Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_14748.773ON45445423840.0
AFR530W8.773ON45944916200.0
SAKL0B05412g8.773ON45145115980.0
NCAS0C008108.773ON45144615850.0
KLLA0F24926g8.773ON45145115490.0
NDAI0K008408.773ON45945415320.0
YMR238W (DFG5)8.773ON45845115290.0
Skud_13.4078.773ON45845415180.0
Smik_13.4468.773ON45845115100.0
Suva_13.4228.773ON45845415070.0
CAGL0M05049g8.773ON45345214720.0
Kwal_55.202668.773ON45745714540.0
KLTH0E04048g8.773ON45445514500.0
TDEL0B033608.773ON43643614460.0
TBLA0B033208.773ON45045214450.0
ACL201WsingletonON44845014440.0
KNAG0J007008.773ON46342714450.0
ACL200WsingletonON46345114430.0
TPHA0J016008.773ON46145914310.0
KAFR0B034908.773ON45145114250.0
Kpol_1030.208.773ON45145414070.0
ZYRO0F12210g8.773ON45345213780.0
ACL202WsingletonON45043013250.0
NCAS0A08740singletonON43440313141e-179
NCAS0A08730singletonON63137612701e-170
TBLA0C03850singletonON56738611511e-153
KLLA0E07723g2.570ON45045611051e-148
SAKL0D13574g2.570ON45144511041e-147
KAFR0I017402.570ON44845110791e-144
Skud_11.1832.570ON44944510721e-143
KLTH0D08008g2.570ON44843310701e-142
Kwal_26.82252.570ON44944410691e-142
NDAI0C006802.570ON45245110691e-142
YKL046C (DCW1)2.570ON44944510671e-142
NCAS0H029002.570ON45346110651e-141
Smik_11.2022.570ON44944510601e-141
TPHA0I024702.570ON45245010581e-140
Suva_11.1802.570ON45044410551e-140
Ecym_45772.570ON45045410491e-139
KAFR0A021702.570ON44945010431e-138
NDAI0B015102.570ON44744510381e-137
TBLA0H02590singletonON45045410371e-137
CAGL0L01727g2.570ON44642910281e-136
ABR060W2.570ON45143510131e-134
NCAS0A127502.570ON44745710101e-133
KNAG0A071802.570ON46340610061e-132
Kpol_1056.42.570ON45044910021e-132
TDEL0B065802.570ON4474549991e-132
ZYRO0E06380g2.570ON4534419981e-131
TBLA0H026002.570ON4494549791e-129
TBLA0H02580singletonON4494439791e-128
CAGL0K10208g8.199ON30991790.28
NDAI0C059408.199ON30968686.4
Ecym_54885.643ON482110688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1474
         (454 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   922   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   628   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   620   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   615   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   601   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   594   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   593   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   589   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   586   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   585   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   571   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   564   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   563   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   561   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   561   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   560   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   561   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   560   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   555   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   553   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   546   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   535   0.0  
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   514   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            510   e-179
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            493   e-170
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              447   e-153
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   430   e-148
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   429   e-147
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   420   e-144
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   417   e-143
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   416   e-142
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   416   e-142
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   416   e-142
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   415   e-142
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    414   e-141
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   412   e-141
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   412   e-140
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   410   e-140
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   408   e-139
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   406   e-138
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   404   e-137
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   404   e-137
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   400   e-136
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   394   e-134
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   393   e-133
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            392   e-132
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   390   e-132
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   389   e-132
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   389   e-131
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   381   e-129
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   381   e-128
CAGL0K10208g Chr11 complement(994696..995625) [930 bp, 309 aa] {...    35   0.28 
NDAI0C05940 Chr3 (1359850..1360779) [930 bp, 309 aa] {ON} Anc_8....    31   6.4  
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...    31   8.7  

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/454 (98%), Positives = 445/454 (98%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI
Sbjct: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
           QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG
Sbjct: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
           IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY
Sbjct: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240
           DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD
Sbjct: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240

Query: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300
           NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC
Sbjct: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300

Query: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCG 360
           QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLE         CSGGKDGETCG
Sbjct: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCG 360

Query: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420
           LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL
Sbjct: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420

Query: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI
Sbjct: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/449 (66%), Positives = 346/449 (77%), Gaps = 1/449 (0%)

Query: 7   LYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWW 66
           L  L LL+   +   L LD+ S++ +C  T +IQ+GIMDYYWGS  GGIVGMF  PYYWW
Sbjct: 11  LVGLFLLMQGMLSRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWW 70

