Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_1475na 1ON34934917630.0
AFR531Wna 1ON2742386322e-80
SAKL0B05434gna 1ON3443655331e-64
KLTH0H15048gna 1ON2963554577e-54
Kwal_34.15946na 1ON2791894392e-51
Skud_8.555.586ON5351123301e-33
Kwal_47.183375.586ON5361403283e-33
Kpol_1023.635.586ON5561473266e-33
Smik_8.635.586ON5421073258e-33
Suva_8.625.586ON5451103259e-33
YHR006W (STP2)5.586ON5411123241e-32
NDAI0C006905.586ON6501133242e-32
TBLA0E028205.586ON3121243104e-32
KLTH0G05104g5.586ON5381213195e-32
KAFR0A067205.586ON2351133029e-32
KLLA0F10109g5.586ON6231253172e-31
NCAS0H028905.586ON5321063142e-31
KNAG0B033505.586ON6001153144e-31
KNAG0C060305.586ON3141163034e-31
TDEL0A045305.586ON4841083062e-30
ZYRO0D13992g5.586ON5871183072e-30
SAKL0G06292g5.586ON5171063011e-29
Smik_4.7425.586ON5281073011e-29
TPHA0K002105.586ON4811073001e-29
YDR463W (STP1)5.586ON5191072992e-29
NDAI0H011105.586ON4541072946e-29
NCAS0A079005.586ON3671062906e-29
Ecym_14045.586ON5621062923e-28
Skud_4.7395.586ON5141072895e-28
AFR461C5.586ON5441062896e-28
Suva_2.6395.586ON5161072852e-27
CAGL0K06413g5.586ON3591062766e-27
KAFR0C057105.586ON4421072717e-26
CAGL0E04312g5.586ON6881062651e-24
Kwal_26.93004.222ON3041502008e-17
NCAS0J013004.222ON4351761993e-16
KLLA0F07073g4.222ON5581671951e-15
KAFR0A061204.222ON3421621832e-14
Kpol_337.64.222ON4001001832e-14
KLTH0D13618g4.222ON414971772e-13
TBLA0I027704.222ON6131021782e-13
TBLA0A082004.222ON3501001682e-12
SAKL0H26224gsingletonON2271021642e-12
SAKL0H03894g4.222ON358971682e-12
AFR588W4.222ON319971672e-12
NDAI0J020604.222ON489991683e-12
KNAG0B059404.222ON3771761664e-12
Ecym_27684.222ON431941665e-12
TPHA0B009304.222ON3471771611e-11
TDEL0E015204.222ON3991791612e-11
CAGL0K04697g4.222ON515581603e-11
CAGL0H04873g4.222ON451641593e-11
ZYRO0B07436g4.222ON343661549e-11
Smik_12.4624.222ON3411391531e-10
YLR375W (STP3)4.222ON3431391531e-10
Suva_10.4914.222ON3441681532e-10
Skud_12.4604.222ON344661522e-10
YDL048C (STP4)4.222ON4901231523e-10
Suva_4.2014.222ON503891523e-10
Skud_4.2064.222ON486891523e-10
NCAS0A023604.222ON4781851513e-10
Smik_4.1904.222ON489891513e-10
NDAI0D045104.222ON5601001462e-09
Kpol_472.34.222ON3111661282e-07
TPHA0B023904.222ON3461451246e-07
Ecym_72552.533ON544611042e-04
AGL071C2.533ON396611033e-04
ZYRO0B02002g2.533ON294611023e-04
NDAI0K018602.533ON730611034e-04
Smik_13.2492.533ON473711024e-04
Suva_13.2462.533ON419711015e-04
CAGL0K02343g8.130ON11621041025e-04
KLLA0E18547g2.533ON431681015e-04
KNAG0D022208.130ON1206701025e-04
Skud_13.2262.533ON475731016e-04
KAFR0A018602.533ON490761007e-04
Ecym_21596.256ON460671007e-04
YMR070W (MOT3)2.533ON490711008e-04
TDEL0A030702.533ON23964960.001
ACR264W2.162ON769118980.001
KNAG0C058102.533ON55470980.001
KLLA0F23782g2.162ON782118980.002
KNAG0G012808.144ON47259960.003
KNAG0H011803.281ON25490930.003
TBLA0I014802.533ON51364940.004
TBLA0G022302.533ON21674920.004
AEL174W1.326ON661116940.005
TPHA0G035102.533ON38761930.005
KNAG0A070402.533ON35269930.005
KLTH0E09724g2.162ON768119930.005
Kwal_47.178882.162ON786119930.005
Ecym_54242.162ON775118930.006
TBLA0F003708.144ON68767930.006
NDAI0A075403.298ON37091910.007
KAFR0A010903.281ON24968900.008
SAKL0E10714g2.162ON819125920.008
KNAG0J008703.281ON28084900.009
Ecym_62951.326ON66377910.009
CAGL0K03003g2.533ON64761910.011
TDEL0F010308.130ON107759900.013
SAKL0A09482g2.533ON38860890.013
NCAS0A048002.533ON51168900.014
SAKL0D06776g1.326ON767124900.014
Kwal_26.83512.598ON698128890.020
KNAG0I020702.162ON57264880.021
NCAS0B045008.130ON120762880.028
TBLA0I032803.518ON33088860.031
Kwal_26.80212.533ON50760860.034
ZYRO0G19140g8.144ON55768860.038
ACL057W8.144ON52067860.038
Kpol_1023.1004.351ON91660860.039
NDAI0H014002.533ON54160860.040
SAKL0H04070g4.214ON89971860.041
TPHA0C041902.533ON41761850.043
Smik_4.2813.281ON23164840.044
Kpol_1052.183.281ON35761840.051
SAKL0D03146g3.281ON15767810.055
ABR089C2.598ON571130850.055
KLTH0D06842g2.533ON50661850.056
KNAG0D041904.214ON101060850.058
NCAS0I015603.281ON26659830.062
NCAS0F009002.533ON52582840.069
KNAG0E016003.518ON33868830.069
YDR043C (NRG1)3.281ON23166820.071
Suva_2.2003.281ON23266820.072
SAKL0H24816g8.144ON41067830.073
Skud_4.2973.281ON23166820.074
Smik_6.4356.256ON38655830.075
KAFR0B021608.144ON45364830.075
KAFR0J003402.533ON21866810.084
Kpol_1018.332.533ON58958830.091
KLLA0C17072g8.144ON47468830.093
Ecym_84038.144ON57367830.099
Kwal_47.172418.144ON40368820.10
Kpol_1072.582.162ON794125830.10
Kpol_1031.428.144ON35967820.11
TPHA0M011803.281ON35068810.12
CAGL0K12078g3.281ON46363820.12
KLTH0E06688g8.144ON39767820.12
CAGL0K04631g4.214ON101376820.13
SAKL0G18062g4.351ON123860820.13
YPL230W (USV1)6.256ON39155810.14
Suva_8.244.21ON63188810.15
NDAI0A074703.281ON26359800.15
KAFR0E029008.486ON185142790.15
AER159C4.351ON119160820.15
KAFR0C04550singletonON467110810.16
KLTH0D08734g2.598ON67767810.16
NDAI0B042902.162ON1064115810.16
SAKL0A03476g6.256ON32259800.16
KLLA0B04477g4.351ON133260810.16
TPHA0B029102.162ON717125810.17
TDEL0D006704.351ON119960810.18
Suva_16.766.256ON39255800.18
Suva_5.2518.144ON44964800.18
Skud_16.486.256ON39855800.18
Suva_13.3636.256ON21163780.19
Smik_13.3876.256ON21263780.20
TDEL0B046708.144ON31267790.20
Skud_13.3486.256ON21673780.20
YMR182C (RGM1)6.256ON21163780.20
KLLA0E13487gna 2ON23059780.21
Kpol_1065.153.281ON22060780.21
CAGL0E06116g6.256ON61363800.21
Kpol_1050.193.518ON22173780.22
KLLA0F26961g2.598ON69467800.23
KAFR0B063608.425ON62760800.23
SAKL0H24464g8.130ON95061800.25
TPHA0D010508.144ON43967790.26
TBLA0H006608.425ON131177800.27
KAFR0C004903.281ON22459770.27
Kpol_185.32.598ON64759790.28
Skud_10.3514.351ON132771790.28
Kwal_14.25431.326ON711122790.28
KAFR0B068104.351ON115595790.30
CAGL0M00594g4.351ON102064790.30
KLTH0H10538g1.326ON682122790.30
CAGL0L07480g3.281ON31459780.31
SAKL0F16170g7.543ON43733780.31
Ecym_27604.214ON93860790.32
Skud_5.2488.144ON44259780.33
Suva_4.3053.281ON22068770.33
Kpol_1052.83.298ON38666780.34
NDAI0C048608.425ON135074790.34
ZYRO0B07568g4.214ON61660780.35
KNAG0J022503.296ON29693770.36
Kpol_1002.256.256ON29473770.37
TDEL0D058603.518ON33058770.37
TDEL0B052502.162ON714126780.38
AFR580C4.214ON83860780.39
NCAS0B069602.162ON839118780.39
CAGL0L03916g2.162ON64257780.40
Smik_16.4507.543ON43233770.41
Kwal_27.109253.281ON26467760.42
KNAG0F017106.256ON41364770.42
TDEL0E015904.214ON77060780.43
TBLA0F013001.326ON98560780.43
Skud_16.4907.543ON40733770.44
YER130C8.144ON44359770.44
YJR127C (RSF2)4.351ON1380117780.46
ZYRO0C13508g3.281ON18959750.46
NCAS0B046008.144ON54792770.47
Kpol_541.398.116ON29127760.51
Kpol_1013.212.598ON49459770.53
Skud_2.1893.281ON22066750.53
Smik_5.2768.144ON44259760.55
KLLA0C16005g6.256ON33174760.57
NCAS0A129102.598ON82259770.58
Smik_10.4204.351ON134876770.58
CAGL0K02145g8.144ON31759750.62
KNAG0H034802.162ON796113760.62
YGR067C4.214ON80476760.63
KNAG0D021208.144ON40275760.64
NCAS0A062504.351ON134160760.67
KNAG0H005502.598ON62059760.73
NCAS0G012706.256ON27489740.73
Suva_8.1662.162ON94861760.75
ZYRO0F01012g2.598ON58480750.76
Smik_15.2912.162ON909116760.77
Kwal_14.22784.80ON46365750.77
Suva_7.3494.214ON81260750.81
TPHA0A039803.281ON31461740.86
KAFR0E042704.351ON125578750.87
KAFR0G030504.214ON74960750.88
Skud_15.2762.162ON917116750.89
NCAS0A021604.189ON41260740.94
KNAG0D009006.256ON32255740.96
Suva_12.2184.351ON127071750.97
TBLA0B061604.351ON138461750.98
TPHA0A039103.298ON35166741.0
Skud_5.1373.518ON39463741.0
NCAS0D02520singletonON24357731.1
KLLA0B07909g4.214ON92260741.1
Skud_13.1932.598ON70459741.1
YOR113W (AZF1)2.162ON914116741.1
Skud_7.3644.214ON81060741.1
AFL136W6.256ON40978741.1
Smik_11.1862.598ON64159741.2
Smik_13.2072.598ON70359741.2
YMR037C (MSN2)2.598ON70459741.2
Smik_6.1504.214ON80660741.2
KLLA0F18524g3.281ON35761731.3
TPHA0N014602.598ON51959731.3
TPHA0C025802.598ON36568731.3
CAGL0J05060g1.326ON71368731.4
Smik_5.1513.518ON38858731.4
Kpol_472.104.214ON83058731.4
CAGL0H04213g4.351ON132158741.4
Kpol_1060.356.256ON27855721.4
TDEL0B069102.598ON43764731.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1475
         (349 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...   683   0.0  
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...   248   2e-80
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...   209   1e-64
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...   180   7e-54
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...   173   2e-51
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...   131   1e-33
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...   130   3e-33
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...   130   6e-33
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)   129   8e-33
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...   129   9e-33
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...   129   1e-32
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...   129   2e-32
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...   124   4e-32
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...   127   5e-32
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....   120   9e-32
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...   126   2e-31
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...   125   2e-31
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...   125   4e-31
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....   121   4e-31
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...   122   2e-30
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...   122   2e-30
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...   120   1e-29
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...   120   1e-29
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...   120   1e-29
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...   119   2e-29
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586    117   6e-29
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...   116   6e-29
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...   117   3e-28
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...   115   5e-28
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...   115   6e-28
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...   114   2e-27
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...   110   6e-27
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...   108   7e-26
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...   106   1e-24
Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375...    82   8e-17
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    81   3e-16
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    80   1e-15
KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa] ...    75   2e-14
Kpol_337.6 s337 (17510..18712) [1203 bp, 400 aa] {ON} (17510..18...    75   2e-14
KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} simi...    73   2e-13
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    73   2e-13
TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa] ...    69   2e-12
SAKL0H26224g Chr8 (2308056..2308739) [684 bp, 227 aa] {ON} some ...    68   2e-12
SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {...    69   2e-12
AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic h...    69   2e-12
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    69   3e-12
KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON} Anc_4...    69   4e-12
Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar...    69   5e-12
TPHA0B00930 Chr2 complement(212983..214026) [1044 bp, 347 aa] {O...    67   1e-11
TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {O...    67   2e-11
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    66   3e-11
CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {...    66   3e-11
ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {...    64   9e-11
Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375...    64   1e-10
YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}  STP3Zinc-...    64   1e-10
Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 ...    64   2e-10
Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375...    63   2e-10
YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}  ...    63   3e-10
Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON...    63   3e-10
Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON...    63   3e-10
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     63   3e-10
Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON...    63   3e-10
NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa] ...    61   2e-09
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    54   2e-07
TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {O...    52   6e-07
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    45   2e-04
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    44   3e-04
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    44   3e-04
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    44   4e-04
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    44   4e-04
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    44   5e-04
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    44   5e-04
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    44   5e-04
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    44   5e-04
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    44   6e-04
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    43   7e-04
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    43   7e-04
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    43   8e-04
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    42   0.001
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    42   0.001
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    42   0.001
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    42   0.002
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    42   0.003
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    40   0.003
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    41   0.004
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    40   0.004
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    41   0.005
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    40   0.005
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    40   0.005
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    40   0.005
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    40   0.005
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    40   0.006
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    40   0.006
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    40   0.007
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    39   0.008
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    40   0.008
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    39   0.009
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    40   0.009
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    40   0.011
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    39   0.013
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    39   0.013
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    39   0.014
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    39   0.014
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    39   0.020
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    39   0.021
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    39   0.028
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    38   0.031
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    38   0.034
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    38   0.038
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    38   0.038
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    38   0.039
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    38   0.040
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    38   0.041
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    37   0.043
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    37   0.044
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    37   0.051
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    36   0.055
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    37   0.055
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    37   0.056
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    37   0.058
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      37   0.062
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    37   0.069
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    37   0.069
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    36   0.071
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    36   0.072
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    37   0.073
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    36   0.074
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    37   0.075
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    37   0.075
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       36   0.084
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    37   0.091
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    37   0.093
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    37   0.099
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    36   0.10 
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    37   0.10 
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    36   0.11 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    36   0.12 
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    36   0.12 
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    36   0.12 
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    36   0.13 
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    36   0.13 
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    36   0.14 
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    36   0.15 
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    35   0.15 
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    35   0.15 
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    36   0.15 
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               36   0.16 
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    36   0.16 
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    36   0.16 
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    35   0.16 
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    36   0.16 
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    36   0.17 
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    36   0.18 
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    35   0.18 
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    35   0.18 
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    35   0.18 
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    35   0.19 
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    35   0.20 
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    35   0.20 
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    35   0.20 
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    35   0.20 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    35   0.21 
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    35   0.21 
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    35   0.21 
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    35   0.22 
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    35   0.23 
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    35   0.23 
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    35   0.25 
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    35   0.26 
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    35   0.27 
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    34   0.27 
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    35   0.28 
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    35   0.28 
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    35   0.28 
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    35   0.30 
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    35   0.30 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    35   0.30 
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    35   0.31 
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    35   0.31 
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    35   0.32 
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    35   0.33 
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    34   0.33 
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    35   0.34 
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    35   0.34 
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    35   0.35 
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               34   0.36 
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    34   0.37 
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    34   0.37 
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    35   0.38 
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    35   0.39 
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    35   0.39 
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    35   0.40 
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    34   0.41 
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    34   0.42 
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    34   0.42 
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    35   0.43 
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    35   0.43 
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    34   0.44 
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    34   0.44 
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    35   0.46 
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    33   0.46 
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    34   0.47 
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    34   0.51 
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    34   0.53 
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    33   0.53 
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    34   0.55 
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    34   0.57 
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    34   0.58 
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    34   0.58 
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    33   0.62 
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    34   0.62 
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    34   0.63 
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    34   0.64 
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    34   0.67 
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    34   0.73 
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      33   0.73 
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    34   0.75 
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    33   0.76 
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    34   0.77 
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    33   0.77 
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    33   0.81 
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    33   0.86 
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    33   0.87 
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    33   0.88 
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    33   0.89 
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    33   0.94 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    33   0.96 
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    33   0.97 
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    33   0.98 
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    33   1.0  
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    33   1.0  
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                33   1.1  
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    33   1.1  
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    33   1.1  
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    33   1.1  
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    33   1.1  
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    33   1.1  
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    33   1.2  
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    33   1.2  
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    33   1.2  
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    33   1.2  
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    33   1.3  
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    33   1.3  
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    33   1.3  
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    33   1.4  
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    33   1.4  
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    33   1.4  
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    33   1.4  
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    32   1.4  
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    33   1.4  
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    33   1.5  
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    33   1.5  
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    32   1.5  
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    33   1.5  
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     32   1.6  
Kpol_460.6 s460 complement(9217..10995) [1779 bp, 592 aa] {ON} c...    33   1.6  
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    32   1.6  
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    33   1.6  
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    32   1.6  
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    33   1.6  
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    33   1.7  
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    32   1.8  
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    33   1.8  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    32   2.0  
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    32   2.1  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    32   2.1  
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    32   2.1  
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    32   2.2  
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    32   2.3  
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    32   2.3  
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    32   2.3  
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    32   2.4  
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    32   2.4  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    32   2.4  
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    32   2.4  
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    32   2.4  
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     32   2.5  
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    32   2.5  
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    31   2.5  
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    32   2.6  
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    32   2.6  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    32   2.6  
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    32   2.7  
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    32   2.7  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    32   2.8  
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    32   2.8  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    32   2.8  
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    32   2.9  
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    32   2.9  
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    32   2.9  
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    31   3.0  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    32   3.0  
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    32   3.1  
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    32   3.1  
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    32   3.2  
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    32   3.3  
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    32   3.3  
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    32   3.3  
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    32   3.4  
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    32   3.4  
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    32   3.6  
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    31   3.7  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    32   3.9  
KLLA0A02629g Chr1 complement(233822..235501) [1680 bp, 559 aa] {...    31   4.0  
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    31   4.0  
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    31   4.0  
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    31   4.1  
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    31   4.1  
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    31   4.2  
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    31   4.3  
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    31   4.6  
SAKL0G16434g Chr7 (1423039..1423932) [894 bp, 297 aa] {ON} some ...    31   4.9  
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    31   5.0  
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    31   5.0  
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    31   5.3  
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    31   5.3  
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    31   5.6  
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    31   5.6  
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    31   5.7  
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    31   5.9  
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    31   6.0  
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    30   6.1  
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    30   6.1  
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    31   6.6  
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     31   6.7  
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    30   6.9  
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    30   6.9  
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    30   7.0  
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             30   7.1  
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    31   7.1  
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    31   7.2  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    31   7.2  
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    30   7.4  
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    30   7.6  
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    30   7.7  
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    30   7.7  
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    30   7.7  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    30   7.8  
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    30   7.8  
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    30   8.1  
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    30   8.8  
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    30   8.8  
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    30   9.1  
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     30   9.4  
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    30   9.9  
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    30   10.0 

