGF 236
           VWI +F   I+ +N+ GV+ F E EFWLS  K                GGGP  N  +G 
Sbjct: 190 VWIAIFYVFIMCLNLFGVRGFAETEFWLSLIKIAAIVIFIIIGIVLICGGGPHSNGYIGA 249

Query: 237 RYWKDPGGF-KPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
           +YW DPG F KP             F    + FV A F++ G EL  + A E +    ++
Sbjct: 250 KYWHDPGAFVKPV------------FKGLCNTFVSAAFSFGGAELVVLTANESRKIE-SI 296

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI--P 353
            RA K T +RI VFY+ TV ++G  V   D  LL            P+V+A+ N G    
Sbjct: 297 SRAAKGTFWRIAVFYITTVVIIGCLVPSTDERLLGAASDVDVTAS-PFVIALSNTGSFGD 355

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
            + H  NA +L  V S CNS +Y  SR +  L   ++ P      +  G P   + +C +
Sbjct: 356 KVSHFMNAVILIAVLSVCNSCVYAASRVIQSLGASRQLPSFCGYIDRKGRPLVGIGICGV 415

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
           F  L ++  SS    +F++   + SI    +W  I  + + F  A R QG   + ++Y++
Sbjct: 416 FGLLGFLVASSKEGEVFTWLFALCSISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKS 475

Query: 474 PFQPVTAWIALGFCLMVALVKNFTVF-----LGDTFDYKTFITGYIGIPVYILCFVCYKI 528
               +  W  +  C++  L+    ++     LG + + + F    + IP+ I  + C++I
Sbjct: 476 ---MLGFWGGVLGCVLNILLIAGEIYVSLFPLGGSPNAEGFFQYCLSIPIMIFVYFCHRI 532

Query: 529 VHK--TKWIKSA-NVDLFTYKTAIDLE 552
                T WI S   +DL T + A DLE
Sbjct: 533 YRNNWTDWIISTKKIDLDTGRKAEDLE 559

>KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 582

 Score =  212 bits (539), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/516 (27%), Positives = 249/516 (48%), Gaps = 11/516 (2%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           ++ L+ RHV +                    + G + +L+  ++    +  +     EM 
Sbjct: 65  RRTLRERHVLLIGISGVIGTALFVSIGKGLFRGGSVFLLLGMALWCIPMLCITVSTAEMV 124

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            Y+PLD  F   A+R  D +L    G+ + F   V  P ++ A   ++ YW  R   +  
Sbjct: 125 CYLPLDSPFLCLASRCVDDSLAIMAGWNFWFLECVQIPFEIVAVNTILHYW--RDDYSAA 182

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + V + +   I+++ V+F+GE EFWL+SFK                GG P  +R GFR
Sbjct: 183 IPLVVQVILYFAISVLAVRFYGEMEFWLASFKIILAAGLFVFTLVAMLGGNPKKDRFGFR 242

Query: 238 YWKDPGGFKPY--SGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            + D   FK Y  SG    P   G F  F +  + A F   G +   ++A E + PR+ +
Sbjct: 243 NFAD-APFKQYFPSGKPGSPSA-GYFQGFLACLIQASFTIAGPDYVAMIAGETRLPRKIL 300

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XXPYVVAIKNAGIPV 354
           P A K    R+ + +L +   +G+  + NDP L+             PYV+A+KN GI  
Sbjct: 301 PVAFKQVFNRLTILFLGSSLCVGILCSANDPSLMAAISEARPGAGASPYVLAMKNLGIKT 360

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           LP + NA ++T  FSA N+  +  SR+L+G+A+   AP +F + N  GVP  ++A+   +
Sbjct: 361 LPDVVNAALVTAAFSAGNAYTFCSSRTLHGMALVGNAPAVFKRCNRHGVPIYAVAVSLTW 420

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L+ + ++ ++  + ++ +N+ +   L+++  + +TY+ F RA+  Q      L +++ 
Sbjct: 421 ALLSLLQLNKNSAVVLNWLINMITASQLINFAVLCVTYLYFRRAYHAQCGALPELPFKSW 480

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK-IVHKTK 533
            QP TA + L   L++ LV+ + VF    +D + F+  Y+ I + I  +V +K +V + +
Sbjct: 481 GQPYTALVGLVAVLIMVLVQGYAVFCSSLWDVQEFLFCYLMIFIDIAIYVVHKFVVQRGR 540