Query: 67  EAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFI 126
           EAG VF GMLENWYLCDN EY S L ESMIAQTG  +DYIP+NQS TEGNDDQG+W LFI
Sbjct: 71  EAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFI 130

Query: 127 MGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTI 186
           MGAVERNF D +   +PGWLTM Q VFN M ARWD+++CGGGLRWQIF WN GY YKNTI
Sbjct: 131 MGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTI 190

Query: 187 ANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIK 246
           ANGCLFQLAARLGRYTGN TYLD+A++ F WLVDVK++VL+D+A VFDGAHI +NC DIK
Sbjct: 191 ANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIK 250

Query: 247 GIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKIC 306
           GIEW+YNHG+IL G AYMYNAT G P WE+ + +IL GA  F+FR+ IMYERACQD   C
Sbjct: 251 GIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTC 310

Query: 307 NNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTG 366
           +NDQRSFKSIFSRMLA+TSV+APFTR TID L+          C  G  G TCGL+W  G
Sbjct: 311 DNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKG 370

Query: 367 SWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLG-TPMDNVLHSRLN 425
           ++DG YGLGEQASALE+IQN+LIHTKAPPLT + GG S G+P AGL       +L    N
Sbjct: 371 TYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHN 430

Query: 426 IGSKDRIKAALITAVCLGLLVGTALWMVI 454
           I  KDR+ A+LITA+ LGL++G ALWM+ 
Sbjct: 431 ITGKDRVGASLITAISLGLMLGCALWMIF 459

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/451 (64%), Positives = 349/451 (77%)

Query: 4   IVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPY 63
           ++ L   L+ + + +   + LD  SKDSIC AT  IQ+G++DYY G+  GG VGMF  PY
Sbjct: 1   MISLLISLIYMSLNIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPY 60

Query: 64  YWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWG 123
           YWW+AG  F GML+N YLCDN  Y   +Y++MIAQTG NYDYIP+NQSM EGNDDQG+WG
Sbjct: 61  YWWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWG 120

Query: 124 LFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYK 183
           + IMGAVERNF +     VPGWL M QAVFNTMYARWDSQHCGGGLRWQIFTWN GY+YK
Sbjct: 121 ITIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYK 180

Query: 184 NTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQ 243
           NTIANGCLFQ+AARLGRYTGN TYL++A++ + WL DV FVVL+D+ANVFDGA+I +NC 
Sbjct: 181 NTIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCS 240

Query: 244 DIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN 303
            I  IEWTYNHGV+LGG AYMYNATNG  +W+TRL Q+L GA  FFF N+IMYERACQ +
Sbjct: 241 SIVKIEWTYNHGVVLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGS 300

Query: 304 KICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDW 363
             CNNDQRSFKSIFSRML +TSVLAPFTR+TIDPL++         C+GG DG TCGLDW
Sbjct: 301 GTCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDW 360

Query: 364 TTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSR 423
           T G  DGYYGLGEQ SALE++QNLLI     P T + GG+S GDP AGL +   NVL + 
Sbjct: 361 TLGHHDGYYGLGEQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENN 420

Query: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           L+I  KDR+ AA+ITA+ LG+++G ++WMV 
Sbjct: 421 LSITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/446 (65%), Positives = 339/446 (76%), Gaps = 1/446 (0%)

Query: 9   SLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEA 68
           S +LL+ + V   + LDV SKDSICAAT  IQ+G++DYY G   GG VGMF  PYYWW  
Sbjct: 7   SFVLLLPLLV-QSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYWWNG 65

Query: 69  GLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMG 128
           G+ F GMLEN YLC+N  + S L ++++AQTG NYDYIPSNQSM EGNDDQG+WGL IM 
Sbjct: 66  GVAFGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLTIMD 125

Query: 129 AVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIAN 188
           AVERNF       VPGWL MAQAVFNTMYARWD  HCGGGLRWQIFTWN GY+YKNTIAN
Sbjct: 126 AVERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNTIAN 185

Query: 189 GCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGI 248
            CLFQ+AARLGRYTGN TYLD+A + F W+VD+ ++VL D+ANVFDGA I +NC DI  +
Sbjct: 186 ACLFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCTDITTL 245

Query: 249 EWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNN 308
           EWTYNHGV+LGGCAYMYNATNG   WETR+ +IL GA+ +FF++N+M E ACQ    CNN
Sbjct: 246 EWTYNHGVVLGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSYNTCNN 305