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/349 (94%), Positives = 330/349 (94%)

Query: 1   MGYIQFHPVGVPQGNVVSLGLLNEQLQRQRAILPDTDLSNEISQVNSSSTGYYNAAQTNN 60
           MGYIQFHPVGVPQGNVVSLGLLNEQLQRQRAILPDTDLSNEISQVNSSSTGYYNAAQTNN
Sbjct: 1   MGYIQFHPVGVPQGNVVSLGLLNEQLQRQRAILPDTDLSNEISQVNSSSTGYYNAAQTNN 60

Query: 61  SNNSVAVKXXXXXXXXXXXXXXXXXXXSQYACRTDNTSIVQKNELTTTQLWDFLMTADNL 120
           SNNSVAVK                   SQYACRTDNTSIVQKNELTTTQLWDFLMTADNL
Sbjct: 61  SNNSVAVKNYNDYNDYNYRENYNYNDNSQYACRTDNTSIVQKNELTTTQLWDFLMTADNL 120

Query: 121 SLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFKLPGSSSLVSPVNFDDISS 180
           SLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFKLPGSSSLVSPVNFDDISS
Sbjct: 121 SLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFKLPGSSSLVSPVNFDDISS 180

Query: 181 TDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIVCHPPTTESTTIYKCPYCP 240
           TDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIVCHPPTTESTTIYKCPYCP
Sbjct: 181 TDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIVCHPPTTESTTIYKCPYCP 240

Query: 241 SSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGT 300
           SSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGT
Sbjct: 241 SSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGT 300

Query: 301 TKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLEAHKSNL 349
           TKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLEAHKSNL
Sbjct: 301 TKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLEAHKSNL 349

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score =  248 bits (632), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 155/238 (65%), Gaps = 26/238 (10%)

Query: 104 ELTTTQLWDFLMTADNLSLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFKL 163
           E    QLWD LM  D L    AG + Q L A E P    S   EPSSL+E++   F +K 
Sbjct: 52  EANMAQLWDVLMGNDGLP---AGAEVQPLRAAEVPTLRCS--PEPSSLEEDMQGQFQYKD 106

Query: 164 PGSSSLVSPVNFDDISSTDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIVC 223
             S  L SP   D+ +S DS D+ QI +  ++    +   +P+ FA +SA          
Sbjct: 107 LISVHL-SPCTQDEQASGDSSDAPQISETPVDVAVEAPAQSPT-FARDSA---------- 154

Query: 224 HPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKD 283
                    +Y+C YCPS+FKVRGYLTRHLKKHMP K FRCPYWSEDCRCH SGEFSRKD
Sbjct: 155 ---------VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKD 205

Query: 284 TFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIK 341
           TFRTHLKSIHFVYPVGTTKAQR NS GRCAACYE FN+NKDWLKYHIDA  C +FK++
Sbjct: 206 TFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTEFKLR 263

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 26/30 (86%)

Query: 1  MGYIQFHPVGVPQGNVVSLGLLNEQLQRQR 30
          MGYIQFH V +P+ NVVSLG+L++ LQRQ+
Sbjct: 1  MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQ 30

>SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 344

 Score =  209 bits (533), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/365 (37%), Positives = 193/365 (52%), Gaps = 45/365 (12%)

Query: 1   MGYIQFHPVGVPQGNVVSLGLLNEQLQ-----RQRAILP--DTDLSNEISQVNSSSTGYY 53
           MGYIQF  V +PQ N+VSLGLLN+QLQ     R++A+    D D S+ +S    SST + 
Sbjct: 1   MGYIQFDKVNIPQDNLVSLGLLNKQLQKLKDEREQALQVENDNDKSSSVSGQGISSTNF- 59

Query: 54  NAAQTNNSNNSVAVKXXXXXXXXXXXXXXXXXXXSQYACRTDNTSIVQKNELTTTQLWDF 113
                N  +    ++                    +      +T+ ++KN+   ++ W+ 
Sbjct: 60  -----NLGSLDEFLQDEKFGFLLQGVSPSKEHGIEETNNSPGHTTDLEKNDTDASEFWNL 114

Query: 114 LMTADNLSLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFK-LPGSSSLVSP 172
            M        S   DS S +      +  SS  EPS LDEEIC G  F  +  ++    P
Sbjct: 115 FM--------SGQTDSVSSSILTSSLSNQSSIFEPS-LDEEIC-GLRFNTMTTTNLSSPP 164

Query: 173 VNFDDISSTDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHR-----------I 221
                 +ST S +  +++  SL +       TP      S+T    H+           +
Sbjct: 165 STLSSNTSTLSLEDRKLIPTSLSE-------TPCRTVGTSSTSYKVHKKKHMTRSIRQEL 217

Query: 222 VCHPPTTEST--TIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEF 279
           +   P   +    I++CP+CPS+FKV+GYLTRHLKKH+PNK + CPYWS DC+CH +GEF
Sbjct: 218 IALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEF 277

Query: 280 SRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKD-F 338
           SRKDTF+THLKSIHFVYPVG  K+QR+ S GRCAAC++ F SN  WL  HI+   C+  F
Sbjct: 278 SRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLF 337

Query: 339 KIKLE 343
           ++K E
Sbjct: 338 EVKNE 342

>KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 296

 Score =  180 bits (457), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 124/355 (34%), Positives = 168/355 (47%), Gaps = 79/355 (22%)

Query: 1   MGYIQFHPVGVPQGNVVSLGLLNEQLQR-------QRAILPDTDLSNEISQVNSSSTGYY 53
           MGYIQF  V VP+ NVVSLGLL+ QLQ+       + A L D   S   S       G Y
Sbjct: 1   MGYIQFDKVDVPEDNVVSLGLLSRQLQKQQLGQLGELAGLGDEYASEYASGFGREYGGEY 60

Query: 54  NAAQTNNSNNSVAVKXXXXXXXXXXXXXXXXXXXSQYACRTDNTSIVQKNELTTTQLWDF 113
           +    +                             +YA ++ +T++      +  Q W  
Sbjct: 61  SGEYGHEYRG-------------------------EYARKSVHTTL-SATSASIAQTWHA 94

Query: 114 LMTADNLSLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFKLPGSSSLVSPV 173
           L+  D+    S G+                      SLDEE C                V
Sbjct: 95  LLGFDHYDSASDGK---------------------PSLDEETCG---------------V 118

Query: 174 NFDDISSTDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIVCHPPTTESTTI 233
            FD + +  +  S+     S   +   S + P+S AS++       +    P       +
Sbjct: 119 RFDTVPAAIAAASMASSSSSSCTER--SALVPASPASSTECGSAGAK----PAALSGAAM 172

Query: 234 ---YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
              ++C +CPSSFKV+GYLTRH+KKH+  K F+CP+WSEDCRCH SGEFSRKDT++THLK
Sbjct: 173 QQPFQCAFCPSSFKVKGYLTRHMKKHLVTKDFQCPFWSEDCRCHASGEFSRKDTYKTHLK 232

Query: 291 SIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDF-KIKLEA 344
           S+HFVYPVG  K+QR  S GRCAACY  F SN +WL  H++   C+   K+K E 
Sbjct: 233 SVHFVYPVGVAKSQRGQSKGRCAACYHEFASNAEWLLRHVETRQCEALVKLKHEG 287

>Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {ON}
           YDR463W (STP1) - Nuclear-localized protein containing
           zinc finger motifs [contig 272] FULL
          Length = 279

 Score =  173 bits (439), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 120/189 (63%), Gaps = 5/189 (2%)

Query: 150 SLDEEICSGFSFK-LPGSSSLVSPVNFDDISSTDSGDSVQILDISLEDQNYSSNITPSSF 208
           SLDEE C G  F  +P   S  +  +    +S+    SV + D+    Q  +    P+  
Sbjct: 88  SLDEETC-GLRFDTVPSVESFCTDADLAASASSTCSYSV-VDDLDHVHQPGNGTRPPACL 145

Query: 209 ASNSATHENYHRIVCHPPTTE--STTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPY 266
            +  ++  +    +  P      ST +++C +CPS+FKV+GYLTRH+KKH+  K FRCP+
Sbjct: 146 ETQPSSFGDTPSAINTPAAAAAASTAMFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPF 205

Query: 267 WSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWL 326
           WS DCRCH SGEFSRKDT++THLKSIHFVYPVG  K+QR+ S GRCAACY+ F +N +WL
Sbjct: 206 WSVDCRCHASGEFSRKDTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWL 265

Query: 327 KYHIDADNC 335
             H+++ +C
Sbjct: 266 TQHVESRSC 274

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (73%)

Query: 1  MGYIQFHPVGVPQGNVVSLGLLNEQLQRQRAILPDTDLSNEI 42
          MGYIQF  V VP+ NVVSLGLLN+QL+RQR  +   ++  E+
Sbjct: 1  MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMGEIGAEM 42

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score =  131 bits (330), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (68%), Gaps = 4/112 (3%)

Query: 231 TTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYW----SEDCRCHPSGEFSRKDTFR 286
           T  Y C YC + F++RGYLTRH+KKH   KA+ CP++    S++ RCH SG FSR+DT++
Sbjct: 202 TLPYVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGGFSRRDTYK 261

Query: 287 THLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDF 338
           THLKS HF YP G     R  S+G CA C EHF++++ W++ HI+A +CK  
Sbjct: 262 THLKSRHFNYPEGVKPQDRNKSSGACAQCGEHFSTSESWVENHIEAGSCKGL 313

>Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {ON}
           YDR463W (STP1) - Nuclear-localized protein containing
           zinc finger motifs [contig 196] FULL
          Length = 536

 Score =  130 bits (328), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 85/140 (60%), Gaps = 21/140 (15%)

Query: 215 HENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWS----ED 270
           H+   R VCH             YC + F +RGYLTRH+KKH   KA+ CP+++    +D
Sbjct: 151 HKGQKRFVCH-------------YCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKD 197

Query: 271 CRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
            RCH +G FSR+DT++THL+S HFV P G    ++A S+GRCA C EHF +  DW+K H+
Sbjct: 198 ARCHTTGGFSRRDTYKTHLRSRHFVCPKGVRSQEKAKSSGRCAHCNEHFENTDDWIKGHV 257

Query: 331 DADNCK----DFKIKLEAHK 346
           +A  CK     FK+ + + +
Sbjct: 258 EAGECKGLPDGFKVAIRSSR 277

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score =  130 bits (326), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 90/147 (61%), Gaps = 11/147 (7%)

Query: 201 SNITPSSFASNSATHENYHRIVCHPPTTESTTI-------YKCPYCPSSFKVRGYLTRHL 253
           S++TP S + +S    N        PTT +  +       + C YC +SF++RGYLTRH+
Sbjct: 140 SSLTPRSTSISSINRSNTLSTSSRGPTTTNKKLDSKNDGEFVCHYCDASFRIRGYLTRHI 199

Query: 254 KKHMPNKAFRCPYWSE----DCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSA 309
           KKH   KA+ CP++++    D RCH SG FSR+DT++THLK  HF+YP G     R+ S+
Sbjct: 200 KKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRDTYKTHLKVRHFMYPDGVKPQDRSKSS 259

Query: 310 GRCAACYEHFNSNKDWLKYHIDADNCK 336
           G CA C E F + ++W++ HI+  NCK
Sbjct: 260 GHCAQCGEFFENTENWVEQHIETGNCK 286

>Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)
          Length = 542

 Score =  129 bits (325), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 4/107 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYW----SEDCRCHPSGEFSRKDTFRTHL 289
           Y C YC + F++RGYLTRH+KKH   KA+ CP++    S++ RCH SG FSR+DT++THL
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTHL 263

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           KS HF YP G     R  S+G CA C E+F++++ W++ HI+A +CK
Sbjct: 264 KSRHFTYPEGVKPQDRNKSSGACAQCGEYFHTSESWVENHIEAGSCK 310

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score =  129 bits (325), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 77/110 (70%), Gaps = 4/110 (3%)

Query: 231 TTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYW----SEDCRCHPSGEFSRKDTFR 286
           T  Y C YC S F++RGYLTRH+KKH   KA+ CP++    S++ RCH SG FSR+DT++
Sbjct: 201 TLPYICHYCDSRFRIRGYLTRHIKKHAKRKAYHCPFFDGSISQELRCHNSGGFSRRDTYK 260

Query: 287 THLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           THLKS HF YP G     R  S+G CA C E+F+S++ W++ HI+A +CK
Sbjct: 261 THLKSRHFNYPEGIKPQYRNKSSGACAQCGEYFSSSESWVENHIEAGSCK 310

>YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}
           STP2Transcription factor, activated by proteolytic
           processing in response to signals from the SPS sensor
           system for external amino acids; activates transcription
           of amino acid permease genes
          Length = 541

 Score =  129 bits (324), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (66%), Gaps = 4/112 (3%)

Query: 231 TTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYW----SEDCRCHPSGEFSRKDTFR 286
           T  Y C YC + F++RGYLTRH+KKH   KA+ CP++    S++ RCH SG FSR+DT++
Sbjct: 201 TLPYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYK 260

Query: 287 THLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDF 338
           THLKS HF YP G     R  S G C  C EHF++++ W++ HI+A +CK  
Sbjct: 261 THLKSRHFTYPEGVKPQDRNKSPGVCTQCGEHFSTSESWVENHIEAGSCKGL 312