Query: 534 -WIKSAN-VDLFTYKTAIDLEEEEGKLEMMRLKEER 567
            W ++   VDL T   A++  E E   +      ER
Sbjct: 541 CWPRAPKAVDLVTGLLAVERHEREAGFDRYVFFTER 576

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  212 bits (539), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 151/520 (29%), Positives = 248/520 (47%), Gaps = 32/520 (6%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           KK L  RH++M                     +GP ++LI + ++G  +  V+ C  E++
Sbjct: 70  KKVLDQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELS 128

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
              P+ G +  +A+R+ DP+ GF+VG  YL  +L+  P++L   +L M YW     VNP 
Sbjct: 129 CQYPVSGSYALHASRFIDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWAP--SVNPA 186

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGP-SHNRLGF 236
           VW+ +   + + +N+ G + F E EF++S FK                GGGP S   +G 
Sbjct: 187 VWVAIAFTLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGT 246

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F P +           F +F + FV A +++ GTE+  + +AE ++   +V 
Sbjct: 247 KYWYDPGSFAPPA-----------FKNFCNTFVSAAYSFSGTEMVVLTSAEARDVS-SVS 294

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI--PV 354
           RA K T +RI VFY+ TV ++G  V YNDP L+            P+V+A+ N G     
Sbjct: 295 RAAKGTFWRIAVFYIVTVIIIGCLVPYNDPRLINGSSSEDITAS-PFVIALSNTGAMGTR 353

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +    NA +L  VFS CNS +Y  SR + GLA   + PKI    +  G P   +A+C  F
Sbjct: 354 VSQFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICGYMDRNGRPLVGMAICGAF 413

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L ++ VS    T+F++   + SI    +W  I    I F  A + QG   + + Y++P
Sbjct: 414 GLLGFLVVSKDQGTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSP 473

Query: 475 FQPVTAWIA--LGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKT 532
                  +   L   L++  +      +G       F    + IP+ I  ++ ++I ++ 
Sbjct: 474 LGIYGGVVGCTLNVLLVIGEIYVSAAPVGMPSSAANFFEYCMSIPIMIAVYIGHRI-YRR 532

Query: 533 KW----IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERK 568
            W    IK  ++DL +  +  DLE  +     +R  +E++
Sbjct: 533 DWRHWYIKREDIDLDSGHSLEDLEATK-----LRRDQEKE 567

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  213 bits (543), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 144/531 (27%), Positives = 246/531 (46%), Gaps = 29/531 (5%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           K  ++ARHV M                     +GP  +++ Y ++ +V + V+   GEMA
Sbjct: 155 KGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMA 214

Query: 119 AYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176
              P    GF +Y + +     GFA  + +   +L + P +L  +++ ++YW     +NP
Sbjct: 215 IAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTT--SINP 272

Query: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGF 236
            +++ +F   +L ++ +G++ + E EF+ +S K                GG      +G 
Sbjct: 273 DIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGG 332

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           +YW DPG F   +GA        +F     V + A F+Y GTEL  +   E +NPR+ VP
Sbjct: 333 KYWHDPGPFASDNGA-------ARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVP 385

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPVLP 356
            A K ++YR+ + YL T+ L+G +V YN P L+            PYV+A +  G+ ++P
Sbjct: 386 VAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLM---GNANSKDASPYVLAAQIHGVKIVP 442

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
           H  NA +L  V S  NS L+ G R L  LA    APK     +  G P  +L +C+LF  
Sbjct: 443 HFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGV 502

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           +A+   S   + +F++   +  +  L +W  IL+++I F  A +  G   + + Y+A   
Sbjct: 503 IAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITG 562

Query: 477 PVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIVHK 531
              ++  L F L+V L+  F V L     G      +F   Y+   +++  ++CY I +K
Sbjct: 563 IWGSYYGLFFNLLV-LIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYLCYMIYNK 621

Query: 532 TKW-----IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE---RKQHGWTW 574
             W     +K  +VD        D   +E +    + K+    +K + W W
Sbjct: 622 -DWTILIPLKDIDVDYQRRIYDADFLRQEKEESYEKYKQSNIGKKIYAWLW 671

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  212 bits (539), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 159/536 (29%), Positives = 252/536 (47%), Gaps = 36/536 (6%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
           RL++ ++ RHV+M                      GP  ++I Y+ +  V + +M   GE
Sbjct: 78  RLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAAGE 137

Query: 117 MA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           MA AY  + G F +Y++ +     GFA  + Y  ++L + P +L  A+L ++YW     V
Sbjct: 138 MAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTD--SV 195