Query: 309 DQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSW 368
           DQR FKSIFSRML  TSVLAPFT ETIDPL++         C+GGKDG TCGLDWT GS 
Sbjct: 306 DQRCFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTKGSN 365

Query: 369 DGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGS 428
           DGYYGLGEQ +ALE++ NLLIH +  PLT N GGTS GD  AGL +   NVL ++L I  
Sbjct: 366 DGYYGLGEQMNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENKLKITQ 425

Query: 429 KDRIKAALITAVCLGLLVGTALWMVI 454
            DR  AA++TAV LG+ VG A+WM+ 
Sbjct: 426 GDRAGAAIVTAVILGIFVGGAVWMLF 451

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/451 (62%), Positives = 334/451 (74%), Gaps = 2/451 (0%)

Query: 4   IVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPY 63
           I  LYSL L +   +   + LD  SK SIC AT  IQ+GI DYY G   GG VGMF+ PY
Sbjct: 3   ISPLYSLFLTVVSVL--AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60

Query: 64  YWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWG 123
           YWWEAGLVF GM+ENWYLC N  Y   LY++++AQTG++YDY+PSNQ+M EGNDDQG+W 
Sbjct: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120

Query: 124 LFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYK 183
           L +M AVERNF + +    PGWL M QAVFN MY+RWDS HC GGLRWQIFTWN GY+YK
Sbjct: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180

Query: 184 NTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQ 243
           NTI+NGCLFQLAARLGRYTGN+TYL++A + F WLVD+ FVV+K+EANVFDGA I DNC 
Sbjct: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240

Query: 244 DIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN 303
            I   EW+YNHGV+LGGCAYMYNATNG  VW+TR  QILGGA +FFF ++IMYE  CQ +
Sbjct: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS 300

Query: 304 KICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDW 363
             CN DQR FK+IFSRML  TSVLAPFT +TI PL++         CSGG DG TCGL+W
Sbjct: 301 NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGLNW 360

Query: 364 TTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSR 423
            TG WDG YGLGEQA ALE+I  LL+H    PLT++ GG+S+GD  AGL     NVL   
Sbjct: 361 FTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQKN 420

Query: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           +NI + D+  A +IT + LG+LV   +WMV+
Sbjct: 421 INITAGDKAGAGIITTIVLGVLVLGTVWMVL 451

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/454 (62%), Positives = 338/454 (74%), Gaps = 2/454 (0%)

Query: 2   RIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQ 61
           R  +  +   LL+ V     + LD+ SK+SIC AT  IQ G+MDYYWG+  GG VGMF  
Sbjct: 7   RPSLYFHFFQLLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQP 66

Query: 62  PYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGI 121
           PYYWWEAG  F GM+ENWYLC N  Y   L  +++AQTG+NYDYIP+NQSM EGNDDQG+
Sbjct: 67  PYYWWEAGEAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGV 126

Query: 122 WGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYD 181
           WGL +MGA ERNF D   G  PGWL M QAVFNTM ARWDS HCGGGLRWQIFTWN GY+
Sbjct: 127 WGLTLMGAAERNFTDPDDG-TPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYN 185

Query: 182 YKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDN 241
           YKNTI+N CLFQLAARLGRYTGN+TYL++A + F+WLVDV +V+L D ANVFDGA I  N
Sbjct: 186 YKNTISNACLFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSN 245

Query: 242 CQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNN-IMYERAC 300
           C D+  IEWTYNHGV+LGG AYMYNATNG   WE+R+ ++L GA  +FF +N IM+E AC
Sbjct: 246 CTDMTQIEWTYNHGVVLGGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENAC 305

Query: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCG 360
           Q+   CNNDQRSFKSIFSRML +TSVLAPFT +T+DPL++         C+GG DG TCG
Sbjct: 306 QEYNTCNNDQRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCG 365

Query: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420
           L+W  GS DGYYGLGEQ  ALEV+QNLLIH +  PLT N GG+S GD  AGL +   NVL
Sbjct: 366 LNWAKGSHDGYYGLGEQMCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVL 425

Query: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
            +++ I + DR  AA++TA+ LG+L G A+WM  
Sbjct: 426 ENKMTITNGDRAGAAIVTAIILGVLTGGAVWMFF 459

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/451 (62%), Positives = 336/451 (74%), Gaps = 7/451 (1%)

Query: 10  LLLLICV------PVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPY 63
           ++L IC            + LD  SK SIC AT  IQ G++DYY G+  GG VGMF  PY
Sbjct: 9   MILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68