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score =  129 bits (324), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 74/113 (65%), Gaps = 4/113 (3%)

Query: 228 TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC----RCHPSGEFSRKD 283
           TE    + C YC + F++RGYLTRH+KKH   KA+ CP+++ D     RCH SG FSR+D
Sbjct: 267 TEEEGTFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRD 326

Query: 284 TFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           T++THLK+ HF+YP G     R  S+G C+ C E FNS   W+  H+++ NCK
Sbjct: 327 TYKTHLKARHFIYPKGVKPQDRNKSSGHCSQCGEFFNSTDIWISKHLESGNCK 379

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score =  124 bits (310), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 78/124 (62%), Gaps = 8/124 (6%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFSRKDTFRTHL 289
           Y C YC +SF++  YLTRH+KKH   KAF+CP+++E    D RCH SG FSRKDTF+ HL
Sbjct: 13  YICHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHL 72

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK----DFKIKLEAH 345
           K  HF+YP G  + +R+  +G CA C E F+++ DW+  HI    CK     F++K E  
Sbjct: 73  KCRHFIYPKGIKQNERSKYSGNCAQCGEFFHNSNDWMDNHISTGQCKSLPQGFRMKSEVK 132

Query: 346 KSNL 349
              L
Sbjct: 133 SGKL 136

>KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 538

 Score =  127 bits (319), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%), Gaps = 8/121 (6%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC----RCHPSGEFSRKDTFRTHL 289
           + C YC + F +RGYLTRH+KKH   KA+ CPY++ D     RCH +G FSR+DT++THL
Sbjct: 159 FVCHYCNAKFYIRGYLTRHIKKHAVEKAYYCPYFNADAPKDQRCHTTGGFSRRDTYKTHL 218

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK----DFKIKLEAH 345
           +S HF+ P G    ++A S+GRCA C E F+   DW+K H++A  CK     FK+ +++ 
Sbjct: 219 RSRHFICPKGVRSQEKAKSSGRCAHCNEQFDKTDDWIKSHVEAGECKGLPDGFKVAVKSS 278

Query: 346 K 346
           +
Sbjct: 279 R 279

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score =  120 bits (302), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 77/113 (68%), Gaps = 4/113 (3%)

Query: 227 TTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFSRK 282
           T+++  +Y C YC +SF++RGYLTRH+KKH   KA+ CP+++E    + +CH SG FSR+
Sbjct: 28  TSKTNGMYVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPFYNEHQPSELKCHNSGGFSRR 87

Query: 283 DTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           DT++THLKS H +YP G  + +R  S G CA C E F +   W++ HI++  C
Sbjct: 88  DTYKTHLKSRHILYPKGVKQNERNKSTGHCAQCGEFFQNLDHWVETHIESGEC 140

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score =  126 bits (317), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 77/125 (61%), Gaps = 7/125 (5%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWS----EDCRCHPSGEFSRKDT 284
           E+   + C YC + FK+RGYLTRH+KKH   KA+ CP+W      + RCH +G FSR+D+
Sbjct: 237 ETDMKFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDS 296

Query: 285 FRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLEA 344
           ++THL+S HF+YP       R NS G C  C +HF+S  +W+++HI+   C+     L  
Sbjct: 297 YKTHLRSRHFIYPDNVKNVDRVNSHGHCGRCKKHFDSTNEWIEHHIENRECEAI---LPT 353

Query: 345 HKSNL 349
            K NL
Sbjct: 354 FKGNL 358

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score =  125 bits (314), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 73/106 (68%), Gaps = 4/106 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC----RCHPSGEFSRKDTFRTHL 289
           + C YC + F++RGYLTRH+KKH   KA+ CP+++ D     RCH +G FSR+DT++THL
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHL 242

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           K+ HFVYP G     RA S+G C+ C + F +  DW+K HI++ +C
Sbjct: 243 KARHFVYPKGMKPQDRAKSSGHCSQCGQSFTTADDWIKNHIESGDC 288

>KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {ON}
           Anc_5.586 YHR006W
          Length = 600

 Score =  125 bits (314), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 4/115 (3%)

Query: 225 PPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFS 280
           P        Y C YC ++FK+RGYLTRH+KKH  +KA+ CP+++     + +CH +G FS
Sbjct: 190 PAVASDVGTYICHYCDATFKIRGYLTRHIKKHAIDKAYHCPFFNATLGTELKCHNTGGFS 249

Query: 281 RKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           R+DT++THLK+ HFVYP G   + R+ S G CA C ++F S   W+K HI+   C
Sbjct: 250 RRDTYKTHLKTRHFVYPNGVKPSDRSKSNGTCAHCGDYFESADKWIKEHIEGGQC 304

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score =  121 bits (303), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 225 PPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFS 280
           P ++ +   + C YC + F++RGYLTRH+KKH   KAFRCP++      D +CHPSG FS
Sbjct: 52  PSSSSAMEPFVCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFS 111

Query: 281 RKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           R+DT++THLK  H +YP G   + R  S G C AC E+  S  +W++ HI++  C+
Sbjct: 112 RRDTYKTHLKVKHVLYPPGVRPSDRNRSGGHCTACGEYTESLHEWVEQHIESGACQ 167

>TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.586
           YHR006W
          Length = 484

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 71/108 (65%), Gaps = 4/108 (3%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWS----EDCRCHPSGEFSRKDTFRTH 288
           ++ C YC + F++RGYLTRH+KKH   KA+ CP++S    +D RCH SG FSR+DT++TH
Sbjct: 137 VFVCHYCDAKFRIRGYLTRHIKKHAIQKAYHCPFFSAEAPQDMRCHNSGGFSRRDTYKTH 196

Query: 289 LKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           L++ HF YP G     R  S+G C+ C + F +   W++ HI+   CK
Sbjct: 197 LRARHFTYPKGVKPQDRTKSSGHCSQCEQFFENTDQWVEQHIETGECK 244

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score =  122 bits (307), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 74/118 (62%), Gaps = 4/118 (3%)

Query: 225 PPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYW----SEDCRCHPSGEFS 280
           P    S  ++ C YC + FK+RGYLTRH+KKH   KA+ CP++      + RCH SG FS
Sbjct: 195 PEGANSEGLFVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGFS 254

Query: 281 RKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDF 338
           R+DT++THL++ HF+YP G   ++R  SAG C  C + F +   W++ HI++  C+  
Sbjct: 255 RRDTYKTHLRTRHFIYPKGVKPSERNKSAGNCGQCGQSFENTDKWVEQHIESGECRGL 312

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 72/106 (67%), Gaps = 4/106 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFSRKDTFRTHL 289
           Y C YC + F++RGYLTRH+KKH   KA+ CP+++     + RCH +G FSR+DT++THL
Sbjct: 162 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTYKTHL 221

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           KS HF+YP G    +R  S+G C+ C E F + + W++ HI+  +C
Sbjct: 222 KSRHFIYPKGIKTQERNKSSGNCSHCGEWFENTEKWIENHIETGDC 267

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 76/107 (71%), Gaps = 4/107 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFSRKDTFRTHL 289
           + C YC ++F++RGYLTRH+KKH   KA+ CP+++     D RCH SG FSR+DT++THL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           K+ H +YP G     R  S+G CA C E+F++ +++++ HI++ +CK
Sbjct: 220 KARHVLYPKGVRPQDRNKSSGHCAQCGEYFSTIENFVESHIESGDCK 266

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score =  120 bits (300), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 70/107 (65%), Gaps = 4/107 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYW----SEDCRCHPSGEFSRKDTFRTHL 289
           + C YC + F++RGYLTRH+KKH   KAF CP++    S   +CH +G FSR+DT++ HL
Sbjct: 99  FVCHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHL 158

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           K  HF+YP G     R  S+G C+ C E F + + W++ HI++ NCK
Sbjct: 159 KIRHFMYPTGVKPRDRHKSSGYCSQCGEFFKTTERWVETHIESGNCK 205

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score =  119 bits (299), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 76/107 (71%), Gaps = 4/107 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFSRKDTFRTHL 289
           + C YC ++F++RGYLTRH+KKH   KA+ CP+++     D RCH SG FSR+DT++THL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           K+ H +YP G     R  S+G CA C E+F++ +++++ HI++ +CK
Sbjct: 220 KARHVLYPKGVKPQDRNKSSGHCAQCGEYFSTIENFVENHIESGDCK 266

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score =  117 bits (294), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 72/107 (67%), Gaps = 4/107 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSED----CRCHPSGEFSRKDTFRTHL 289
           Y C +C + F+++GYLTRHLKKH   KA+ CP+++ D     RCH SG FSR+DT++THL
Sbjct: 100 YVCHHCNAQFRIKGYLTRHLKKHATEKAYTCPFFNTDSPPELRCHNSGGFSRRDTYKTHL 159

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           KS H ++P G     R  S G CA C + F+S ++W++ HI++  CK
Sbjct: 160 KSRHILFPKGVRPQDRNKSVGHCAQCGDFFDSCENWVETHIESGKCK 206

>NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa]
           {ON} Anc_5.586
          Length = 367

 Score =  116 bits (290), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 72/106 (67%), Gaps = 4/106 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSED----CRCHPSGEFSRKDTFRTHL 289
           Y C YC + F+++GYLTRH+KKH   KA+ CP++S +     RCH SG FSR+DT++THL
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTHL 155

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           K+ H ++P G    +R  S G CA C E F + ++W++ HI++ +C
Sbjct: 156 KARHILFPKGIRPHERNKSKGHCAQCGEFFTNFENWVELHIESGDC 201

>Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR461C
          Length = 562

 Score =  117 bits (292), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 4/106 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWS----EDCRCHPSGEFSRKDTFRTHL 289
           Y C YC + F++RGYLTRH+KKH   KA+ CP+++     + RCH +G FSR+DT++THL
Sbjct: 163 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNGCSPPETRCHTTGGFSRRDTYKTHL 222

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           +S HF+YP G     R  S G CA C + F +   W++ HI++  C
Sbjct: 223 RSRHFIYPEGVKTQDRNRSPGHCAHCGKWFENTSKWIEKHIESGYC 268

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score =  115 bits (289), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 75/107 (70%), Gaps = 4/107 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWS----EDCRCHPSGEFSRKDTFRTHL 289
           + C YC ++F++RGYLTRH+KKH   KA+ CP+++     D RCH SG FSR+DT++THL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           K+ H +Y  G     R  S+G CA C E+F++ +++++ HI++ +CK
Sbjct: 220 KARHVLYSKGVKPQDRNKSSGHCAQCGEYFSTIENFVESHIESGDCK 266

>AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR463W
           (STP1)
          Length = 544

 Score =  115 bits (289), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 69/106 (65%), Gaps = 4/106 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFSRKDTFRTHL 289
           + C YC + F++RGYLTRH+KKH   KA+ CP+++     + RCH +G FSR+DT++THL
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTHL 211

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           +S HF+YP G     R  S G CA C + F +   W++ HI++  C
Sbjct: 212 RSRHFIYPEGVKTQDRGKSCGHCAHCGKWFENTSTWIEKHIESGYC 257

>Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463W
           (REAL)
          Length = 516

 Score =  114 bits (285), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 73/107 (68%), Gaps = 4/107 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWS----EDCRCHPSGEFSRKDTFRTHL 289
           + C YC ++F++RGYLTRH+KKH   KA+ CP+++     D RCH SG FSR+DT++THL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIRKAYHCPFFNCATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           K+ H +Y  G     R  S+G CA C E+F   +++++ HI++ +CK
Sbjct: 220 KARHVLYSKGVKPQDRNKSSGHCAQCGEYFPVIENFVENHIESGDCK 266

>CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some
           similarities with uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 359

 Score =  110 bits (276), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 71/106 (66%), Gaps = 4/106 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSE----DCRCHPSGEFSRKDTFRTHL 289
           + C YC + FK+RGYLTRH+KKH   KA+ CPY++E    D RCH +G FSR+DT++ H+
Sbjct: 41  FVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTYKAHM 100

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           K+ H +YP G    +R  S+G C+ C E+  + + W++ H+++  C
Sbjct: 101 KTRHIMYPSGVKSQERFKSSGHCSHCGEYSPNVEFWVEDHVESGQC 146

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score =  108 bits (271), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWS----EDCRCHPSGEFSRKDTFRTHL 289
           + C YC + FK+RGYLTRH++KH   KAF+CPY++    +  RCH +G FSR+DTF+ HL
Sbjct: 122 FICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGFSRRDTFKIHL 181

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCK 336
           KS HF++P       + +S G C  C   F+  + W+  H+    C+
Sbjct: 182 KSRHFIFPNDVKVPNKTHSGGNCKHCQGSFSDIETWINDHVGLRRCR 228

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score =  106 bits (265), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 4/106 (3%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSED----CRCHPSGEFSRKDTFRTHL 289
           + C YC + F++RGYLTRH+KKH   KA+ CP+++       RCH SG FSR+DT++TH+
Sbjct: 198 FVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSRRDTYKTHM 257

Query: 290 KSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           K+ H +YP G   A R  S+G CA C         +++ HI++  C
Sbjct: 258 KARHLIYPEGVNFASRNESSGHCAKCGGFIAKAATYVEDHIESGQC 303

>Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375W
           (STP3) - Involved in pre-tRNA splicing [contig 72] FULL
          Length = 304

 Score = 81.6 bits (200), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 68/150 (45%), Gaps = 34/150 (22%)

Query: 208 FASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHM---------- 257
           F +N +TH + H              +KCP C   F     L RH K+H           
Sbjct: 154 FYANLSTHRSSH-------LQPENKPHKCPVCGRGFTRHNDLLRHRKRHWKDEDNSCSSY 206

Query: 258 -PNKA-FRCPYWSE----DCR-----------CHPSGEFSRKDTFRTHLKSIHFVYPVGT 300
            PN+  FRCPY S     D R           CH +G+FSR DTF+ HL+++HF YP GT
Sbjct: 207 NPNQGTFRCPYKSRIAYPDSRSKGLASLGTTSCHATGKFSRCDTFKNHLRALHFEYPPGT 266

Query: 301 TKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
            K  R +  G+C  C + F S   WL  H+
Sbjct: 267 RKKDRGHVPGKCKHCGQEFASVNTWLNTHV 296

>NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4.222
          Length = 435

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 72/176 (40%), Gaps = 58/176 (32%)

Query: 206 SSFASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKH----MP--- 258
           S + +N  TH+  H +    P       +KCP C   F     L RH K+H    +P   
Sbjct: 258 SGYYANLTTHKATHLVPEDRP-------HKCPICQRGFGRNNDLIRHQKRHWKDALPEGK 310

Query: 259 -------------------------NKAFRCPYWS-------------------EDCRCH 274
                                    + A++CPY S                   E   CH
Sbjct: 311 KASGGGAVANGTESAHDHLKSLHQLSGAYKCPYNSTLIQLDMEMYPFKKQLINFETLNCH 370

Query: 275 PSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           PSG FSR DTF+ HLK++HF YP GT K +R +  G C  C +HF + + WL  H+
Sbjct: 371 PSGIFSRGDTFKNHLKALHFQYPAGTKKTERNSVPGNCKHCGKHFANVEVWLHDHV 426

>KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q7LH06 Saccharomyces
           cerevisiae YDL048C STP4 Protein involved in pre-tRNA
           splicing and in uptake of branched-chain amino acids
          Length = 558

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 69/167 (41%), Gaps = 48/167 (28%)

Query: 208 FASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNK------- 260
           F SN +TH++ H        +  T  +KC  C   F     L RH K H  +        
Sbjct: 392 FFSNLSTHKSTH-------LSPETRPFKCEVCSRGFARSNDLIRHKKLHWKDDLNQESMD 444

Query: 261 -------------AFRCPYWS---------------------EDCRCHPSGEFSRKDTFR 286
                         ++CP+ S                     E   CH +G FSR DTF+
Sbjct: 445 FVEKLKCLHELKGTYKCPFNSNLINLDLKLKGSDMKTADLPFETSNCHSTGVFSRCDTFK 504

Query: 287 THLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDAD 333
            HLK++HF YP GT K  RAN AG C  C + F S + WLK H+  +
Sbjct: 505 NHLKALHFEYPPGTKKKDRANVAGHCKHCGQKFESIETWLKDHVGKE 551

>KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa]
           {ON} Anc_4.222 YDL048C
          Length = 342

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 70/162 (43%), Gaps = 44/162 (27%)

Query: 206 SSFASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNK----- 260
           ++F +N +TH++ H        T     ++CP C   F     L RH K+H  ++     
Sbjct: 179 NNFYANLSTHKSTH-------LTPEDRPHRCPVCERGFARNNDLIRHKKRHWKDEINVAG 231