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  V+I +F   IL I+  G + +GE EF     K                GG  +   +
Sbjct: 196 NADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYI 255

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G RYW DPG F     AV  P  K  F  F  V V   F+Y GTEL  +   E  +PRR 
Sbjct: 256 GARYWHDPGAF-----AVGDPASK--FKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRA 308

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           +  A K  +YRI+V Y+ T+ L+G  V +    L+            PYV+A+   G+ V
Sbjct: 309 IHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELM-GSGGKSATHASPYVLAVSLHGVKV 367

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS +Y G R L  LA    APK  A  +  G P  +L  C++ 
Sbjct: 368 VPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVI 427

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             LA++  S   E +F++   +  +  L +W +IL+++I F +A +  G   + L Y++ 
Sbjct: 428 GLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKS- 486

Query: 475 FQPVTA-WIAL-GFCL-MVALVKNFTVFL------GDTFDYKTFITGYIGIPVYILCFVC 525
              +T  W ++ G C  ++  V  F V L      G T D  +F   Y+  P++ + F+ 
Sbjct: 487 ---ITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKT-DVLSFFQSYLAFPLWFVFFLG 542

Query: 526 YKIVHKTKWI---KSANVDLFTYKTAIDLEE-EEGKLEMMRLKEE-----RKQHGW 572
           Y +V+  +W+      ++D+  ++   D E  E+ KLE   + +      R +H W
Sbjct: 543 Y-MVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKTMLQNSNWLGRLKHFW 597

>SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {ON}
           similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 558

 Score =  210 bits (535), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 143/508 (28%), Positives = 245/508 (48%), Gaps = 10/508 (1%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
            + LQ RHV +                      GP+ +L+ +S+    +  +     EM 
Sbjct: 45  HRKLQNRHVQLIGISGVIGTALFVSIGRALYHGGPVFLLLGFSLWCIPILCITVSTAEMV 104

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            Y+P    F   A+R  D +L     + + F   V  P ++ A   ++ YW  R   +  
Sbjct: 105 CYMPFSSPFLRIASRCVDNSLAIMASWNFWFLECVQIPFEIVAVNTMIHYW--RDDYSAA 162

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + V + + L I++  V+++GE EFWL+SFK                GG P H+R GFR
Sbjct: 163 IPLVVQVVLYLAISVFAVRYYGEMEFWLASFKIFLAIGLFFFTFITMLGGNPKHDRYGFR 222

Query: 238 YWKDPGGFKPY--SGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295
            +KD   FK Y  +   ++    G F  F +  + A F   G +   ++A E   PR+ +
Sbjct: 223 NFKDLP-FKEYFPNNDKTVGSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETLLPRKVL 281

Query: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
           P A K    R+ V +L     +G+  + NDP L              PYV+A+ N GI V
Sbjct: 282 PIAFKQVFVRLTVLFLGGCLCIGIVCSANDPNLTAAITEDRPGAGASPYVIAMNNLGIKV 341

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           LP I NA ++T  FSA N+  Y  SR+LYG+A+D  APK+F++ N  GVP  ++A+  L+
Sbjct: 342 LPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPKVFSRCNRHGVPIFAVAVSLLW 401

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L+ + +  ++  + ++ VN+ +   L+++  + + Y+ F RA+  Q  +   L +++ 
Sbjct: 402 ALLSLLQLGKNSAVVLNWLVNLITASQLINFGVLCVVYLFFRRAYMAQRDNLPELPFKSW 461

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV---HK 531
           +QP  A I L    ++ +V+ +TVF    ++Y++F+  Y+ I V I  ++ +K V    K
Sbjct: 462 WQPYPAIIGLVSVSVMTIVQGYTVFFKTLWNYESFLFSYLMIFVDIFIYLGHKFVINYGK 521

Query: 532 TKWIKSANVDLFTYKTAIDLEEEEGKLE 559
               +  +VDL T    I++ E E   +
Sbjct: 522 DPVKRPQDVDLITGLYEIEIHELENGFD 549

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  211 bits (537), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 147/534 (27%), Positives = 251/534 (47%), Gaps = 26/534 (4%)

Query: 45  VDWGYDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMG 104
           V+ G        + KK L +RHV M                      GP +++I Y ++ 
Sbjct: 64  VEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVS 123

Query: 105 WVVFTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAA 162
           +V + ++   GEMA AY  L G F +Y + +   + GFA  + +  ++L + P +L  ++
Sbjct: 124 FVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSS 183