Query: 64  YWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWG 123
           YWW AG  F GMLENW+LC+N  Y   LY++++AQTG+NYDYIPSNQ+M EGNDDQGIWG
Sbjct: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128

Query: 124 LFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYK 183
           + +MGAVERNF D   G  PGWL M QAVFNTMY+RWDS+HCGGGLRWQIFTWN GY+YK
Sbjct: 129 ITVMGAVERNFTDPGDGK-PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187

Query: 184 NTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQ 243
           NT++N CLFQ+AARLGRYTGN+TYL++A + F WLVDV +VVL D ANVFDGA I  NC 
Sbjct: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247

Query: 244 DIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN 303
           DI  IEWTYNHG++LGG AYMYNATNG   WET L +IL GA+++FF+++IMYE ACQD 
Sbjct: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307

Query: 304 KICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDW 363
             CN DQR+FKSIFSRML +TSV+APFTR+TID L++         C+GG DG TCGL+W
Sbjct: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367

Query: 364 TTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSR 423
              + DGYYGLGEQ SALEVIQNLLIH +  P  ++ GGTS GD  AG+ +   NVL + 
Sbjct: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427

Query: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           LNI   DR  AA+ITAV L +L G A+WM+ 
Sbjct: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/454 (62%), Positives = 337/454 (74%), Gaps = 2/454 (0%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           MR+I        L  V +   + LD  SK SIC AT  IQ G++DYY G+  GG VGMF 
Sbjct: 7   MRMI-PFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQ 65

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
            PYYWW AG  F GMLENW+LC+N  Y   LY++++AQTG+NYDYIP+NQ+M EGNDDQG
Sbjct: 66  SPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQG 125

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
           IWG+ +MGAVERNF D   G  PGWL M QAVFNTMY+RWDS+HCGGGLRWQIFTWN GY
Sbjct: 126 IWGITVMGAVERNFTDPDEGK-PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGY 184

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240
           +YKNT++N CLFQ+AARLGRYTGNSTYLD+A + F WLVDV +VVL D ANVFDGA I  
Sbjct: 185 NYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDT 244

Query: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300
           NC DI  IEWTYNHG++LGG AYMYNATNG   WETRL QIL GA+A+FF++ IMYE AC
Sbjct: 245 NCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESAC 304

Query: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCG 360
           QD   CN DQR+FKSIFSRML +TSV+APFT +TID L++         C+GG DG TCG
Sbjct: 305 QDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCG 364

Query: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420
           LDW   + DGYYGLGEQ SALEVIQNLLIH +  P  ++ GGTS GD  AG+ +   NVL
Sbjct: 365 LDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVL 424

Query: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
            + LNI    R  AA+ITA+ L +L+G A+WM+ 
Sbjct: 425 QNNLNITKGGRAGAAIITAIILSVLIGGAVWMLF 458

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/451 (61%), Positives = 340/451 (75%), Gaps = 1/451 (0%)

Query: 4   IVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPY 63
           ++ L    LL    +C  ++LD  SK SIC AT  IQ G++DYY G+  GG VGMF  PY
Sbjct: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68

Query: 64  YWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWG 123
           YWW AG  F GMLENW+LC+N  Y   LY++++AQTG+NYDYIP+NQ+M EGNDDQGIWG
Sbjct: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128

Query: 124 LFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYK 183
           + +MGAVERNF D   G  PGWL M QAVFNTMY+RWDS+HCGGGLRWQIFTWN GY+YK
Sbjct: 129 ITVMGAVERNFTDPSDGK-PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187

Query: 184 NTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQ 243
           NTI+N CLFQ+AARLGRYTGN+TYLD+A + F WLVDV +VVL D ANVFDGA I  NC 
Sbjct: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247

Query: 244 DIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN 303
           DI  IEWTYNHG++LGG AYMYNATNG   WET L +IL GA+++FF+++IMYE ACQD 
Sbjct: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDY 307

Query: 304 KICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDW 363
             CN DQR+FKSIFSRML +TSV+AP+T +TID L++         C GG+DG TCGL+W
Sbjct: 308 STCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367

Query: 364 TTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSR 423
              + DGYYGLGEQ +ALEVIQNLLIH +  P  ++ GGTS GD  AG+ +   NVL + 
Sbjct: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427

Query: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           LNI + DR  AA+ITA+ L +L+G A+WM+ 
Sbjct: 428 LNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/454 (61%), Positives = 334/454 (73%), Gaps = 2/454 (0%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           M+I + L    LL        + LD  S  SIC AT  IQ G++DYY G+  GG VGMF 
Sbjct: 7   MKIALPL-CFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQ 65