Query: 261 -------------AFRCPYWS-------------------EDCRCHPSGEFSRKDTFRTH 288
                         F+CPY S                   E   CH +G FSR DTF+ H
Sbjct: 232 EHDQLKSLHQIKGTFKCPYNSTLIQLDMEIYPFKSKSLNFETSNCHQTGIFSRCDTFKNH 291

Query: 289 LKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           LK++HF YP GT K  R   +GRC  C   F++ + WL  H+
Sbjct: 292 LKALHFEYPPGTKKKDRNVVSGRCKHCGLKFDNVEVWLSDHV 333

>Kpol_337.6 s337 (17510..18712) [1203 bp, 400 aa] {ON}
           (17510..18712) [1203 nt, 401 aa]
          Length = 400

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 8/100 (8%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           +KCPY  +  K+   +  H K          P   E   CH +G FSR DT++ HLK++H
Sbjct: 303 FKCPYNSTLIKLDMDIYPHKKG--------TPLKFESSNCHATGVFSRCDTYKNHLKALH 354

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDAD 333
           F YP GT KA R+   G+C  C ++F +   WLK HI+ D
Sbjct: 355 FEYPPGTKKANRSIVPGKCKHCGKNFPNVDVWLKTHIERD 394

>KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q7LH06 Saccharomyces cerevisiae YDL048C STP4
           Protein involved in pre-tRNA splicing and in uptake of
           branched-chain amino acids
          Length = 414

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 46/97 (47%), Gaps = 19/97 (19%)

Query: 256 HMPNKAFRCPYWS-------------------EDCRCHPSGEFSRKDTFRTHLKSIHFVY 296
           H     F CPY S                   E   CH +G FSR DTF+ HLK++HF Y
Sbjct: 312 HRIKGTFHCPYKSALIALDMDAYPGKRRELAFETSECHQTGVFSRCDTFKNHLKALHFEY 371

Query: 297 PVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDAD 333
           P GT K  R++  GRC  C  HF +  +WL  H+  D
Sbjct: 372 PPGTKKKDRSSVPGRCKQCGRHFANVGEWLSSHVGKD 408

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 208 FASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKH 256
           F +N +TH++ H +  H P       +KCP C   F     L RH K+H
Sbjct: 196 FYANLSTHKSSHMLPEHKP-------HKCPVCARGFTRNNDLLRHRKRH 237

>TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.222
           YDL048C
          Length = 613

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (53%), Gaps = 10/102 (9%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           YKCPY  +  K+   +        P KA    +  +   CH +G FSR DTF+ HLK++H
Sbjct: 517 YKCPYNSTLVKLDMEM-------YPFKAKSLNF--QTLNCHQTGVFSRCDTFKNHLKALH 567

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           F YP GT +  R  S+G+C  C ++F +   WL YH+   NC
Sbjct: 568 FEYPQGTKRKDRLFSSGKCKHCGQNFPNVDVWLNYHV-GKNC 608

>TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa]
           {ON} Anc_4.222 YDL048C
          Length = 350

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 7/100 (7%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           YKCPY  S  ++   +  H   H+           E   CH +G FSR DTF+ HLK++H
Sbjct: 252 YKCPYNSSLIQLDMEIYPHKINHLK-------LNFETSNCHQTGVFSRCDTFKNHLKALH 304

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDAD 333
           F YP GT K  R   +GRC  C   F +   WLK H+  +
Sbjct: 305 FEYPPGTKKKDRLLVSGRCKHCGLKFKNVDVWLKTHVGKE 344

>SAKL0H26224g Chr8 (2308056..2308739) [684 bp, 227 aa] {ON} some
           similarities with uniprot|Q7LH06 Saccharomyces
           cerevisiae YDL048C STP4 Protein involved in pre-tRNA
           splicing and in uptake of branched-chain amino acids
          Length = 227

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (51%), Gaps = 8/102 (7%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           +KCP+      +   L      + P    + P ++ DC  H +G F+R DT++ HLK++H
Sbjct: 124 FKCPFNIHQINLDNKL------YHPQNLGQVPMYATDC--HKTGLFTRVDTYKYHLKALH 175

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNC 335
           F YP G +K  R  S G C  C+ HF S   WL+ HI +  C
Sbjct: 176 FEYPDGISKQDREFSPGHCKHCHAHFPSVHAWLQDHILSHKC 217

>SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {ON}
           similar to uniprot|Q7LH06 Saccharomyces cerevisiae
           YDL048C STP4 Protein involved in pre-tRNA splicing and
           in uptake of branched-chain amino acids
          Length = 358

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 51/97 (52%), Gaps = 8/97 (8%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           +KCP+  +  K+   L  + KK         P+  E   CH +G FSR DTF+ HLK++H
Sbjct: 261 FKCPFNSNLIKLDMELYPYKKKD------SLPF--ETSNCHATGIFSRCDTFKNHLKALH 312

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           F YP GT K  R +  GRC  C E F +   WL  H+
Sbjct: 313 FEYPPGTKKKDRGSVHGRCKHCGEKFANVDIWLNEHV 349

>AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR375W (STP3) and
           YDL048C (STP4)
          Length = 319

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 51/97 (52%), Gaps = 9/97 (9%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           YKCP+  +  K+   +        P K  R  +  E   CH +G FSR DT++ HLK++H
Sbjct: 223 YKCPFNSTLIKLDMEI-------YPTKGRRLAF--ETSNCHITGVFSRCDTYKNHLKALH 273

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           F YP GT K +RA   GRC  C   F++   WL  H+
Sbjct: 274 FEYPPGTKKRERAKIHGRCKHCGMKFDNVDMWLNEHV 310

>NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4.222
          Length = 489

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 47/99 (47%), Gaps = 20/99 (20%)

Query: 252 HLKK-HMPNKAFRCPYWS-------------------EDCRCHPSGEFSRKDTFRTHLKS 291
           HLK  H     F CPY +                   E   CH SG FSR+DTF+ HLK+
Sbjct: 382 HLKALHQMKGTFECPYNATLIQLDMELYPYKQQLINFEAIHCHKSGIFSRRDTFKNHLKA 441

Query: 292 IHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           +HF+YP GT K +R    G C  C   F++   WL  H+
Sbjct: 442 LHFLYPPGTKKNERNKVPGTCKHCGMKFDNVDIWLSEHV 480

>KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON}
           Anc_4.222 YDL048C
          Length = 377

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 67/176 (38%), Gaps = 60/176 (34%)

Query: 208 FASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKH----------- 256
           + +N +TH++ H        T     ++CP C   F     L RH K+H           
Sbjct: 200 YYANLSTHKSTH-------LTPEDRPHRCPVCQRGFARNNDLIRHKKRHWKDVDQPIGDD 252

Query: 257 --------MPNKA---------------FRCPYWS-------------------EDCRCH 274
                    P +A               F+CP+ S                   E   CH
Sbjct: 253 TDPVSGEKFPEQATEHDKLIALHRIKGTFKCPFNSTLIQLDMEMYPFKSRPLLFETSNCH 312

Query: 275 PSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
            +G FSR DTF+ HLK++HF YP GT K +R    GRC  C   F +   WL  H+
Sbjct: 313 STGVFSRCDTFKNHLKALHFEYPPGTKKKERTVVPGRCRNCGVKFPNVDTWLTEHV 368

>Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar to
           Ashbya gossypii AFR588W
          Length = 431

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 47/94 (50%), Gaps = 19/94 (20%)

Query: 256 HMPNKAFRCPYWS-------------------EDCRCHPSGEFSRKDTFRTHLKSIHFVY 296
           HM    ++CP+ S                   E   CH +G FSR DT++ HLK++HF Y
Sbjct: 329 HMIQGTYKCPFNSALIKLDMEIYPTKDRQLLFETSNCHITGVFSRCDTYKNHLKALHFEY 388

Query: 297 PVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           P GT K +RAN  GRC  C   F++   WL  HI
Sbjct: 389 PPGTKKRERANIHGRCKHCGMKFDNVDVWLNEHI 422

>TPHA0B00930 Chr2 complement(212983..214026) [1044 bp, 347 aa] {ON}
           Anc_4.222 YDL048C
          Length = 347

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 70/177 (39%), Gaps = 61/177 (34%)

Query: 208 FASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHM---------- 257
           F +N +TH++ H        T     +KC  C   F     L RH K+H           
Sbjct: 169 FYANLSTHKSTH-------LTPENRPHKCDICGHGFARNNDLIRHKKRHWKDEFSLGTGT 221

Query: 258 ----------PNK---------------AFRCPYWS-------------------EDCRC 273
                     P+K               +FRCP+ S                   +   C
Sbjct: 222 NTQYKYSDTEPSKEIKFDQLKSLHSIKGSFRCPFNSTLIKLDMELYSYKSMDLNFDTSNC 281

Query: 274 HPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           H +G FSR DT++ HLK++HF YP GT K  R+  AGRC  C + F +   WLK H+
Sbjct: 282 HQTGIFSRCDTYKNHLKALHFEYPPGTKKVNRSAVAGRCRHCGKKFPNVNYWLKNHV 338

>TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {ON}
           Anc_4.222 YDL048C
          Length = 399

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 66/179 (36%), Gaps = 63/179 (35%)

Query: 208 FASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNK------- 260
           F +N +TH++ H        T     +KCP C   F     L RH K+H  ++       
Sbjct: 219 FYANLSTHKSTH-------LTPEDRPHKCPICRRGFARNNDLIRHKKRHWKDEILENNSS 271

Query: 261 ------------------------------AFRCPYWS-------------------EDC 271
                                          F+CP+ +                   E  
Sbjct: 272 VENSDADEHVSSHQHLDEHDQLKSLHQIKGTFKCPFNAALIQLDMEIYPYKSKPLNFETS 331

Query: 272 RCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
            CH +G FSR DTF+ HLK++HF YP GT K  R   AGRC  C   F +   WL  H+
Sbjct: 332 SCHQTGVFSRCDTFKNHLKALHFEYPPGTKKRDRTVVAGRCKHCGIKFANVDTWLNEHV 390

>CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some
           similarities with uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4 or uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3
          Length = 515

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%)

Query: 273 CHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           CHP+G FSR DTF+ HLK++HF YP  T + QR+   G+C  C   F +   WL  H+
Sbjct: 448 CHPTGVFSRCDTFKNHLKALHFEYPQKTKREQRSQVPGKCKHCGMKFPNVDIWLNQHV 505

>CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {ON}
           some similarities with uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3 or uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4
          Length = 451

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 272 RCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHID 331
           +CH +G FSR DTF+ HLK++HF YP GT +++R+  +G+C  C   F +  +W+  H+ 
Sbjct: 384 QCHKTGVFSRCDTFKNHLKALHFEYPQGTRRSERSFVSGKCKHCNMSFANVDEWINEHV- 442

Query: 332 ADNC 335
             NC
Sbjct: 443 GKNC 446

>ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q7LH06 Saccharomyces cerevisiae
           YDL048C STP4 Protein involved in pre-tRNA splicing and
           in uptake of branched-chain amino acids
          Length = 343

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 37/66 (56%)

Query: 265 PYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKD 324
           P   E   CH +G FSR DTF+ HLK++HF YP GT K  R+   GRC  C   F +   
Sbjct: 269 PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKRDRSVVPGRCKHCGLRFANVDL 328

Query: 325 WLKYHI 330
           WL  HI
Sbjct: 329 WLNEHI 334

>Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375W
           (REAL)
          Length = 341

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 63/139 (45%), Gaps = 18/139 (12%)

Query: 192 ISLEDQNYSSNITPSSFASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTR 251
           +S  D +    +TP +  ++ A  ++ H+I            +KCP+  +  ++   +  
Sbjct: 212 VSPNDDDAHEKMTPMNSVTDYAQLKSLHQI---------KGTFKCPFNSTLIQLDMDMYP 262

Query: 252 HLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGR 311
           +  K         P   E   CH +G FSR DTF+ HLK++HF YP GT K  R    GR
Sbjct: 263 YKLK---------PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGR 313

Query: 312 CAACYEHFNSNKDWLKYHI 330
           C  C   F +   WL  H+
Sbjct: 314 CKHCGLKFENVDVWLNEHV 332

>YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}
           STP3Zinc-finger protein of unknown function, possibly
           involved in pre-tRNA splicing and in uptake of
           branched-chain amino acids
          Length = 343

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 63/139 (45%), Gaps = 18/139 (12%)

Query: 192 ISLEDQNYSSNITPSSFASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTR 251
           +S  D +    +TP +  ++ A  ++ H+I            +KCP+  +  ++   +  
Sbjct: 214 VSPNDDDTHEKMTPMNSVTDYAQLKSLHQI---------KGTFKCPFNSTLIQLDMDMYP 264

Query: 252 HLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGR 311
           +  K         P   E   CH +G FSR DTF+ HLK++HF YP GT K  R    GR
Sbjct: 265 YKLK---------PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGR 315

Query: 312 CAACYEHFNSNKDWLKYHI 330
           C  C   F +   WL  H+
Sbjct: 316 CKHCGLKFENVDVWLNEHV 334

>Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 aa]
           {ON} YLR375W (REAL)
          Length = 344

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 75/168 (44%), Gaps = 29/168 (17%)

Query: 163 LPGSSSLVSPVNFDDISSTDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIV 222
           L  S +L SP N  D++    G SV     S  D +    +TP +  ++ A  ++ H+I 
Sbjct: 197 LSQSGALSSPAN--DVT----GGSV-----SPTDDDTHEKMTPMNSVTDYAQLKSLHQI- 244

Query: 223 CHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRK 282
                      +KCP+  +  +        L   M    F+ P   E   CH +G FSR 
Sbjct: 245 --------KGTFKCPFNSTLIQ--------LDMDMYPYKFK-PLNFETSNCHQTGVFSRC 287

Query: 283 DTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           DTF+ HLK++HF YP GT K  R    GRC  C   F +   WL  H+
Sbjct: 288 DTFKNHLKALHFEYPPGTKKKDRNIVPGRCKHCGLKFENVDVWLNEHV 335

>Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375W
           (REAL)
          Length = 344

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (54%)

Query: 265 PYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKD 324
           P   E   CH +G FSR DTF+ HLK++HF YP GT K  R    GRC  C   F +   
Sbjct: 270 PLNFETSNCHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGRCKHCGLKFENVDV 329

Query: 325 WLKYHI 330
           WL  H+
Sbjct: 330 WLNEHV 335

>YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}
           STP4Protein containing a Kruppel-type zinc-finger
           domain; has similarity to Stp1p, Stp2p, and Stp3p;
           predicted to be a transcription factor
          Length = 490

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 53/123 (43%), Gaps = 32/123 (26%)

Query: 227 TTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPY-------------------W 267
           ++E T + K     S +K++G             AF+CPY                   +
Sbjct: 372 SSEETKLLKKNQLKSLYKIKG-------------AFKCPYNSTLINLDMEVYPHKSRSLY 418

Query: 268 SEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLK 327
            E   CH +G FSR DTF+ HLK++HF YP  T K  R    G+C  C   F +   WL 
Sbjct: 419 FEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGVVPGKCKHCGLQFPNVDVWLN 478

Query: 328 YHI 330
            H+
Sbjct: 479 KHV 481

>Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON}
           YDL048C (REAL)
          Length = 503

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 42/89 (47%), Gaps = 19/89 (21%)

Query: 261 AFRCPY-------------------WSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTT 301
           AF+CPY                   + E   CH +G FSR DTF+ HLK++HF YP  T 
Sbjct: 406 AFKCPYNSTLINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTK 465

Query: 302 KAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           K  R+   G+C  C   F +   WL  H+
Sbjct: 466 KEDRSIVPGKCKHCGLQFPNVDVWLNKHV 494

>Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON}
           YDL048C (REAL)
          Length = 486

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 42/89 (47%), Gaps = 19/89 (21%)

Query: 261 AFRCPY-------------------WSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTT 301
           AF+CPY                   + E   CH +G FSR DTF+ HLK++HF YP  T 
Sbjct: 389 AFKCPYNSTLINLDMEVYPHKTQSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTK 448

Query: 302 KAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           K  R+   G+C  C   F +   WL  H+
Sbjct: 449 KEDRSIVPGKCKHCGLQFPNVDVWLNKHV 477

>NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222
          Length = 478

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 64/185 (34%), Gaps = 66/185 (35%)

Query: 208 FASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNK------- 260
           + +N +TH++ H        T     +KCP C   F     L RH K+H  ++       
Sbjct: 295 YYANLSTHKSTH-------LTPEDRPHKCPICERGFARNNDLIRHKKRHWKDEFKKDKMK 347