Query: 163 LVMQYWVGRGKVNPGVWITVFLAVILTINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXX 221
           L ++YW    K+N  +++ +F   ++ I++VG ++ +GE EF  +S K            
Sbjct: 184 LTIKYW--NDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSI 241

Query: 222 XXXXGGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELC 281
               GG  +   +G +YW +PG F              +F     V V   F+Y GTEL 
Sbjct: 242 VINAGGAGNDGYIGGKYWHEPGSFAEGDAT-------SRFKGICLVLVSGYFSYGGTELY 294

Query: 282 GIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXX 341
            +   E   PR+  P A K ++YRI++ YL T+ L+G +V +N+  L+            
Sbjct: 295 VLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHAS-- 352

Query: 342 PYVVAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSW 401
           PYV+A    G+ ++PH  NA +L  V S  NS L+ G R L  LA    APKI +  +  
Sbjct: 353 PYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDRE 412

Query: 402 GVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRV 461
           G P  +L +  L   +A+++ +S  E +F++   +  +  + +W  I+ +++ F  A +V
Sbjct: 413 GRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKV 472

Query: 462 QGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGI 516
           QG D N L Y+A      +     F ++V L+  F V L     G   D + F   Y+  
Sbjct: 473 QGKDINELGYKANTGVWGSAYGAFFGVLV-LIAQFWVALAPIGNGGKCDAEAFFESYLAF 531

Query: 517 PVYILCFVCYKIVHKTKWIKSA--NVDLFTYKTAIDLE----EEEGKLEMMRLK 564
           P+++ C+  Y I +K   + S    +DL +Y+   D E    E+E   E ++ +
Sbjct: 532 PIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENKENLKSR 585

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  211 bits (536), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 156/543 (28%), Positives = 251/543 (46%), Gaps = 52/543 (9%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           KK L  RH++M                     +GP A+LI Y ++G  +F V+    E+A
Sbjct: 71  KKVLSQRHLTMISIGGTLGTGLFIGLGAAL-TSGPAALLIGYLLVGASMFCVIQSASELA 129

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
              P+ G ++S+ TR+ D ++GF VG  Y   +LVL P++L   +L + YW     +NP 
Sbjct: 130 CQFPVTGSYSSHVTRFVDESVGFTVGTNYTLAWLVLFPSELIGCSLTISYW--NSTINPA 187

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG-PSHNRLGF 236
           VW+ +FL  +L IN+ GV+ F E EF LS  K                GGG  S   +G 
Sbjct: 188 VWVAIFLVFVLWINLFGVRLFAETEFVLSIIKVLAIVIFIIIGIVLIAGGGQDSGGYIGT 247

Query: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296
           RYW DPG           P  K  F +  + FV A F+Y G+E+  +   E KN   ++ 
Sbjct: 248 RYWHDPG-----------PFAKPVFKNLCNTFVSAAFSYGGSEMVLLTGTESKNI-SSIA 295

Query: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGI--PV 354
           RA K T YRI +FY+ TV ++G  V YNDP LL            P+V+A+ N G     
Sbjct: 296 RAAKGTFYRIAIFYITTVVVIGCLVPYNDPRLLN-ASSSEDISASPFVIALGNTGSMGSK 354

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           + +  NA +L  V S CNS +Y  SR +  L      P I    +  G P   +A+   F
Sbjct: 355 VSNFMNAIILVSVVSVCNSTVYASSRLIQALGAAGHLPGICGYMDMKGRPLVGIAITGAF 414

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             L ++  ++    +F++   + SI   ++W  I +  + F  A + +   K  ++Y++ 
Sbjct: 415 GLLGFLVATNKQSEVFTWLFALCSIASFVTWFCICLAQVRFRLAMKARKRSKEHIAYRS- 473

Query: 475 FQPVTAWIALG-FCLMVALVKNFTVFLGDTF------DYKTFITGY----IGIPVYILCF 523
                    LG +  +   + NF +  G+ +      D K+   G+    + IP+ I+ F
Sbjct: 474 --------MLGIYGGIAGCIVNFLLIAGEIYVSAWPVDGKSSAEGFFEYDLSIPIMIIVF 525

Query: 524 VCYKIVHKTKW----IKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYD 579
           + +KI ++  W    +K  ++DL    T   +E     LE+ + ++E ++     K  Y 
Sbjct: 526 LGHKI-YRNDWKNWYVKRRDMDL---DTGCSIE----NLELFQSQKESEKEDLACKPLYY 577