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
            PYYWW AG  F GM+ENWYLC N  Y   LY++++AQTGA+YDYIP+NQ+M EGNDDQG
Sbjct: 66  SPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQG 125

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
           IWG+ +MGAVERNF +   G  PGWL M QAVFNTMY+RWDS++CGGGLRWQIFTWN GY
Sbjct: 126 IWGITVMGAVERNFTNPDNG-APGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGY 184

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240
           +YKNTI+N CLFQ+AARLGRYTGN+TYLD+A + F WLVDV +VVL D ANV+DGA I  
Sbjct: 185 NYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDT 244

Query: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300
           NC DI  IEWTYNHG++LGG AYMYNATNG   W+T L+Q+L GA ++FF++ IMYE AC
Sbjct: 245 NCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESAC 304

Query: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCG 360
           QD   CN DQR+FKSIFSRML +TSV+APFT +TID L++         C GG DG TCG
Sbjct: 305 QDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCG 364

Query: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420
           LDW   + DGYYGLGEQ SALEVIQNLLIH +  P  ++ GGTS GD  AG+ +   +VL
Sbjct: 365 LDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVL 424

Query: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
            + LNI   DR  AA+ITAV L +L+G A+WM+ 
Sbjct: 425 QNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/452 (60%), Positives = 329/452 (72%), Gaps = 6/452 (1%)

Query: 7   LYSLLLLICV----PVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQP 62
           L+SL L + +    P  G + L   +KDSICAAT  IQ G++DYY G+  GG VGMF  P
Sbjct: 4   LFSLQLWVLIGTLFPDAGAINLQ-DNKDSICAATALIQGGMLDYYEGTRYGGTVGMFQPP 62

Query: 63  YYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIW 122
           YYWW+AG+ F GMLENW+LC N  Y   L  +++AQTG NYDYIP+NQ+  EGNDDQG+W
Sbjct: 63  YYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEGNDDQGVW 122

Query: 123 GLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDY 182
           GL I+ AVERNF  A +   PGWL M+Q +FNTMYARWD Q C GGLRWQIFTWN GY+Y
Sbjct: 123 GLTILDAVERNFS-APIDGKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNY 181

Query: 183 KNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNC 242
           KNTI+N CLFQ+AARLGRYTGN+TYLD+A   F WLV V ++VL ++ NV+DGA + DNC
Sbjct: 182 KNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYIVLSEKGNVYDGAKVEDNC 241

Query: 243 QDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQD 302
            DI  IEWTYNHGV+LGG AYMYNATNG  VW++RL  +LGGA A+FF+++IMYE ACQ 
Sbjct: 242 TDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVLGGATAYFFQDDIMYESACQP 301

Query: 303 NKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLD 362
            K CNNDQR FKSIFSRML  TSVLAPFT +TIDPLL+         C GG DG TCGLD
Sbjct: 302 YKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCGLD 361

Query: 363 WTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHS 422
           W   + DGYYGLGEQ SALEVIQ LLIH +  P   + GGTS GD  AGL +   NVL +
Sbjct: 362 WQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADNGGTSVGDAAAGLNSTTTNVLKN 421

Query: 423 RLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
            L I   DR  AA++T + LG+++G A WM+ 
Sbjct: 422 NLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF 453

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/457 (59%), Positives = 329/457 (71%), Gaps = 5/457 (1%)

Query: 3   IIVQLYSLLLL--ICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           +++QL +L  L  +       + LD  SKDSIC AT  IQ+G+MDYY G+  GG VGMF 
Sbjct: 1   MVLQLMALGALGAVFTSQVSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQ 60

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
           QPYYWWEAG VF GM+ENW+LC N  Y  TLY++MIAQ G +YD++PSNQSM EGNDDQG
Sbjct: 61  QPYYWWEAGEVFGGMMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQG 120

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
           +WGL +M AVERNF +     VPGWL M Q VFNTM++RWDS HCGGGLRWQIFTWN GY
Sbjct: 121 VWGLTLMSAVERNFTNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGY 180

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDE--ANVFDGAHI 238
           +YKNT++N CLFQLAARLGRYTGN TYL  A   ++WLVD+ FV   +   ANV+DGA I
Sbjct: 181 NYKNTVSNACLFQLAARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATI 240