Query: 261 ---------------------------------AFRCPYWSE------------------ 269
                                            AF+CPY                     
Sbjct: 348 LLLSETGSTDLSTKEQKEILKKNQLKALHQIRGAFKCPYNKALIDLDMETYPYKSKNLNF 407

Query: 270 -DCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKY 328
               CH +G FSR DT++ HLK++HF YP  T K  RA   G C  C   F +   WL  
Sbjct: 408 TPLNCHQTGVFSRCDTYKNHLKALHFEYPPKTKKEDRAVMPGNCKHCGMKFENVDVWLNK 467

Query: 329 HIDAD 333
           H+  D
Sbjct: 468 HVGKD 472

>Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON}
           YDL048C (REAL)
          Length = 489

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 41/89 (46%), Gaps = 19/89 (21%)

Query: 261 AFRCPY-------------------WSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTT 301
           AF+CPY                   + E   CH +G FSR DTF+ HLK++HF YP  T 
Sbjct: 392 AFKCPYNSTLINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTK 451

Query: 302 KAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           K  R    G+C  C   F +   WL  H+
Sbjct: 452 KEDRGIVPGKCKHCGLQFPNVDVWLNKHV 480

>NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa]
           {ON} Anc_4.222
          Length = 560

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 46/100 (46%), Gaps = 8/100 (8%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           +KCPY  S   +   +    KK + N             CH +G FSR DT++ HLK++H
Sbjct: 463 FKCPYNKSLINLDMEIYPEKKKEVLNFT--------PLSCHQTGVFSRCDTYKNHLKALH 514

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDAD 333
           F YP  T K  R    GRC  C   F +   WL  H+  +
Sbjct: 515 FEYPPRTRKEDRGVVPGRCKHCGMGFVNVDVWLNKHVGKE 554

>Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON}
           complement(4365..5300) [936 nt, 312 aa]
          Length = 311

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 57/166 (34%), Gaps = 50/166 (30%)

Query: 208 FASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNK------- 260
           F SN  TH+  H      P       +KCP C   F       RH K+H+          
Sbjct: 144 FFSNLTTHKRTHLAPEDKP-------FKCPSCNKGFSRNFDFLRHQKEHVQKDLLTAKDP 196

Query: 261 ----------------AFRCPYWSEDCR-------------------CHPSGEFSRKDTF 285
                            FRCPY  +                      CH +G F RKDT 
Sbjct: 197 LMSEHDRLVALHNTGDIFRCPYNEKLINIDLELYKHKFQPKTAYVKNCHSTGLFLRKDTL 256

Query: 286 RTHLKSIHFVYP-VGTTKAQRANSAGRCAACYEHFNSNKDWLKYHI 330
           R HL++ HF Y  +   K +   S G C AC + F +   W   H+
Sbjct: 257 RNHLRAHHFNYADLTLPKRKSITSPGNCGACGKWFENTTTWTDEHV 302

>TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 54/145 (37%), Gaps = 48/145 (33%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKH-----------------MPNKA-----------FRCP 265
           + C  CP SF       RH K+H                 + NK+           FRCP
Sbjct: 193 FHCDICPKSFSRNFDFLRHKKEHVQKALIQDVNSQDAYSDLTNKSKLTQLHNIGNVFRCP 252

Query: 266 Y-------------------WSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVGTTKA-QR 305
           Y                    S+   CH +G F RKDT R HL+S HF Y        ++
Sbjct: 253 YNEKVIDLDLSLHKYKVKPASSQVANCHHNGMFFRKDTLRNHLRSHHFDYDKKELSVKEK 312

Query: 306 ANSAGRCAACYEHFNSNKDWLKYHI 330
           A ++GRC  C E   + K W   H+
Sbjct: 313 ACASGRCRFCNEWHENAKIWADEHV 337

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           I+KC +C  +FK + +L RHL  H   K + CP+      CH      RKD    HLK  
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW------CH--SRHKRKDNLSQHLKLK 336

Query: 293 H 293
           H
Sbjct: 337 H 337

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           I+KC +C  +FK + +L RHL  H   K + CP+      CH      RKD    HLK  
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW------CH--SRHKRKDNLSQHLKLK 235

Query: 293 H 293
           H
Sbjct: 236 H 236

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFV 295
           CP C  SFK + +L RHL  H P + F CP+    C      +  RKD    H+K  H  
Sbjct: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW----CLS----KHKRKDNLLQHMKLKHTE 245

Query: 296 Y 296
           Y
Sbjct: 246 Y 246

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           +++C YC  SFK   +L RHL  H P + + CP+    C      +  RKD    HLK  
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPW----CLS----KHKRKDNLLQHLKLK 610

Query: 293 H 293
           H
Sbjct: 611 H 611

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P+++   I++C +C  SFK + +L RHL  H   + F CP+    C         RKD  
Sbjct: 330 PSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW----CL----SRQKRKDNL 381

Query: 286 RTHLKSIHFVY 296
             H+K  H  Y
Sbjct: 382 LQHMKLKHTNY 392

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P+++   I++C +C  SFK + +L RHL  H   + F CP+    C         RKD  
Sbjct: 319 PSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW----CL----SRQKRKDNL 370

Query: 286 RTHLKSIHFVY 296
             H+K  H  Y
Sbjct: 371 LQHMKLKHTNY 381

>CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} similar
           to uniprot|Q12139 Saccharomyces cerevisiae YPR022c
          Length = 1162

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 13/104 (12%)

Query: 197 QNYSSNITPSSFASNSATHENYHRIVCHPPTTESTTI-------YKCPY--CPSSFKVRG 247
           +N+S N+TP S +  S+  E +  +V     T S  +       YKCP+  C  SF  + 
Sbjct: 3   ENHSYNVTPESVSLPSSGGEVH--VVRKRSKTVSMVVGEDGQYRYKCPHPTCDKSFSRQE 60

Query: 248 YLTRHLKKHMPNKAFRCPYWSEDCRCHPSGE-FSRKDTFRTHLK 290
           +L+RH   H P + F+C Y S      P G+ F R+D    H K
Sbjct: 61  HLSRHKLNHWPKEIFKCHYVSP-LSGQPCGKTFVRRDLLNRHEK 103

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 8/68 (11%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTH 288
           ES   Y+C  C   F+ + +L RHL  H   K F CP+ S   +        RKD    H
Sbjct: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHK--------RKDNLLQH 352

Query: 289 LKSIHFVY 296
           LK  H  Y
Sbjct: 353 LKLKHTQY 360

>KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8.130
           YPR022C
          Length = 1206

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 225 PPTTESTTIYKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPYW--SEDCRCHPSGEFS 280
           P    S   Y CP+  C  +F  + +L RH   H P + FRCPY   + D RC+ +  F 
Sbjct: 61  PEDGTSVDRYVCPHPDCNKTFSRQEHLARHKLNHWPKEIFRCPYVFPNTDIRCNKT--FV 118

Query: 281 RKDTFRTHLK 290
           RKD    H K
Sbjct: 119 RKDLLGRHAK 128

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 10/73 (13%)

Query: 226 PTTESTT--IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKD 283
           PT+ ST   I++C +C  SFK + +L RHL  H   + F CP+    C         RKD
Sbjct: 318 PTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW----CL----SRQKRKD 369

Query: 284 TFRTHLKSIHFVY 296
               H+K  H  Y
Sbjct: 370 NLLQHMKLKHTNY 382

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 8/76 (10%)

Query: 231 TTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           T I+ C  C  SF+ + +L RHL  H   + F CP+    C         RKD    H+K
Sbjct: 350 TLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW----CL----SRHKRKDNLLQHMK 401

Query: 291 SIHFVYPVGTTKAQRA 306
             H  Y V   K   A
Sbjct: 402 LKHSNYLVIELKKNNA 417

>Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar to
           Ashbya gossypii AFL136W
          Length = 460

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPV 298
           C  SF    +L RH++KH   K F+C    E C       FSR D  + H +S+H++  +
Sbjct: 28  CDMSFTRAEHLARHIRKHTGEKPFQC----EVCNRF----FSRIDNLKQHRESVHWIPTI 79

Query: 299 GTTKAQR 305
            TT+++R
Sbjct: 80  STTRSKR 86

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 8/71 (11%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P+++   I++C +C  SFK + +L RHL  H   + F CP+    C         RKD  
Sbjct: 338 PSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW----CL----SRQKRKDNL 389

Query: 286 RTHLKSIHFVY 296
             H+K  H  Y
Sbjct: 390 LQHMKLKHTNY 400

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           ++KC  C  SFK + +L RHL  H P + F CP+    C      +  RKD    H+K  
Sbjct: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW----C----LSKHKRKDNLLQHMKLK 184

Query: 293 HFVY 296
           H  Y
Sbjct: 185 HTDY 188

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 47/118 (39%), Gaps = 20/118 (16%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P +     +KCPYC   F    +L  H++ H+  K F+C Y  +         F++    
Sbjct: 479 PKSRGVKQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGK--------RFTQGGNL 530

Query: 286 RTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
           RTH++      P              C  C + F+   +   + +  +N K F+ KL+
Sbjct: 531 RTHVRLHTGERPY------------ECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLD 576

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 8/70 (11%)

Query: 227 TTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFR 286
           ++ S  I+KC  C  SFK R +L RHL  H   + + CP+    C         RKD   
Sbjct: 429 SSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW----CLS----RHKRKDNLL 480

Query: 287 THLKSIHFVY 296
            H+K  H  Y
Sbjct: 481 QHMKLKHSNY 490

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 47/118 (39%), Gaps = 20/118 (16%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P ++    ++CPYC   F    +L  H++ H+  K F C +  +         F++    
Sbjct: 515 PKSKGVKQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGK--------RFTQGGNL 566

Query: 286 RTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
           RTH++ +H                  C  C   F+   +   + +  DN K F+ KL+
Sbjct: 567 RTHIR-LH-----------TGEKPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLD 612

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRH-LKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           + C YCP  FK + +L RH L  H+  K F CP   ++        FSR D    H+K+
Sbjct: 400 FGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKN--------FSRSDNLNQHIKT 450

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 36/90 (40%), Gaps = 18/90 (20%)

Query: 227 TTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT-- 284
           T E    Y C  C   F   G+L RH + H   K   CP+  E C+      FSR+D   
Sbjct: 178 TLEQRRKYLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPF--EGCK----QRFSRQDNCL 231

Query: 285 --FRTHLKSIHFVYPVGTTKAQRANSAGRC 312
             +RTH K+  F           AN  G C
Sbjct: 232 QHYRTHFKNFTFT--------NLANKKGTC 253

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           I++C  C  SFK + +L RHL  H   + F CP     C C    +  RKD    HLK  
Sbjct: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----C-C--LSKHKRKDNLIQHLKLK 390

Query: 293 HFVY 296
           H  Y
Sbjct: 391 HLDY 394

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query: 220 RIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEF 279
           +++ +  +      +KCP C   FK + +L RH+  H   + + CP+    C        
Sbjct: 99  QVLLYNSSMNEMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPW----C----ISRH 150

Query: 280 SRKDTFRTHLKSIH 293
            RKD    H+K  H
Sbjct: 151 KRKDNLLQHMKLKH 164

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 47/116 (40%), Gaps = 30/116 (25%)

Query: 213 ATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCR 272
           A H+  HR   H P +       CP+CP +F     L +H++ H   + F C Y    CR
Sbjct: 533 APHQGTHR---HKPCS-------CPHCPKTFSTDDILAQHIRTHSGERPFHCHY----CR 578

Query: 273 CHPSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKY 328
                +FS   + R H+++     P+             C  C + FN + +  K+
Sbjct: 579 ----KQFSTSSSLRVHIRTHTGEKPLS------------CTVCGKRFNESSNLSKH 618

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           I++C  C   FK + +L RHL  H  N+ + CP+    C      +  RKD    H+K  
Sbjct: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW----CL----SKHKRKDNLLQHMKLK 304

Query: 293 H 293
           H
Sbjct: 305 H 305

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P   + T Y CP CP SF+   +L RH   H  +  F+C  W   C+     E  R+D  
Sbjct: 242 PKPPTMTSYPCPQCPKSFQRSAWLKRHSITHTNSHPFKC-VW---CK----SEHKRRDNM 293

Query: 286 RTHLKSIHF 294
             H+K  H 
Sbjct: 294 FKHMKLKHM 302

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 44/119 (36%), Gaps = 20/119 (16%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P       ++CPYC   F    +L  H++ H+  K F+C Y  +         F++    
Sbjct: 478 PKARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGK--------RFTQGGNL 529

Query: 286 RTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLEA 344
           RTH++      P              C  C   F+   +   + +  +N K F  KL+ 
Sbjct: 530 RTHVRLHTGEKPY------------ECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDG 576

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 44/119 (36%), Gaps = 20/119 (16%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P       ++CPYC   F    +L  H++ H+  K F+C Y  +         F++    
Sbjct: 495 PKARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGK--------RFTQGGNL 546

Query: 286 RTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLEA 344
           RTH++      P              C  C   F+   +   + +  +N K F  KL+ 
Sbjct: 547 RTHVRLHTGEKPY------------ECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDG 593

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 47/118 (39%), Gaps = 20/118 (16%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P +     ++CPYC   F    +L  H++ H+  K F+C Y  +         F++    
Sbjct: 483 PKSRGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGK--------RFTQGGNL 534

Query: 286 RTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
           RTH++      P              C  C + F+   +   + +  +N K F+ KL+
Sbjct: 535 RTHVRLHTGERPY------------ECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLD 580

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  + + I+ CPYC   FK + +L RH +  HM  K F C   ++        +FSR D 
Sbjct: 626 PFNDPSKIFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNK--------KFSRSDN 677

Query: 285 FRTHLKS 291
              H+K+
Sbjct: 678 LAQHIKT 684

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 4/91 (4%)

Query: 220 RIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEF 279
           R    P  +E    Y C +C   FK    L  H+  H  NK + CPY  E+CR   + + 
Sbjct: 244 RYNSGPSISEEIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPY--EECRKSFNAKS 301

Query: 280 SRKDTFRTHLK--SIHFVYPVGTTKAQRANS 308
           +    ++ H K  S  ++ P G   A++  S
Sbjct: 302 NMLRHYKLHFKLNSGAYILPNGEISAEKPTS 332

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 10/68 (14%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT---- 284
           E    Y C  C   F   G+L RH + H   K   CP+  E C+      FSR+D     
Sbjct: 167 EQRRKYICKTCSKGFTTSGHLARHNRIHTGEKNHECPF--EGCQ----QRFSRQDNCLQH 220

Query: 285 FRTHLKSI 292
           +RTH KSI
Sbjct: 221 YRTHFKSI 228

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 15/125 (12%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P       ++CPYC   F    +L  H++ H+  K F+C Y  +         F++    
Sbjct: 532 PKARGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGK--------RFTQGGNL 583

Query: 286 RTHLKSIHFVYPVGTTK-AQRANSAGRCAACYEHFNSNKDWLKYHIDADNC-KDFKI--K 341
           RTH +      P    K  +R +  G  AA   H  ++++   YH   D C K F     
Sbjct: 584 RTHTRLHTGEKPYSCEKCGKRFSRKGNLAA---HMLTHENLKPYHCKLDGCSKSFTQLGN 640

Query: 342 LEAHK 346
           L+AH+
Sbjct: 641 LKAHQ 645

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 37/84 (44%), Gaps = 21/84 (25%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHL 289
           ++C  C  +F   G+L+RH K H   K + CP+  E C       FSR D     +RTHL
Sbjct: 212 FQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPH--ESC----GQRFSRHDNCIQHYRTHL 265

Query: 290 KSIHFVYPVGTTKAQRANSAGRCA 313
           K           K QR    G+ A
Sbjct: 266 K-----------KKQRQAKKGKVA 278

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 12/77 (15%)

Query: 217 NYHRIVCHPPTTESTTIYKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCH 274
           N H    H PT +S+  Y+C +  C   F  R  L RH+K H   K F+CP        H
Sbjct: 501 NEHIEAIHVPTGQSS--YQCRWDGCTKHFAQRQKLLRHIKVHTGYKPFKCP--------H 550

Query: 275 PSGEFSRKDTFRTHLKS 291
            S  FS +D    H+++
Sbjct: 551 CSKTFSTEDILSQHIRT 567

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 19/95 (20%), Positives = 40/95 (42%), Gaps = 20/95 (21%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           +KCP+C  +F     L++H++ H   + F+C +  +         F+   + R H+++  
Sbjct: 546 FKCPHCSKTFSTEDILSQHIRTHSGERPFKCQFCDK--------RFTTSSSLRIHIRTHT 597