Query: 580 YIF 582
            I+
Sbjct: 578 RIY 580

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  211 bits (536), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 146/529 (27%), Positives = 246/529 (46%), Gaps = 28/529 (5%)

Query: 49  YDGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVF 108
           Y+   K  ++K+ +++RH++M                      GP  ++I Y     +++
Sbjct: 69  YNATQK--KMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLY 126

Query: 109 TVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQ 166
            V+    E+  +Y  L G + SY +   D    FAV + Y  ++ ++ P +L  +++ ++
Sbjct: 127 CVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIK 186

Query: 167 YWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXG 226
           YW     +NP V++ +F   I+ I+  G + + E EF  +S K                G
Sbjct: 187 YW--NDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCG 244

Query: 227 GGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286
              S   +G +YW  PG F    G  +I   KG      SV+V + FAY G+E   + AA
Sbjct: 245 ASKS-GYIGGKYWHTPGAF---VGEKAIDHFKG----ICSVWVQSAFAYGGSEFIALTAA 296

Query: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVA 346
           E  NPR++VP+A K  LYR+++ +L  + L+G  V Y+ PLLL            P+V+A
Sbjct: 297 EQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLL-GSPGQAASHASPFVIA 355

Query: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYN 406
             + G+ V+PHI NA +L  V S  NS  Y   R L  LA     PK+F   +  G P  
Sbjct: 356 AASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLV 415

Query: 407 SLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDK 466
           ++    +F  ++++  S + ET+F++   + S+  L +W +I +++I F  A + QG   
Sbjct: 416 TMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSL 475

Query: 467 NTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYIL 521
             L Y+A      +W A+ F ++V L   F V +     G   D   F   Y+  PV + 
Sbjct: 476 GELGYKANTGYWGSWYAIAFNIIV-LAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVF 534

Query: 522 CFVCYKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
            +  YK+ ++  W       LF     +DLE      +   +K+E  +H
Sbjct: 535 FYFGYKLWYR-DW------KLFIPADKVDLESHRKIFDADLIKQEDFEH 576

>TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.397
           YBR132C
          Length = 580

 Score =  210 bits (534), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 146/526 (27%), Positives = 256/526 (48%), Gaps = 20/526 (3%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           K++L+ RHV                      + GP+++++A+ +    +F +     EM 
Sbjct: 63  KRNLKNRHVQFIAISGVIGTALFVTIGKPLYKGGPVSLILAFILWCIPIFAITVSTAEMV 122

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            + P+   F   A +  D +L F   + + F   V  P ++ +   ++ YW      +P 
Sbjct: 123 CFYPVSSPFLRLANKCVDESLAFMASWNFWFLECVQIPFEIVSVNTMIHYWTT--NYSPA 180

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + V + +   I+I  VK++GE EFWLSSFK                GG P  +  GFR
Sbjct: 181 IPLVVQVVLYFIISITAVKYYGELEFWLSSFKIILAIGLFLFTLITMCGGNPERDHFGFR 240

Query: 238 YWK-DPGGFKPY--SGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
            +K +P  FK Y  SG  S P   G F  F +  + A F   G E   ++A E   PR+ 
Sbjct: 241 NYKVEP--FKQYFPSGNHS-PASLGYFQGFLNCLIQAAFTIAGGEYISMLAGEVHLPRKV 297

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDP-LLLQXXXXXXXXXXXPYVVAIKNAGIP 353
           +P+A K   YR+   ++ +   +G+  + NDP L              PYV+A+ N  I 
Sbjct: 298 LPKAFKQVFYRLTFIFIGSCLCVGIICSPNDPDLTAAISESRPGAGSSPYVIAMNNLKIR 357

Query: 354 VLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTL 413
           +LPHI N  ++T  FSA N+  Y  SR+LYG+A+D  APKIF++ N +GVP  S+ +  L
Sbjct: 358 ILPHIVNVALITAAFSAGNAYTYCSSRTLYGMALDGYAPKIFSRCNKYGVPIYSVVISLL 417

Query: 414 FCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQA 473
           +  L+ + ++S++  + ++ VN+ +   L+++  I ITY+ F +++R Q  D  +L +++
Sbjct: 418 WALLSLLQLNSNSAVVLNWLVNLITASQLINFSVICITYLFFRKSYRAQSNDLPSLPFKS 477