Query: 239 GDNCQDIKGIEWTYNHGVILGGCAYMYNAT-NGDPVWETRLRQILGGARAFFFRNNIMYE 297
             NC DI  IEW+YN G++LGG AYMYNAT NG   WE+RL QI+GG+   FFRN IMYE
Sbjct: 241 DKNCTDIVEIEWSYNQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYE 300

Query: 298 RACQDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGE 357
             CQD+  CN DQRSFKSIFSRML++T  LAP+T + IDPL++         C+GG DG 
Sbjct: 301 ATCQDSGKCNQDQRSFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGH 360

Query: 358 TCGLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMD 417
           TCGL+W  G  DG+YGLGEQA ALE IQ+ L   +  P T + GGTS GD  AGL     
Sbjct: 361 TCGLNWEKGEHDGWYGLGEQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTST 420

Query: 418 NVLHSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           NVLHS LNI  KD++ A++ITAV L +LVG ++WM+ 
Sbjct: 421 NVLHSDLNITQKDKVGASIITAVLLAVLVGGSIWMIF 457

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/455 (58%), Positives = 330/455 (72%), Gaps = 4/455 (0%)

Query: 3   IIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQP 62
           ++ Q ++L  L+  P+ G + LD     SIC AT  IQ GIMDYY G+  GG VGMF QP
Sbjct: 1   MLAQSFALCALLLQPILG-IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQP 59

Query: 63  YYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIW 122
           YYWWEAG VF GMLENW+LC N  Y+  +Y++MI Q G +YD++PSNQSM EGNDDQG+W
Sbjct: 60  YYWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVW 119

Query: 123 GLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDY 182
           GL +M A ERNF +     VPGWL MAQ VFNTM+ RWDS+HCGGG+RWQIFTWN GY+Y
Sbjct: 120 GLTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNY 179

Query: 183 KNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKD--EANVFDGAHIGD 240
           KNT++N C+FQLAARLGRYTGN TYL  A   + WLVDV FVVL +   ANV+DGA+I D
Sbjct: 180 KNTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDD 239

Query: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGD-PVWETRLRQILGGARAFFFRNNIMYERA 299
           NC DI   EW+YN G++LGG AYMYNAT  D  VW++RL QI+GG+  FFF++ +MYE  
Sbjct: 240 NCTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYEST 299

Query: 300 CQDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETC 359
           CQD+K CN DQRSFKSIFSRML++T  LAP+T ETIDPL+E         C+GG DG TC
Sbjct: 300 CQDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTC 359

Query: 360 GLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNV 419
           GL+W  G  DGYYGLGEQA ALE IQ+L+   +  P T + GG+S GD  A L +   NV
Sbjct: 360 GLNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNV 419

Query: 420 LHSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           L S + I  KD++ A++ITAV L +LVG ++WM+ 
Sbjct: 420 LQSDIKITHKDKVGASIITAVILAVLVGGSIWMIF 454

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/436 (61%), Positives = 329/436 (75%), Gaps = 3/436 (0%)

Query: 21  GLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWY 80
           GL LD  SKDSIC AT  IQ+G++DYY G+  GG VGMF  PYYWW+AG  F GM++NWY
Sbjct: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61

Query: 81  LCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMG 140
            C+N  + S +Y+ M+AQTG +YDY+P NQ+M EGNDDQG+WGL +MGAVERNF +   G
Sbjct: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121

Query: 141 NVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGR 200
             PGWL MAQA+FN + +RWD+ +CGGGLRWQIFTWN GY+YKNTI+N CLFQ+AARLGR
Sbjct: 122 -APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGR 180

Query: 201 YTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEWTYNHGVILGG 260
           YTGN TYL++A   F WLVDV +VVLKD  NVFDGA I +NC  I  +EW+YNHGV+LGG
Sbjct: 181 YTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGG 240

Query: 261 CAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN--KICNNDQRSFKSIFS 318
            A+MYNATNG   WETR+ QILGGA ++FF+++IMYE  CQ +    CN+DQRSFK+IFS
Sbjct: 241 LAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFS 300

Query: 319 RMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYYGLGEQA 378
           RML +TSVL P T+  +D LL+         CSGG DG TCGL+W   + DGYYGLGEQ 
Sbjct: 301 RMLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQM 360

Query: 379 SALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKDRIKAALIT 438
           SALEV+Q LLIH KA P T+  GG+S GD  AGL T   NVL ++L+I +KDR  AA+IT
Sbjct: 361 SALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIIT 420