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKY 328
              P+             C  C + FN + +  K+
Sbjct: 598 GEKPLA------------CNVCGKRFNESSNLSKH 620

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           ++C  CP  FK + +L RHL  H   + F CP+    C    +    R+D    H+K  H
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW----C----NSRHKRRDNLLQHMKLKH 585

Query: 294 F 294
            
Sbjct: 586 V 586

>TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8.130
           YPR022C
          Length = 1077

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 234 YKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           +KCP+  C  SF  + +L+RH   H P + F+C Y   +     +  F RKD    H+K
Sbjct: 45  FKCPHPACDKSFTRQEHLSRHKLNHWPKEIFKCSYVFPNTGLACNRTFVRKDLLARHVK 103

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           ++C  C  SFK + +L RHL  H   K F CP+    C+        RKD    H+K  H
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW----CQS----RHKRKDNLLQHMKLKH 309

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTH 288
           ++ ++Y+C  C  SF+   +L RHL  H   + + CP      +C    +  RKD    H
Sbjct: 382 DTPSVYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP------KC--VSKHKRKDNLLQH 433

Query: 289 LKSIHFVY 296
           LK  H  +
Sbjct: 434 LKLKHTAF 441

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 23/124 (18%)

Query: 170 VSPVNFDDISSTDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIVCHPPTTE 229
           ++PV++D    +   +SV +   +       S + P+  A N+      H    H P  +
Sbjct: 577 LTPVSYDPSEGSTGDESVHVCKWA-----NCSQVFPNPEALNN------HIESQHIPRGQ 625

Query: 230 STTIYKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           S+  Y+C +  C  SF  R  L RHLK H   K F+CP        H + +FS +D  + 
Sbjct: 626 SS--YQCSWDTCSKSFTQRQKLLRHLKVHSGYKPFKCP--------HCTKKFSTEDILQQ 675

Query: 288 HLKS 291
           H+++
Sbjct: 676 HIRT 679

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 26/128 (20%)

Query: 177 DISSTDSGDSVQI----LDISLEDQNYSSNITPSSFASNSATHENYHRIVCHPP------ 226
           D+++  SG +  +    L +SL     +++ +PSS+ SNS   +        PP      
Sbjct: 577 DVANLSSGSAGSVALNPLQLSL-----TASTSPSSYTSNSNPKQRKTHSFSKPPRNSKSS 631

Query: 227 --TTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKD 283
               E    +KC  C  +F+   +L RH++  H   + F C Y  +        +FSR D
Sbjct: 632 SPVEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDK--------KFSRSD 683

Query: 284 TFRTHLKS 291
               HLK+
Sbjct: 684 NLSQHLKT 691

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 8/64 (12%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           YKC +C   F   G L  H++ H   K F C + S+         FSRK     HL +  
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSK--------RFSRKGNLTAHLVTHE 467

Query: 294 FVYP 297
            V P
Sbjct: 468 KVRP 471

>NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8.130
          Length = 1207

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 231 TTIYKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTH 288
           T  Y CP+  C  SF  + +L+RH   H P + F CP+   +     +  F RKD    H
Sbjct: 39  TERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRH 98

Query: 289 LK 290
            K
Sbjct: 99  QK 100

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 10/88 (11%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK--- 290
           +KCP C   F    +  RH++ H   K   CP       C+ S  FSR D  + H+K   
Sbjct: 16  FKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILG----CNKS--FSRTDELKRHMKVHP 69

Query: 291 -SIHFVYPVGTTKAQRANSAGRCAACYE 317
            S H ++   TT    +NS     +  +
Sbjct: 70  ASTHNLHSTSTTSLNISNSTMSMTSLLQ 97

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y+C  C  SFK R +  RHL  H   K + CP+    C+        R+D    H+K+ H
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW----CQS----RHKRRDNLFQHMKTKH 440

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 11/68 (16%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSG-EFSRKD 283
           P  ++T  + C YC   FK + +L RH++  HM  K F          CH  G +FSR D
Sbjct: 495 PILDATKHFGCEYCDRRFKRQEHLKRHVRSLHMCEKPF---------GCHICGKKFSRSD 545

Query: 284 TFRTHLKS 291
               H+K+
Sbjct: 546 NLNQHIKT 553

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  ++T  + C YC   FK + +L RH++  HM  K    PY  + C      +FSR D 
Sbjct: 452 PALDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEK----PYGCDIC----GKKFSRSDN 503

Query: 285 FRTHLKS 291
              H+K+
Sbjct: 504 LNQHIKT 510

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 10/60 (16%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC-RCHPSGEFSRKDTFRTHLKSIHF 294
           CP C   F  R +L RH + H   K F C +    C RC     F+R+D    H   +HF
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVF----CGRC-----FARRDLIIRHQNKLHF 93

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y+C  C   FK R +L RHL  H   + + CP+    C         R+D    H+K  H
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW----CLS----RHKRRDNLLQHMKLKH 451

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C  +F    + TRH + H   K F C      C    +  F R+D  + H++++H
Sbjct: 8   YICSFCAKAFSRSEHRTRHERSHTGVKPFTCTV----C----AHSFVRRDLLQRHIRTVH 59

Query: 294 FVYPVGTTKAQ 304
             + +  TK Q
Sbjct: 60  RTFLLQCTKEQ 70

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
            Y+C  C  +FK   +L RH   H   K F C +    C    SG++ RKD    H++  
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNW----C----SGKYKRKDNLVQHIRKK 374

Query: 293 H 293
           H
Sbjct: 375 H 375

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 29/64 (45%), Gaps = 10/64 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHL 289
           Y C  C   F   G+L RH + H   K   CPY  + C    +  FSR D     +RTHL
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQHYRTHL 227

Query: 290 KSIH 293
           K  H
Sbjct: 228 KKEH 231

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHL 289
           Y C  C       G+L RH + H   K   CPY  E C    +  FSR D     +RTHL
Sbjct: 301 YICRVCSKGLTTSGHLARHYRIHTGEKNHFCPY--EGC----NQRFSRHDNCIQHYRTHL 354

Query: 290 K 290
           K
Sbjct: 355 K 355

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 35.8 bits (81), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 29/67 (43%), Gaps = 10/67 (14%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT---- 284
           E    Y C  C   F   G+L RH + H   K   CP+  E C       FSR D     
Sbjct: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPF--EGC----GQRFSRHDNCVQH 148

Query: 285 FRTHLKS 291
           +RTHLK+
Sbjct: 149 YRTHLKT 155

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 51/130 (39%), Gaps = 22/130 (16%)

Query: 163 LPGSSSLVSPVNFDDISSTDSGDSVQILDISLEDQNYSSNITPSSFASNSATHENYHRIV 222
           LPG+ + ++P   D             LD +  D    S + P+     S +  +     
Sbjct: 446 LPGAGTFITPAVLDG------------LDNTSYDMRNPSYVVPTRRKRASVSKASRASKS 493

Query: 223 CHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSR 281
             P   E    +KC  C  +F+   +L RH++  H  ++ F C Y  +        +FSR
Sbjct: 494 SSP-LEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDK--------KFSR 544

Query: 282 KDTFRTHLKS 291
            D    HLK+
Sbjct: 545 SDNLSQHLKT 554

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           +Y+C  C  SFK + +  RHL  H   K + CP+    C+        R+D    H+K+ 
Sbjct: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW----CQS----RHKRRDNLFQHMKTK 438

Query: 293 H 293
           H
Sbjct: 439 H 439

>KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {ON}
           Anc_4.214 YGR067C
          Length = 1010

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C YC  +F    + TRH + H   K F+C    + C       F R+D  + H+K++H
Sbjct: 8   YICSYCAKAFSRSEHRTRHERSHTGYKPFQCKI-CQHC-------FVRRDLVQRHIKTVH 59

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 10/59 (16%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHLK 290
           C  C + F   G+L+RH + H   K   CP+  E C    + +FSR D     +RTHLK
Sbjct: 212 CKICSTGFTTSGHLSRHNRIHTGEKNHSCPF--EGC----NQKFSRHDNCLQHYRTHLK 264

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 32/82 (39%), Gaps = 11/82 (13%)

Query: 215 HENYHRIVCHPPTT---ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC 271
           H N   +   PP         +Y C  C  +FK R +L RHL  H   + + CP+    C
Sbjct: 366 HSNQRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW----C 421

Query: 272 RCHPSGEFSRKDTFRTHLKSIH 293
                    R+D    H+K  H
Sbjct: 422 LS----RHKRRDNLLQHMKLKH 439

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 36.6 bits (83), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 7/68 (10%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           P   +T  +KCP C   F    +  RH++ H   K ++C +   DC       FSR D  
Sbjct: 9   PLDNNTRPFKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSF--PDC----PKSFSRTDEL 62

Query: 286 RTHLKSIH 293
           + H K IH
Sbjct: 63  KRHSK-IH 69

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 29/66 (43%), Gaps = 10/66 (15%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT---- 284
           E    Y C  C   F   G+L RH + H   K   CPY  + C    +  FSR D     
Sbjct: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQH 222

Query: 285 FRTHLK 290
           +RTHLK
Sbjct: 223 YRTHLK 228

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 29/66 (43%), Gaps = 10/66 (15%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT---- 284
           E    Y C  C   F   G+L RH + H   K   CPY  + C    +  FSR D     
Sbjct: 170 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQH 223

Query: 285 FRTHLK 290
           +RTHLK
Sbjct: 224 YRTHLK 229

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  +++  + C +C   FK + +L RH++  HM  K    PY  E C      +FSR D 
Sbjct: 346 PILDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEK----PYGCEIC----GKKFSRSDN 397

Query: 285 FRTHLKS 291
              H+K+
Sbjct: 398 LNQHIKT 404

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 29/66 (43%), Gaps = 10/66 (15%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT---- 284
           E    Y C  C   F   G+L RH + H   K   CPY  + C    +  FSR D     
Sbjct: 169 EQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPY--KGC----TQRFSRHDNCLQH 222

Query: 285 FRTHLK 290
           +RTHLK
Sbjct: 223 YRTHLK 228

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           C  SF    +L RH++KH   K F+CP   +         FSR D  + H +S+H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLK--------FFSRVDNLKQHRESVH 95

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           + T  + C YC   FK + +L RH++  H+  K F C      C  H    FSR D    
Sbjct: 393 DGTKQFSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHI----CDKH----FSRSDNLNQ 444

Query: 288 HLKS 291
           H+K+
Sbjct: 445 HIKT 448

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTH 288
           E T++Y+C  C   F+   +L RH   H  ++ F CP+    C+     +  R+D    H
Sbjct: 114 EVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW----CK----SKHKRRDNLFKH 165

Query: 289 LKSIHF 294
           +K  H 
Sbjct: 166 IKLKHM 171

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 8/58 (13%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           C  C   FK + +L RHL  H   + F CP+    C      +  RKD    H+K  H
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCPW----CLS----KHKRKDNLLQHMKLKH 528

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 11/68 (16%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSG-EFSRKD 283
           P  +++  + C YC   FK + +L RH++  H+  K    PY      CH  G +FSR D
Sbjct: 410 PILDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEK----PYG-----CHLCGKKFSRSD 460

Query: 284 TFRTHLKS 291
               HLK+
Sbjct: 461 NLSQHLKT 468

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  ++T  + C +C   FK + +L RH++  HM  K    PY  + C      +FSR D 
Sbjct: 506 PALDATKPFGCEFCERRFKRQEHLKRHVRSLHMGEK----PYGCDIC----GKKFSRSDN 557

Query: 285 FRTHLKS 291
              H+K+
Sbjct: 558 LNQHIKT 564

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 11/68 (16%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSG-EFSRKD 283
           P  +++  + C +C   FK + +L RH++  HM  K F          CH  G +FSR D
Sbjct: 338 PILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPF---------DCHICGKKFSRSD 388

Query: 284 TFRTHLKS 291
               H+K+
Sbjct: 389 NLNQHIKT 396

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 47/125 (37%), Gaps = 26/125 (20%)

Query: 222 VCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSR 281
           V  P +      ++CPYC   F    +L  H++ H+  K F+C Y  +         F++
Sbjct: 496 VEKPKSAHGIKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGK--------RFTQ 547

Query: 282 KDTFRTHLKSIHFVYPVGTTKAQRANSAGR---CAACYEHFNSNKDWLKYHIDADNCKDF 338
               RTH               QR ++  R   C  C + F+   +   + +     K +
Sbjct: 548 GGNLRTH---------------QRLHTGERPYSCELCGKKFSRKGNLAAHFLTHQKLKPY 592

Query: 339 KIKLE 343
             KL+
Sbjct: 593 VCKLD 597

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  +   ++ C +C   FK + +L RH++  HM  K F C    +        +FSR D 
Sbjct: 295 PILDPLKLFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEK--------KFSRSDN 346

Query: 285 FRTHLKS 291
              H+K+
Sbjct: 347 LNQHIKT 353

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 10/68 (14%)

Query: 227 TTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT-- 284
           T E    ++C  C   F   G+LTRH K H   K  +CP+    C       FSR D   
Sbjct: 261 TIERRRKHQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPH--RGCNL----WFSRNDNSL 314

Query: 285 --FRTHLK 290
             ++THLK
Sbjct: 315 QHYQTHLK 322

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 10/63 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHL 289
           Y C  C   F   G+L RH + H   K   CPY  E C       F+R D     ++THL
Sbjct: 402 YLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPY--EGC----GQRFNRHDNCLQHYKTHL 455

Query: 290 KSI 292
           K +
Sbjct: 456 KRL 458

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  +++  + C +C   FK + +L RH++  HM  K F C    +        +FSR D 
Sbjct: 332 PILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGK--------KFSRSDN 383

Query: 285 FRTHLKS 291
              H+K+
Sbjct: 384 LNQHVKT 390

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 228 TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           T  T  + C +C  +F    + TRH + H   K F C    + C    S  F R+D  + 
Sbjct: 6   TGKTKRHFCSFCNKAFSRSEHKTRHERSHAGVKPFEC----QVC----SHSFVRRDLLQR 57

Query: 288 HLKSIHFVYPVGTTKA 303
           H++++H +  +  T A
Sbjct: 58  HIRTVHRILLLRDTGA 73

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + CP C   F  + +L RH + H   K F C +     RC     F+R+D    H + +H
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 124

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           C  SF    +L RH++KH   K F+CP   +         FSR D  + H +S+H
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLK--------FFSRVDNLKQHRESVH 95

>Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)
          Length = 631

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 10/88 (11%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPV 298
           C +  + R ++T HL+ H+P K F C      C    S +F R    + HLK IH     
Sbjct: 191 CTTKTEKRDHITSHLRVHVPLKPFGC----STC----SKKFKRPQDLKKHLK-IHLES-G 240

Query: 299 GTTKAQRANSAGRCAACYEHFNSNKDWL 326
           G  K +R    G       + NS+KD L
Sbjct: 241 GILKRKRGPKIGSKRTSKRNKNSSKDTL 268

>NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {ON}
           
          Length = 263

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHLK 290
           C  C   F   G+L+RH + H   K   CPY  + C    + +FSR D     +RTHLK
Sbjct: 208 CKTCSMGFTTSGHLSRHNRIHTGEKNHSCPY--KGC----NQKFSRHDNCLQHYRTHLK 260

>KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON}
           Anc_8.486 YDR253C
          Length = 185

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 57/142 (40%), Gaps = 29/142 (20%)

Query: 164 PGSSSLVSPVNFDDISSTDSGDSVQI-------------LDISLEDQNYSSNITPSSFAS 210
           P    L+S +  ++++ T+  D++ +             LD+   D   +S+I  SS   
Sbjct: 26  PVIKELLSRITLNNVNKTEPNDNIPLPTPNSNTYRYDNTLDVFNRDHAATSDINGSS--- 82

Query: 211 NSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSED 270
            +   +N ++   H  T E    YKC  C   F     L RH + H+P     CP   + 
Sbjct: 83  -TEKTKNSNKRSKHNKTRE----YKCLKCDLKFSRSSDLRRHERAHLPILPNICPQCGKG 137

Query: 271 CRCHPSGEFSRKDTFRTHLKSI 292
                   F+RKD  + H  ++
Sbjct: 138 --------FARKDALKRHFDTL 151

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + CP C   F  + +L RH + H   K F C +     RC     F+R+D    H + +H
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 131

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 43/110 (39%), Gaps = 20/110 (18%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           ++CPYC   F    +L  H++ H+  K F+C +  +        +F++    RTH     
Sbjct: 302 HECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQFCGK--------KFTQGGNLRTH----- 348

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
                   +        +C +C   F+   +   + +   N K F  KL+
Sbjct: 349 -------QRLHTGEKPYQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLD 391