Query: 474 PFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTK 533
            FQP TA   L   +++  V+ +T  +   +  + F+  Y+ + + ++    +  VHK  
Sbjct: 478 WFQPYTAIFGLACAVIMIGVQGYTTLIPSIWSVQNFLFCYLMVFLNLI----FYFVHKFG 533

Query: 534 WIKSANVDL-FTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFY 578
           W       L F   T I+      K ++M ++    ++G+   QF+
Sbjct: 534 WTYYKTKSLSFRNPTQINF-----KNDLMVIENHELKYGFNKFQFF 574

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  210 bits (535), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 143/521 (27%), Positives = 244/521 (46%), Gaps = 24/521 (4%)

Query: 57  RLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGE 116
            LKK +++RHV M                     AGP +++I Y ++ +V + ++   GE
Sbjct: 85  HLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGE 144

Query: 117 MAAYIPL--DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKV 174
           M    P     F +Y + +   + GFA  + +  ++L + P +L  +++ ++YW     +
Sbjct: 145 MGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--NDTI 202

Query: 175 NPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRL 234
           N  V+I +F   +L I+  GVK +GE EF  +S K                GG      +
Sbjct: 203 NADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262

Query: 235 GFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRN 294
           G +YW+DPG F   SGA        +F     + V A F++ G EL  +   E  NPR++
Sbjct: 263 GGKYWRDPGSFAEGSGAT-------RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKS 315

Query: 295 VPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIKNAGIPV 354
            P A K ++YRI++ YL T+ L+G +V +N+  L+            PYV+A     + V
Sbjct: 316 TPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLM--GSGGSATHASPYVLAASIHKVRV 373

Query: 355 LPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLF 414
           +PHI NA +L  V S  NS LY   R +  LA    APK     +  G P  +L +C+L 
Sbjct: 374 IPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLV 433

Query: 415 CCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAP 474
             + ++  S   E  F++   +  +  L +W  I++++I F +A +VQG   + + Y+A 
Sbjct: 434 GVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKAN 493

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFL-----GDTFDYKTFITGYIGIPVYILCFVCYKIV 529
                ++  + F ++V + + F V L     G   D + F   Y+  P++I  +V Y +V
Sbjct: 494 TGIWGSYYGVFFNMLVFMAQ-FWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY-MV 551

Query: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
           +K  +     +D    K  +D        E+MR ++E  + 
Sbjct: 552 YKRDFTFLNPLD----KIDLDFHRRVYDPEIMRQEDEENKE 588

>NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.397
           YBR132C
          Length = 584

 Score =  209 bits (533), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 136/513 (26%), Positives = 240/513 (46%), Gaps = 7/513 (1%)

Query: 59  KKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTVMSCLGEMA 118
           K++L  RHV +                    + GP  +L+A++I    +  +     EM 
Sbjct: 74  KRNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLLLAFAIWCIPILCITVSTAEMV 133

Query: 119 AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177
            ++P+   F   AT+  D +L     + + F   V  P ++     ++ YW  R   +  
Sbjct: 134 CFMPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPYEIVTVNTIIHYW--RDDYSAA 191

Query: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGGPSHNRLGFR 237
           + + +   + L I++  VK++GE EFWL+SFK                GG P  +R GFR
Sbjct: 192 IPLVIQSLLYLLISLAAVKWYGEMEFWLASFKIVLAMGLFCFTFITMLGGNPKKDRFGFR 251

Query: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297
           Y+ D    K +   +      G F  F    + A F   G E   ++A E + PRR +PR
Sbjct: 252 YFHDTPFKKYFPDGIDRGSSAGYFQGFFICLIQASFTIAGGEYISMLAGEIEIPRRVLPR 311

Query: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXX-XXPYVVAIKNAGIPVLP 356
           A K    R+ + +L +   +G+  + ND  L              PYV+A+ N GI +LP
Sbjct: 312 AFKQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEARPGAGSSPYVIAMNNLGIRILP 371

Query: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416
            I N  ++T  FS+ N+  Y  SR+LYG+A+D  APKIF + N  GVP  ++ +  L+  
Sbjct: 372 DIVNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFTRCNKQGVPIYAVGVSLLWAF 431

Query: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476
           ++ + ++S++  + ++ +N+ +   L+++  + ITY+ F RA+ +Q      L +++ +Q
Sbjct: 432 ISLLQLNSNSAIVLNWLINIITASQLINFAILCITYLFFRRAYLLQKDKLPELPFKSWWQ 491