Query: 439 AVCLGLLVGTALWMVI 454
           AV L +LVG ++WM+ 
Sbjct: 421 AVILMVLVGGSIWMLF 436

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/452 (59%), Positives = 327/452 (72%), Gaps = 2/452 (0%)

Query: 3   IIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQP 62
           +I+    L  L  V     + LD  SK+SIC AT  I +G++DYYWG+  GG VGMF  P
Sbjct: 1   MILNELILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPP 60

Query: 63  YYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIW 122
           YYWWEAG  F GMLENWYLC N  Y   L++++ AQTG +YDYIP NQ+M EGNDDQ IW
Sbjct: 61  YYWWEAGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIW 120

Query: 123 GLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDY 182
           GL +M AVERNF +   G  PGWL M QAVFNTM++RWD+  CGGGLRWQIFTWN GYDY
Sbjct: 121 GLTVMDAVERNFTNPTEG--PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDY 178

Query: 183 KNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNC 242
           KNTI+N CLFQ+AARLGRYTGN+TYLD+AN+ F WL  V +V + + A V+DGA I +NC
Sbjct: 179 KNTISNACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENC 238

Query: 243 QDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQD 302
            DI   +W+YN+G +LGG AYMYNATNG  +WETR+ Q+L GA+A+FF+++IMYE ACQ 
Sbjct: 239 TDITKYQWSYNNGCMLGGAAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQT 298

Query: 303 NKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLD 362
            K CNNDQRSFKS+FSRML  TSVL P TR+ IDPL+          C+GG DG TCGL+
Sbjct: 299 AKTCNNDQRSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLN 358

Query: 363 WTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHS 422
           W   + DGYYGLGEQ SALEVIQNLLIH +  P T   GG+S GD  AGL     NVL +
Sbjct: 359 WQASTHDGYYGLGEQMSALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSN 418

Query: 423 RLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
            L+I + D++ AA++TA  L +LVG A+WM+ 
Sbjct: 419 DLDIKTGDKVGAAILTAGVLAILVGGAIWMLF 450

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/450 (58%), Positives = 322/450 (71%), Gaps = 4/450 (0%)

Query: 7   LYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWW 66
           +Y LL+++ + +   L +D  S +SIC AT+ IQ GI+DYY G+ PGG  G  ++PYYWW
Sbjct: 1   MYVLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWW 60

Query: 67  EAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFI 126
            AG  F GM+ENWYLC+N EY   L ++M++Q G N DY+PS+Q M EGNDDQGIWGL +
Sbjct: 61  MAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLV 120

Query: 127 MGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTI 186
           MGA ERNFPDA     PGWL +AQAVFNTM+ARWD ++CGGGLRWQIF WN GYDYKNTI
Sbjct: 121 MGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTI 180

Query: 187 ANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIK 246
           +N CLFQ+AARL R+TGNSTY D+A   F WLVDVK V L+++A V DGAHI + C+D  
Sbjct: 181 SNACLFQIAARLARFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHS 240

Query: 247 GIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKIC 306
            +EWTYNHGV+LGGCAYMYN TNG  VW  RL ++L G+   FF N I+YERACQD   C
Sbjct: 241 QLEWTYNHGVVLGGCAYMYNITNGSAVWGDRLNKVLNGS-LLFFENGILYERACQDVNKC 299

Query: 307 NNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTG 366
           N+DQRSF+SIFSRMLA+TSVLAP T+  I+P +          CSGG+DG TCG+ W   
Sbjct: 300 NDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNY 359

Query: 367 SWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAG--LGTPMDNVLHSRL 424
           +WDG YGLGEQ SALE+IQN LIHTK PP T N G  S GDPGAG  L +P    L +R 
Sbjct: 360 TWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTR- 418

Query: 425 NIGSKDRIKAALITAVCLGLLVGTALWMVI 454
            I  KDR+ A   T V L   +  ++WM I
Sbjct: 419 QIRLKDRVGAGFATVVFLLPFITGSIWMSI 448

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/427 (61%), Positives = 314/427 (73%)

Query: 28  SKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYLCDNMEY 87
           S D +C+AT  +  G++DYY G+  GG VGMF  PYYWW AG  F GM+ENW+LC N  Y
Sbjct: 37  SLDPVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIENWFLCQNSTY 96

Query: 88  NSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMGNVPGWLT 147
            + L ++ IAQTG NYDYIP NQ+M EGNDDQGIWGL IM AVERNF       VPGWL 
Sbjct: 97  ETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPTKDGVPGWLA 156