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  E    +KC  C  +F+   +L RH++  H   + F C Y  +        +FSR D 
Sbjct: 612 PIEEDEKPFKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDK--------KFSRSDN 663

Query: 285 FRTHLKS 291
              HLK+
Sbjct: 664 LSQHLKT 670

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 44/115 (38%), Gaps = 20/115 (17%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTH 288
           E +  ++CPYC   F    +L  H++ H+  K F+C +  +         F++    RTH
Sbjct: 595 EGSKQHECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGK--------RFTQGGNLRTH 646

Query: 289 LKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
                        +        RC  C + F+   +   + +   + K F  KL+
Sbjct: 647 ------------QRLHTGEKPYRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLD 689

>SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 322

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 8/59 (13%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYP 297
           C  +F    +L RH++KH   K F+C     D  CH    FSR D  + H +S+H + P
Sbjct: 30  CHMTFTRAEHLARHIRKHTGEKPFQC-----DI-CH--RFFSRVDNLKQHKESVHSIIP 80

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + CP C   F  + +L RH + H   K F C +     RC     F+R+D    H + +H
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 134

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 48/125 (38%), Gaps = 26/125 (20%)

Query: 222 VCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSR 281
           V  P ++     ++CPYC   F    +L  H++ H+  K F+C +  +         F++
Sbjct: 397 VEKPKSSHGMKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGK--------RFTQ 448

Query: 282 KDTFRTHLKSIHFVYPVGTTKAQRANSAGR---CAACYEHFNSNKDWLKYHIDADNCKDF 338
               RTH               QR ++  +   C  C + F+   +   + +     K +
Sbjct: 449 GGNLRTH---------------QRLHTGEKPYNCEMCGKRFSRKGNLAAHALTHQKLKPY 493

Query: 339 KIKLE 343
             KLE
Sbjct: 494 ICKLE 498

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y CP C   F  + +L RH + H   K F C +     RC     F+R+D    H   +H
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 108

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           C  SF    +L RH++KH   K F+CP   +         FSR D  + H +S+H
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLK--------FFSRVDNLKQHRESVH 98

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           ++T  + C +C   FK + +L RH++  HM  K F C   +++        FSR D    
Sbjct: 390 DATKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKN--------FSRSDNLNQ 441

Query: 288 HLKS 291
           H+K+
Sbjct: 442 HVKT 445

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           C  SF    +L RH++KH   K F+CP   +         FSR D  + H +S+H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLK--------FFSRVDNLKQHRESVH 95

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 11/63 (17%)

Query: 234 YKC---PYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           Y+C   P C  SF    +L RH++KH   K F+C      C       FSR D  R H  
Sbjct: 19  YRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQC----NIC----LKFFSRIDNLRQHQS 70

Query: 291 SIH 293
           S+H
Sbjct: 71  SVH 73

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 11/63 (17%)

Query: 234 YKC---PYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           Y+C   P C  SF    +L RH++KH   K F+C      C       FSR D  R H  
Sbjct: 19  YRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQC----NIC----LKFFSRIDNLRQHQS 70

Query: 291 SIH 293
           S+H
Sbjct: 71  SVH 73

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  +++  + C +C   FK + +L RH++  HM  K F C    +        +FSR D 
Sbjct: 250 PIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDK--------KFSRSDN 301

Query: 285 FRTHLKS 291
              H+K+
Sbjct: 302 LNQHIKT 308

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 14/73 (19%)

Query: 227 TTESTTI---YKC---PYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFS 280
           T E+ ++   Y+C   P C  SF    +L RH++KH   K F+C      C       FS
Sbjct: 9   TKENASVKRNYRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQC----NIC----LKFFS 60

Query: 281 RKDTFRTHLKSIH 293
           R D  R H  S+H
Sbjct: 61  RIDNLRQHQSSVH 73

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 11/63 (17%)

Query: 234 YKC---PYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           Y+C   P C  SF    +L RH++KH   K F+C      C       FSR D  R H  
Sbjct: 19  YRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQC----NICL----KFFSRIDNLRQHQS 70

Query: 291 SIH 293
           S+H
Sbjct: 71  SVH 73

>KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa]
           {ON} some similarities with uniprot|Q12139 Saccharomyces
           cerevisiae YPR022C Hypothetical ORF
          Length = 230

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query: 234 YKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           Y CP+  C  +F    +L RH   H P + FRC Y   D     +  F RKD    H +
Sbjct: 18  YVCPHPDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQR 76

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHL 289
           ++C  C   F   G+LTRH + H   K   CP+  E C       FSR D     ++THL
Sbjct: 161 FECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPF--EGCNL----RFSRNDNSLQHYKTHL 214

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 234 YKC---PYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           +KC   P C  SF    +L RH+++H   K F+C    + C  +    FSR D  + H  
Sbjct: 25  FKCTGYPGCEMSFSRAEHLARHIRRHTGEKPFKC----DICLKY----FSRIDNLKQHKD 76

Query: 291 SIH 293
           ++H
Sbjct: 77  TVH 79

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C  C   F    +  RHLK H   K ++C Y   +C    S +FSR D    H K +H
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYL--NC----SKKFSRSDELNRHSK-VH 71

Query: 294 FVYPVGTTKAQRA 306
                G+ K +++
Sbjct: 72  HSRANGSIKRKKS 84

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  E    +KC  C  +F+   +L RH++  H   + F C +  +        +FSR D 
Sbjct: 613 PMDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDK--------KFSRSDN 664

Query: 285 FRTHLKS 291
              HLK+
Sbjct: 665 LSQHLKT 671

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + C  C  +F  + +L RHL+ H   K F+C    +D        F+R+D    H   +H
Sbjct: 49  FLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKD--------FTRRDLLIRHSNKLH 100

>SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]
           {ON} similar to gnl|GLV|KLLA0E13497g Kluyveromyces
           lactis KLLA0E13497g and weakly similar to YPR022C
           uniprot|Q12139 Saccharomyces cerevisiae YPR022C
           Hypothetical ORF
          Length = 950

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 234 YKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPY-WSED-CRCHPSGEFSRKDTFRTHL 289
           Y CP+  C  SF  + +L+RH   H P + FRC Y + ED   C+ +  F R+D    H 
Sbjct: 16  YVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRT--FVRRDLLVRHE 73

Query: 290 K 290
           K
Sbjct: 74  K 74

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 226 PTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P  +S+  + C YC   FK + +L RH++  HM  K + C    +        +FSR D 
Sbjct: 378 PILDSSKQFGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDK--------KFSRSDN 429

Query: 285 FRTHLKS 291
              H+K+
Sbjct: 430 LSQHIKT 436

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           ++ C +C  +F  + +LTRH + H   K F C        C  +  F+R+D    H + I
Sbjct: 151 LFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNL------CFKN--FTRRDLLIRHAQKI 202

Query: 293 HFVYPVGTTKAQRANSA 309
           H    +G +  +R+ +A
Sbjct: 203 H-GGDIGQSYKRRSTTA 218

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHLK 290
           C  C  +F   G+L+RH K H   K + CP+  E C       FSR D      +THL+
Sbjct: 160 CKVCTMAFTTSGHLSRHNKIHTGEKKYVCPF--EGC----GQRFSRHDNCVQHHKTHLR 212

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           +KC  C  +F+   +L RH++  H   + F C Y  +        +FSR D    HLK+
Sbjct: 590 FKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEK--------KFSRSDNLSQHLKT 640

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 9/71 (12%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + CP C   F  + +L RH   H   K + C +     RC     F+R+D    H + +H
Sbjct: 104 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 155

Query: 294 FVYPVGTTKAQ 304
               VGT  AQ
Sbjct: 156 AAL-VGTGDAQ 165

>Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C
           (ZAP1) - Metalloregulatory protein involved in
           zinc-responsive transcriptional regulation [contig 224]
           FULL
          Length = 711

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 49/122 (40%), Gaps = 29/122 (23%)

Query: 235 KCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHF 294
           KC +C  +F  +  L +H++ H   K ++C +  +         F+   + R H+++   
Sbjct: 607 KCVHCLKTFSTQDILQQHMRTHSGEKPYKCSHCGKG--------FATSSSLRIHIRTHTG 658

Query: 295 VYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKY------HIDADNCK---DFKIKLEAH 345
             P+             C  C + FN + +  K+            CK   DFK +LE H
Sbjct: 659 EKPL------------ECKVCGKRFNESSNLSKHMRTHERKYKCQKCKRSFDFKEQLEVH 706

Query: 346 KS 347
           +S
Sbjct: 707 QS 708

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 16/95 (16%)

Query: 200 SSNITPSSFASNSATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPN 259
           S+N+TPS  A+N        RI+     T+    + C  C   F  + +L RH + H   
Sbjct: 26  SNNVTPS--AANLLPIPKKSRII----KTDKPRPFLCSICTRGFVRQEHLKRHQRAHTSE 79

Query: 260 KAFRCPYWSEDC-RCHPSGEFSRKDTFRTHLKSIH 293
           K F C +    C RC     F+R+D    H   +H
Sbjct: 80  KPFLCTF----CGRC-----FARRDLVLRHQHKLH 105

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 10/64 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC-RCHPSGEFSRKDTFRTHLKSI 292
           + CP C   F  + +L RH   H   K F C      C +C     F+RKD    HL+ +
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLI----CGKC-----FARKDLVLRHLQKL 77

Query: 293 HFVY 296
           H  Y
Sbjct: 78  HRDY 81

>KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 682

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 48/122 (39%), Gaps = 29/122 (23%)

Query: 235 KCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHF 294
           KCP+C  +F  +  L +H++ H   K ++C         H    F+   + R H+++   
Sbjct: 578 KCPHCAKTFSTQDILQQHIRTHSGEKPYKC--------VHCGKGFATSSSLRIHIRTHTG 629

Query: 295 VYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKY------HIDADNCK---DFKIKLEAH 345
             P+             C  C + FN + +  K+            CK   D + +LE H
Sbjct: 630 EKPL------------ECKVCGKRFNESSNLSKHMRTHERKYKCGKCKRSFDLQEQLEVH 677

Query: 346 KS 347
           +S
Sbjct: 678 QS 679

>CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {ON}
           some similarities with uniprot|P38082 Saccharomyces
           cerevisiae YBR066c NRG2 or uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 314

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHLK 290
           C  C + F   G+L+RH K H   K+  CP+  E C    +  FSR D     +RTH K
Sbjct: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPH--EGC----NQSFSRHDNCLQHYRTHSK 306

>SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]
           {ON} similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 437

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPY 266
           +KC +C  +F  + +L RH+  H  NK F C Y
Sbjct: 86  FKCDHCERTFAKKSHLERHMFTHSDNKPFHCSY 118

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C  +F    + TRH + H   K F C   S          F R+D  + H++++H
Sbjct: 8   YICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHS--------FVRRDLLQRHIRTVH 59

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           + C +C   FK + +L RH++  HM  K F C   +++        FSR D    H+K+
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKN--------FSRSDNLNQHVKT 438

>Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 10/68 (14%)

Query: 225 PPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT 284
           P +T   T + C  C + F   G+L+RH + H   K   CP+  E C       FSR D 
Sbjct: 144 PHSTGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPH--EGC----GQRFSRHDN 197

Query: 285 ----FRTH 288
               +RTH
Sbjct: 198 CNQHYRTH 205

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 7/66 (10%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C  C   FK    L+ H+  H  NK F CP+   +C    +  F+ K     H K +H
Sbjct: 305 YHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPF--TNC----TKSFNAKSNMLRHYK-LH 357

Query: 294 FVYPVG 299
           F    G
Sbjct: 358 FKLSSG 363

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 8/74 (10%)

Query: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292
           ++ C  C  +F  + +L RH + H   K + C   S+        +F+R+D    H + +
Sbjct: 115 LFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSK--------KFTRRDLLIRHAQKV 166

Query: 293 HFVYPVGTTKAQRA 306
           H    V T  A +A
Sbjct: 167 HNGNVVDTVAALKA 180

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C  +F    +  RH + H   K F C    + CR      F R+D  + H++++H
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFEC----KVCR----HAFVRRDLLQRHIRTVH 59

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 38/93 (40%), Gaps = 9/93 (9%)

Query: 209 ASNSATHENYHRIVCH--PPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPY 266
           AS +A  +      C+   P  E+   +KC  C   F+    L  H   H   K + CPY
Sbjct: 181 ASAAAVEQGTAECACNNLAPNIENKRKFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPY 240

Query: 267 WSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPVG 299
            +    CH S  F+ K     H K +HF  P G
Sbjct: 241 EN----CHKS--FNAKSNMFRHYK-LHFKLPSG 266

>Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON}
           (79397..80281) [885 nt, 295 aa]
          Length = 294

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 10/73 (13%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYP- 297
           C   F     L RH +KH   K F+C      C       FSR D  + H++S+H ++P 
Sbjct: 33  CSMEFTRSENLVRHRRKHTGEKPFQC----HVCL----KFFSRIDNLKQHIESVHGIHPA 84

Query: 298 -VGTTKAQRANSA 309
            V  TK    NS+
Sbjct: 85  IVKRTKISAVNSS 97

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           +KC  C   F    +  RH++ H   K  RC + S    C  S  FSR D  + HL++
Sbjct: 17  FKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGS----CGKS--FSRSDELKRHLRT 68

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 47/126 (37%), Gaps = 26/126 (20%)

Query: 222 VCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSR 281
           V  P  +     ++CPYC   F    +L  H++ H+  K F+C Y  +         F++
Sbjct: 412 VEKPKGSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQYCGK--------RFTQ 463

Query: 282 KDTFRTHLKSIHFVYPVGTTKAQRANSAGR---CAACYEHFNSNKDWLKYHIDADNCKDF 338
               RTH               QR ++  +   C  C + F+   +   + +     K F
Sbjct: 464 GGNLRTH---------------QRLHTGEKPYECELCGKRFSRKGNLAAHVVTHQKLKPF 508

Query: 339 KIKLEA 344
             KL+ 
Sbjct: 509 ICKLDG 514

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C  +F    + TRH + H   K F C        C+ S  F R+D  + H++++H
Sbjct: 8   YICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV------CNHS--FVRRDLLQRHIRTVH 59

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 46/118 (38%), Gaps = 26/118 (22%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTH 288
           E +  +KCPYC   F    +L  H++ H+  K ++C Y  +         F++    RTH
Sbjct: 510 EGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGK--------RFTQGGNLRTH 561

Query: 289 LKSIHFVYPVGTTKAQRANSAGR---CAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
                          QR ++  +   C  C + F+   +   + +     K F  KL+
Sbjct: 562 ---------------QRLHTGEKPYECELCDKKFSRKGNLAAHLLTHQKVKPFICKLD 604

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 8/57 (14%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           Y+C YC   F    +L  H+K HM  K F C +  +         F++    RTH +
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEFCGK--------RFTQAGNLRTHRR 528

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPY 266
           ++C  CP SF  + +L RHL  H   K F+C Y
Sbjct: 83  FQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY 115

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 231 TTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           T  ++C YC      R  L RH   H   K+F CP    D R      F +    R H+ 
Sbjct: 108 TKPFQCSYCGKGVTTRQQLKRHEVTH--TKSFICPEEGCDLR------FYKHPQLRAHIL 159

Query: 291 SIHF 294
           S+H 
Sbjct: 160 SVHL 163

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 10/67 (14%)

Query: 228 TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT--- 284
            E    Y C  C   F   G+L RH + H   K   CP+  E C       FSR D    
Sbjct: 195 VEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPH--EGC----GQRFSRHDNCVQ 248

Query: 285 -FRTHLK 290
            ++THL+
Sbjct: 249 HYKTHLR 255

>KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.256
           YPL230W
          Length = 413

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 11/64 (17%)

Query: 233 IYKCPY---CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHL 289
           ++KC     C  +F    +L RH++KH   K F+C Y    C  H    FSR D  + H 
Sbjct: 42  MFKCQGFEDCHMAFTRAEHLARHIRKHTGEKPFQC-YI---CLKH----FSRVDNLKQHR 93

Query: 290 KSIH 293
           +S+H
Sbjct: 94  ESVH 97

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C YC   F    +  RH + H   K F C    + CR      F R+D  + H++++H
Sbjct: 12  YICSYCGKPFSRSEHKARHERSHTGVKPFEC----KVCR----HSFVRRDLLQRHIRTVH 63

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 234 YKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           Y+C +  C   FK R  + RHLK H   K F+C   S   RC     FS K+T   H ++
Sbjct: 870 YECKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDVCS---RC-----FSSKETLIQHYRT 921

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 19/44 (43%)