Query: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV---HKTK 533
           P TA   L   +++ +V+ +TVF    ++ + F+  Y+ I + I  ++ YK +    K K
Sbjct: 492 PYTAIFGLVCAMVMMIVQGYTVFFPKNWNVQDFLFCYLMIFINIGIYIFYKFIWRLGKDK 551

Query: 534 WIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE 566
               A +        I+  E E   +  R   E
Sbjct: 552 IKDPATISFEDELREIENHELEHNFDKFRFYTE 584

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  207 bits (527), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 139/489 (28%), Positives = 236/489 (48%), Gaps = 41/489 (8%)

Query: 90  QAGPIAILIAYSIMGWVVFTVMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLF 148
           Q+GP  +LI + I+G  +F V+    E++   P+ G F+S+ +R+ +P+LGF V   Y  
Sbjct: 21  QSGPGTLLIGFLIVGVSIFCVIQSAAELSCQYPVSGSFSSHVSRFIEPSLGFTVSCAYAL 80

Query: 149 KYLVLTPNQLTAAALVMQYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSF 208
            +L+  PN+L   A+ + YW     + P VW+ +   +++ +N+  V+ F E EFWLS  
Sbjct: 81  SWLISFPNELVGLAMTIGYW--NEDIPPAVWVLIGYLLVIGLNLFAVRGFAESEFWLSII 138

Query: 209 KXXXXXXXXXXXXXXXXGGGPSHNR--LGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFAS 266
           K                GGGP++    LG +YW DPG F+P             F S   
Sbjct: 139 KVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFRP-----------PFFSSLCQ 187

Query: 267 VFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDP 326
            FV A F + G EL  + A E +    ++ RA K T +RI +FY+ TV ++G  V Y  P
Sbjct: 188 TFVSAAFTFGGAELVLLTANESRK-IESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSP 246

Query: 327 LLLQXXXXXXXXXXXPYVVAIKNAGI--PVLPHIFNACVLTFVFSACNSDLYVGSRSLYG 384
            L             P+V+A+ N G     + H  NA ++  V S CNS +Y  SR +  
Sbjct: 247 AL-----DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQS 301

Query: 385 LAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLS 444
           L    + P+IF   +  G P   + +C +F  LA++  ++  + +F++   + SI     
Sbjct: 302 LGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFV 361

Query: 445 WISILITYISFDRAFRVQGIDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTF 504
           W  I ++ + + RA +VQG     ++YQ+     +         ++  + NF +  G+ +
Sbjct: 362 WFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSG--------VIGTLLNFLLICGEIY 413

Query: 505 ------DYKTFITGYIGIPVYILCFVCYKIVH---KTKWIKSANVDLFTYKTAIDLEEEE 555
                 D +TF    + IP+ I+ + C+++     KT  I + ++DL T +   DLE  +
Sbjct: 414 VSVKDGDVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMK 473

Query: 556 GKLEMMRLK 564
            +L + R +
Sbjct: 474 HELIVSRAR 482

>SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]
           {ON} similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 850

 Score =  214 bits (544), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 154/593 (25%), Positives = 273/593 (46%), Gaps = 70/593 (11%)

Query: 51  GKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFTV 110
           G +    +++ L  RH+ M                     AGP   L+ + +   +V   
Sbjct: 271 GHNDVYHVQRKLHVRHLQMIAIGASLGVGLFLTSGKAFTVAGPFGTLLGFLLCASIVLAT 330

Query: 111 MSCLGEMAAYIPLD-GFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW- 168
           M    E++  IP+  GF+  A+R+ + A GFA+G++Y F +++  PNQ+ A+  ++ Y+ 
Sbjct: 331 MLSFTEISTLIPISSGFSGLASRFVEDAFGFALGWSYWFSFVIALPNQIVASTFMLSYYE 390

Query: 169 ---VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 225
              V  G      ++T+FL   + IN++ V+  GE  +  + FK                
Sbjct: 391 HLNVPSGST--AGFVTLFLLFAIFINLLDVRILGEILYGSTFFKILITVMMMIAMIALNA 448

Query: 226 GGGP-SHNRLGFRYW---KDPGG-----FKPY-------SGAVS-IPGGKGKFVSFASVF 268
           G G   H+R+GFRYW   K P G     F+P        SG++  I G KG+F++   V 
Sbjct: 449 GAGAHRHSRVGFRYWDSSKSPEGLTYGLFRPTFDLGDKGSGSLDGIGGSKGRFLAVLVVM 508