Query: 221 IVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRC 264
           ++ H  T      YKC  C  SF +   L  H++ H   K F C
Sbjct: 915 LIQHYRTHSGEKPYKCEICGKSFSISSSLKIHVRTHTGEKPFEC 958

>Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {ON}
           YPR186C (REAL)
          Length = 407

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPY 266
           ++C  CP SF  + +L RHL  H   K F+C Y
Sbjct: 80  FQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY 112

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 231 TTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290
           T  ++C YC      R  L RH   H   K+F CP    D R      F +    R H+ 
Sbjct: 105 TKPFQCSYCGKGVTTRQQLKRHEVTH--TKSFVCPEKGCDLR------FYKHPQLRAHIL 156

Query: 291 SIHF 294
           S+H 
Sbjct: 157 SVHL 160

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           + C +C   FK + +L RH++  HM  K F C   +++        FSR D    H+K+
Sbjct: 389 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKN--------FSRSDNLNQHVKT 439

>YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}
           RSF2Zinc-finger protein involved in transcriptional
           control of both nuclear and mitochondrial genes, many of
           which specify products required for glycerol-based
           growth, respiration, and other functions
          Length = 1380

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 16/117 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + CP C   F  + +L RH   H   K + C +     RC     F+R+D    H + +H
Sbjct: 151 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 202

Query: 294 FVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFK-IKLEAHKSNL 349
               VGT   +R   A    +    F S +   ++ + AD+  D   IK+  +K  +
Sbjct: 203 AAL-VGTGDPRRMTPAPNSTSS---FASKR---RHSVAADDPTDLHIIKIAGNKETI 252

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 10/59 (16%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHLK 290
           C  C   F   G+L RH + H   K   CPY  E C      +FSR D     +R H+K
Sbjct: 112 CRICYKGFTTSGHLARHNRIHTGEKNHECPY--EGC----DQKFSRHDNCIQHYRAHVK 164

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 17/92 (18%)

Query: 209 ASNSATHENYHRIVCHPPTT--------ESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPN 259
           +S S+TH    ++   P T         ++T  + C YC   FK + +L RH++  H+  
Sbjct: 462 SSTSSTHVIRKKLGNMPKTRGRKPSLLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGE 521

Query: 260 KAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           K + C   +++        FSR D    H+K+
Sbjct: 522 KPYACHICNKN--------FSRSDNLTQHIKT 545

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 232 TIYKCPY--CPSSFKVRGYLTRHLKKH 256
           T +KCP+  CP SF V+  + RHLK H
Sbjct: 175 TPFKCPWENCPKSFNVKSNMLRHLKSH 201

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           +KC  C   F+   +L RH++  H   + F C Y  +        +FSR D    HLK+
Sbjct: 437 FKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDK--------KFSRSDNLSQHLKT 487

>Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 10/66 (15%)

Query: 227 TTESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT-- 284
           TT   T + C  C + F   G+L+RH + H   K   CP+  E C       FSR D   
Sbjct: 146 TTGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPH--EGC----GQRFSRHDNCN 199

Query: 285 --FRTH 288
             +RTH
Sbjct: 200 QHYRTH 205

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           + C +C   FK + +L RH++  HM  K F C   +++        FSR D    H+K+
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKN--------FSRSDNLNQHVKT 438

>KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 331

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 9/74 (12%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPV 298
           C   F  + +L RH++KH   + F+C              FSR D  + H++S+H V  +
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHLCLRF--------FSRLDNLKQHVESVHSVS-M 78

Query: 299 GTTKAQRANSAGRC 312
            T++ + + S   C
Sbjct: 79  ATSQLKNSKSTAPC 92

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           +KC  C  +F+   +L RH++  H   + F CP   +        +FSR D    H+K+
Sbjct: 765 FKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDK--------KFSRSDNLAQHIKT 815

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 9/76 (11%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + CP C   F  + +L RH   H   K + C +     RC     F+R+D    H + +H
Sbjct: 125 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 176

Query: 294 FVYPVGTTKAQRANSA 309
               VGT   Q+   A
Sbjct: 177 AAL-VGTGDTQQRTPA 191

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           + C +C   FK + +L RH++  HM  K + C      C    + +FSR D    H+K+
Sbjct: 264 FGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI----C----NKKFSRSDNLNQHIKT 314

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 43/113 (38%), Gaps = 26/113 (23%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           ++CPYC   F    +L  H++ H+  K F C +  +         F++    RTH     
Sbjct: 472 HECPYCHHKFAQTTHLEVHVRSHLGYKPFECQFCGK--------RFTQGGNLRTH----- 518

Query: 294 FVYPVGTTKAQRANSAGR---CAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
                     QR ++  +   C  C + F+   +   + +     K F  KL+
Sbjct: 519 ----------QRLHTGEKPYACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLD 561

>YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON}
           Putative protein of unknown function; contains a zinc
           finger motif similar to that of Adr1p
          Length = 804

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C   F    +  RH + H   K F+C    + C+      F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQC----QVCK----HSFVRRDLLQRHIRTVH 59

Query: 294 FVYPVGTTKAQRANSA 309
             + + +  +   + A
Sbjct: 60  RTFLLSSYASMTGDKA 75

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 11/75 (14%)

Query: 220 RIVCHPPTT--ESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPS 276
           +I    PT   ++T  Y C YC   FK + +L RH++  H+  K + C      C    +
Sbjct: 333 KIRGRKPTLIPDNTKHYSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHI----C----A 384

Query: 277 GEFSRKDTFRTHLKS 291
            +FSR D    H K+
Sbjct: 385 RKFSRSDNLNQHTKT 399

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + CP C   F  + +L RH + H   K F C +     RC     F+R+D    H   +H
Sbjct: 72  FLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCG---RC-----FARRDLVLRHQHKLH 123

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           +KC  C  +FK   +L RH++  H  ++ F C    +        +FSR D    HLK+
Sbjct: 563 FKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEK--------KFSRSDNLSQHLKT 613

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFVYPV 298
           C  +F    +L RH++KH   K F+C    + C       FSR D  + H +S+H     
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQC----DVCL----KRFSRVDNLKQHRESVHATVVN 78

Query: 299 GTTKAQRANSAGRCAACYEHFNSNKDWLK 327
             +K     + GR     +   +N+++ K
Sbjct: 79  AASKNVPLVAKGRVEKPKKIILNNENFKK 107

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 228 TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           T +   ++CPYC   F    +L  H++ H+  K F C Y  +         F++    RT
Sbjct: 618 TRTIKKHECPYCHRLFSQATHLEVHVRSHIGYKPFACDYCGK--------RFTQGGNLRT 669

Query: 288 H 288
           H
Sbjct: 670 H 670

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 9/80 (11%)

Query: 213 ATHENYHRIVCHPPTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDC 271
           ++ +N   I     + E    +KC  C  +F+   +L RH++  H   + F C +  +  
Sbjct: 506 SSRKNSRSITPMNASDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEK-- 563

Query: 272 RCHPSGEFSRKDTFRTHLKS 291
                 +FSR D    HLK+
Sbjct: 564 ------KFSRSDNLSQHLKT 577

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 41/116 (35%), Gaps = 20/116 (17%)

Query: 228 TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           T +   ++CPYC   F    +L  H++ H+  K F C Y  +         F++    RT
Sbjct: 577 TRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGK--------RFTQGGNLRT 628

Query: 288 HLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
           H             +         C  C + F+   +   + +     K F  KLE
Sbjct: 629 H------------ERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLE 672

>Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {ON}
           YGL035C (MIG1) - 1:1 [contig 227] FULL
          Length = 463

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 7/65 (10%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTH 288
           ES   Y CP C  +F    + TRH++ H   K   C +    C    +  FSR D    H
Sbjct: 18  ESPRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFA--GC----TKRFSRSDELTRH 71

Query: 289 LKSIH 293
            K IH
Sbjct: 72  -KRIH 75

>Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON}
           YGR067C (REAL)
          Length = 812

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C   F    +  RH + H   K F+C    + C+      F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQC----QVCK----HSFVRRDLLQRHIRTVH 59

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 10/61 (16%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHL 289
           Y C  C       G+L RH + H   K + C    E C      +FSR D     ++THL
Sbjct: 256 YICKVCSKGLTTSGHLARHYRIHTGEKNYSC--LHEGC----DQKFSRHDNCKQHYKTHL 309

Query: 290 K 290
           K
Sbjct: 310 K 310

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 11/78 (14%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC-RCHPSGEFSRKDTFRTHLKSI 292
           + CP C   F  + +L RH + H   + F C      C RC     F+RKD    H + +
Sbjct: 49  FLCPTCTRGFVRQEHLKRHQRSHTRERPFLCVL----CGRC-----FARKDLVLRHQQKL 99

Query: 293 HFVYPVGTTKAQRANSAG 310
           H    V  T + R++ + 
Sbjct: 100 HATI-VSNTASNRSDKSS 116

>KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {ON}
           Anc_4.214 YGR067C
          Length = 749

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C  +F    +  RH + H   K F+C      C    +  F R+D  + H+K++H
Sbjct: 8   YVCSFCAKAFSRSEHRIRHERSHTGYKPFQC----NIC----NHAFVRRDLVQRHIKTVH 59

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 41/116 (35%), Gaps = 20/116 (17%)

Query: 228 TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           T +   ++CPYC   F    +L  H++ H+  K F C Y  +         F++    RT
Sbjct: 588 TRTVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGK--------RFTQGGNLRT 639

Query: 288 HLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
           H             +         C  C + F+   +   + +     K F  KLE
Sbjct: 640 H------------ERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLE 683

>NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {ON}
           Anc_4.189
          Length = 412

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           ++C +CP  F+       HL ++   + F+CP+ +  C  H  G F R+   R H  + H
Sbjct: 270 HRCAHCPRRFRTLYEYAAHLDEYSIVREFKCPFKT--CPWHILG-FPRRSDLRRHCANQH 326

>KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.256
           YPL230W
          Length = 322

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           C  SF    +L RH +KH   K F+C      CR +    FSR D  + H  S+H
Sbjct: 68  CNMSFTRAEHLARHTRKHTGEKPFQC----YICRKY----FSRVDNLKQHRDSVH 114

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 9/71 (12%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           + CP C   F  + +L RH   H   K + C +     RC     F+R+D    H + +H
Sbjct: 36  FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 87

Query: 294 FVYPVGTTKAQ 304
               VGT   Q
Sbjct: 88  AAL-VGTGDTQ 97

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC-RCHPSGEFSRKDTFRTHLKSI 292
           Y C  C   F  + +L RH + H   K F C +    C RC     F+R+D    H + +
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVF----CGRC-----FARRDLILRHQRRL 155

Query: 293 H 293
           H
Sbjct: 156 H 156

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 27/66 (40%), Gaps = 7/66 (10%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C  C   FK    L  H+  H   K +RCP+ S  C    S  F+ K     H K +H
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHIS--C----SKAFNAKSNMLRHYK-LH 322

Query: 294 FVYPVG 299
           F    G
Sbjct: 323 FKLNTG 328

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 10/63 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHL 289
           ++C  C   F    +  RH++ H   K ++C   S++C    +  FSR D     FRTH 
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPYKCS--SKNC----TKSFSRSDELKRHFRTHT 70

Query: 290 KSI 292
           +++
Sbjct: 71  RTV 73

>NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON} 
          Length = 243

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDC-RCHPSGEFSRKDTFRTHLKSIHF 294
           C  +F    +L RH++KH   K F+C    + C +C     FSR D  + H  S+H 
Sbjct: 26  CHMAFSRMEHLARHIRKHTGEKPFKC----DVCLKC-----FSRLDNLKQHRLSVHL 73

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C   F    +  RH + H  +K F C      C    S  F R+D  + H++++H
Sbjct: 8   YICSFCAKPFSRSEHKARHERSHTGSKPFSCSI----C----SHSFVRRDLLQRHIRTVH 59

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           + C  CP SFK   +L RH++  H   + F C    +        +FSR D    H+K+
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDK--------KFSRSDNLSQHIKT 697

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 41/116 (35%), Gaps = 20/116 (17%)

Query: 228 TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           T +   ++CPYC   F    +L  H++ H+  K F C Y  +         F++    RT
Sbjct: 587 TRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGK--------RFTQGGNLRT 638

Query: 288 HLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKDFKIKLE 343
           H             +         C  C + F+   +   + +     K F  KLE
Sbjct: 639 H------------ERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLE 682

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C   F    +  RH + H   K F+C    + C+      F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQC----QICK----HSFVRRDLLQRHIRTVH 59

>AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL230W and YMR182C
           (RGM1)
          Length = 409

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 20/78 (25%)

Query: 240 PSSFKVRGY------------LTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           P SFK  GY            L RH++K    K  +C    E C    +  FSR D  + 
Sbjct: 17  PRSFKCTGYGNCDRSFTRAEHLARHIRKQTGEKPSQC----EVC----NRFFSRIDNLKQ 68

Query: 288 HLKSIHFVYPVGTTKAQR 305
           H +S+H +  + TT+++R
Sbjct: 69  HRESVHSIPTISTTRSKR 86

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           +KC  C  +F+   +L RH++  H   + F C +    C      +FSR D    HLK+
Sbjct: 584 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF----CE----KKFSRSDNLSQHLKT 634

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           + C  CP SFK   +L RH++  H   + F C    +        +FSR D    H+K+
Sbjct: 646 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEK--------KFSRSDNLSQHIKT 696

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           + C  CP SFK   +L RH++  H   + F C    +        +FSR D    H+K+
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDK--------KFSRSDNLSQHIKT 697

>Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON}
           YGR067C (REAL)
          Length = 806

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           Y C +C   F    +  RH + H   K F+C    + C+      F R+D  + H++++H
Sbjct: 8   YICSFCLKPFSRSEHKMRHERSHAGVKPFQC----QICK----HSFVRRDLLQRHIRTVH 59

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 10/61 (16%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDT----FRTHL 289
           Y C  C   F   G+L RH + H   K  +C +   + R      FSR D     +RTH 
Sbjct: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQR------FSRHDNYIQHYRTHF 337

Query: 290 K 290
           K
Sbjct: 338 K 338

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           +KC  C  +F+   +L RH++  H   + F C Y  +        +FSR D    HLK+
Sbjct: 462 FKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEK--------KFSRSDNLSQHLKT 512

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 9/68 (13%)

Query: 225 PPTTESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKD 283
           P    S   +KC  C   FK   +L RH++  H   + + C +  ++        FSR D
Sbjct: 299 PQIIYSDKPFKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKN--------FSRSD 350

Query: 284 TFRTHLKS 291
               HLK+
Sbjct: 351 NLSQHLKT 358

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 11/68 (16%)

Query: 228 TESTTIYKCPY--CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTF 285
           T+  + Y C +  C  +F  R  L RHLK H   K ++CP      +C     FS +DT 
Sbjct: 561 TKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQCPQCQ---KC-----FSTEDTL 612

Query: 286 RTHLKSIH 293
             H K +H
Sbjct: 613 NQH-KRVH 619

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 234 YKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKS 291
           ++C  C   F    +  RH++ H   K  +C + S    C  S  FSR D  + HL++
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQS----CPKS--FSRGDELKRHLRT 68

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 8/58 (13%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           C YC  +F    +  RH + H   K + C    + C      EF R+D  + H++++H
Sbjct: 11  CSYCNRAFSRSEHKARHERSHTGTKPYEC----KVCL----REFVRRDLLQRHIRTVH 60

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 8/58 (13%)

Query: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           CP C   F    +L RH + H   K F C +     RC     F+R+D    H   +H
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCG---RC-----FARRDLVLRHQYKLH 84

>Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON}
           (84889..85725) [837 nt, 279 aa]
          Length = 278

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 239 CPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIH 293
           C  +F  + +L RH ++H   K F+C    E C       FSR D  R H  S+H
Sbjct: 22  CAMAFTRQEHLARHQRRHTGEKPFQC----EIC----LKFFSRHDNMRQHRDSVH 68

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 9/64 (14%)

Query: 229 ESTTIYKCPYCPSSFKVRGYLTRHLKK-HMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRT 287
           E    +KC  C  +F+   +L RH++  H   + F C +  +        +FSR D    
Sbjct: 375 EEVKPFKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEK--------KFSRSDNLSQ 426

Query: 288 HLKS 291
           HLK+
Sbjct: 427 HLKT 430

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,381,601
Number of extensions: 1632965
Number of successful extensions: 8991
Number of sequences better than 10.0: 515
Number of HSP's gapped: 8932
Number of HSP's successfully gapped: 586
Length of query: 349
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 239
Effective length of database: 40,868,139
Effective search space: 9767485221
Effective search space used: 9767485221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 66 (30.0 bits)