Query: 269 VYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLL 328
           + + FA+ G EL  + + E  NPR+ +P A K T   I++ YL ++FL+GL++   DP L
Sbjct: 509 LISSFAFSGVELAFVASGEAVNPRKTLPSATKRTFIIIIILYLFSIFLVGLNIYSGDPRL 568

Query: 329 LQ------------------------------XXXXXXXXXXXPYVVAIKNAGIPVLPHI 358
           L+                                         P+V+A+++ G+     +
Sbjct: 569 LRYYASPGKDVTIDDYGTKWQIETSCNKNLVVNLDGAINGSQSPWVLALQSFGLCTFSSV 628

Query: 359 FNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCLA 418
            N  ++ F  SA  S LY  SR+LY ++I  KAP++F + +  G+PY S+  C  F   +
Sbjct: 629 LNGILIFFGPSAGCSSLYASSRTLYSMSIQGKAPELFRRCSKKGIPYVSVLFCGAFGVTS 688

Query: 419 YMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQ----GIDKNTLSYQAP 474
           Y++VS  +   F    N++S    + W+ + I+++ F  A + +      D  +  Y++P
Sbjct: 689 YLSVSKESVENFQALANISSASICIIWMGLNISFLRFYYALKKRPDIISRDDPSFPYRSP 748

Query: 475 FQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKW 534
           FQP  A+  L    ++ L   FT FL   ++ K F + Y G+  + +C++ YK    +K 
Sbjct: 749 FQPYLAFYGLLGSTILVLFMGFTTFLPGLWNTKVFFSAYGGLMFFTVCYLGYKTFGTSKI 808

Query: 535 IKSANVDLFTYKTAIDLEEEEGKLEMMRLK-EERKQHGWTWKQFYDYIFGWIF 586
            +   +D+           + G+ E+ R+  +E  ++  T+K+       W+F
Sbjct: 809 QRLDQLDM-----------DSGRREIDRMIWDEHHEYSDTFKERAIRWITWLF 850

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  209 bits (533), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 247/534 (46%), Gaps = 42/534 (7%)

Query: 50  DGKHKGIRLKKDLQARHVSMXXXXXXXXXXXXXXXXXXXXQAGPIAILIAYSIMGWVVFT 109
           DG      LKK L+ARH+ M                      GP+A++I ++I G  +  
Sbjct: 78  DGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIG 137

Query: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168
            +  LGE+    P+ G F +Y+TR+ DP++ F V   Y+ ++  + P ++ ++A+ +QYW
Sbjct: 138 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYW 197

Query: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXGGG 228
                ++P VW+ +F   I++IN+ GV+ FGE EF  S+ K                GGG
Sbjct: 198 --NESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGG 255

Query: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288
           P H  +G RYW +PG       A   PG         SV V A ++  GTE+  + + E 
Sbjct: 256 PDHVYVGSRYWHNPGCL-----ANGFPG-------VLSVMVVASYSLGGTEMTCLASGET 303

Query: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQXXXXXXXXXXXPYVVAIK 348
            +P+  +P AIK   +RI+ F+L ++ L+G  V Y +  LL            P+V+AIK
Sbjct: 304 -DPKE-LPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS----PFVIAIK 357

Query: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408
              I VLP I NA +L  + S  NS ++  SR+L  +A     P  F   +  G P   +
Sbjct: 358 IHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGI 417

Query: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468
              +LF  LA++  S S   +F + + +  +   + W+SI +++I F  A + QG   N 
Sbjct: 418 ITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNE 477

Query: 469 LSYQAPFQPVTAW----IALGFCLMVALVKNFTVFL-------GDTFDYKTFITGYIGIP 517
           L +      V  W     A+  CL+  LV  F + L             K F   Y+   
Sbjct: 478 LEF---VSAVGIWGSVYSAIINCLI--LVAQFYISLWPIGGWKNSEDRAKKFFQSYL--- 529

Query: 518 VYILCFVCYKIVHKT-KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQH 570
              L  VC  I HK   W ++  +  FT    IDL+E    +++  LK+E  + 
Sbjct: 530 -CALIMVCIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHER 582

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.142    0.454 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,877,200
Number of extensions: 2018327
Number of successful extensions: 7459
Number of sequences better than 10.0: 371
Number of HSP's gapped: 5690
Number of HSP's successfully gapped: 392
Length of query: 586
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 471
Effective length of database: 40,294,809
Effective search space: 18978855039
Effective search space used: 18978855039
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)