Query: 148 MAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGRYTGNSTY 207
           M+QAVFNTM+ARWD+QHCGGGLRWQIFTWN GY+YKNTI+N CLF LAARLGRYTGNSTY
Sbjct: 157 MSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLAARLGRYTGNSTY 216

Query: 208 LDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEWTYNHGVILGGCAYMYNA 267
           LD+A++ F W+V V +VVL D ANVFDGA+I DNC  I   EW+YNHGV+LGG A+MYNA
Sbjct: 217 LDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHGVVLGGTAFMYNA 276

Query: 268 TNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRSFKSIFSRMLAVTSVL 327
           TNG  VWE R+ +IL GA  +FFR++IM+E ACQD   CNNDQR+FK+IFSRML+ T+VL
Sbjct: 277 TNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFKAIFSRMLSFTAVL 336

Query: 328 APFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYYGLGEQASALEVIQNL 387
            P T  TIDPL++         CSGG DG TCGL+W    WDG YGLGEQ SALEV+  L
Sbjct: 337 VPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQMSALEVMNYL 396

Query: 388 LIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKDRIKAALITAVCLGLLVG 447
           L+H +  P T  AGG+S GD  AGL +   NV  + LNI  KD+  AA++T V LG L G
Sbjct: 397 LVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGAAIVTTVILGTLAG 456

Query: 448 TALWMVI 454
            ++WM+ 
Sbjct: 457 GSIWMLF 463

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/451 (58%), Positives = 322/451 (71%), Gaps = 2/451 (0%)

Query: 5   VQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYY 64
           + +Y LL+++ + +   L +D  S +SIC AT+ IQ GI+DYY G  PGG VG F +PYY
Sbjct: 14  LPMYVLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYY 73

Query: 65  WWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGL 124
           WW AG  F GM+ENWYLC+N EY   L ++M++Q G N DY+PS+Q M EGNDDQGIWGL
Sbjct: 74  WWMAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGL 133

Query: 125 FIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKN 184
            +MGA ERNFPDA     PGWL +AQAVFNTM+ARWD ++CGGGLRWQIF WN GYDYKN
Sbjct: 134 LVMGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKN 193

Query: 185 TIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQD 244
           TI+N CLFQ+AARL R+TGNSTY D+A   F WLVD K V L+++A V DGAHI + C+D
Sbjct: 194 TISNACLFQIAARLARFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERCED 253

Query: 245 IKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNK 304
              +EWTYNHGV+L GCAYMYN TNG  VW  RL ++L G+   FF N I+YERACQD +
Sbjct: 254 HSKLEWTYNHGVVLAGCAYMYNITNGSAVWGDRLNKVLNGS-LLFFPNGILYERACQDVQ 312

Query: 305 ICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWT 364
            CN+DQRSF+SIFSRMLA+TSVLAP T+  I+P +          CSGG+DG TCG+ W 
Sbjct: 313 KCNDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWR 372

Query: 365 TGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLH-SR 423
             +WDG YGLGEQ SALE+IQN LIHTK PP T N G  S GDP AGL     N++  S 
Sbjct: 373 NYTWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLST 432

Query: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
             IG KDR+ A  +T V L   +  ++WM I
Sbjct: 433 RQIGLKDRVGAGFMTVVLLIPFITGSIWMSI 463

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/459 (59%), Positives = 331/459 (72%), Gaps = 15/459 (3%)

Query: 9   SLLLLIC-VPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWE 67
           +LL LI  +     + LDV SKDS+C AT  IQ+G++DYY G+  GG VGMF  PYYWWE
Sbjct: 5   TLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWE 64

Query: 68  AGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIM 127
           AG  F GMLENWYLC N  + S + +++I Q G+NYDYIPSNQ++ EGNDDQG+WGL ++
Sbjct: 65  AGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVL 124

Query: 128 GAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIA 187
           GAVERN PD     VPGWL ++QAVFNTMYARWD+ +CGGGLRWQI+TWN GY+YKNTI+
Sbjct: 125 GAVERNLPDRD--GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTIS 182

Query: 188 NGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKG 247
           N CLFQ+AARLGRYTGN+TYL++A + F W+VDV+++VLKD ANV+DGA    NC DI  
Sbjct: 183 NACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQ 242

Query: 248 IEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICN 307
            EW+YNHGV+LGG AYMYNATNG   WET L Q+L GA  +FF+NNIMYE ACQ+ K CN
Sbjct: 243 YEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCN 302

Query: 308 NDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGS 367
            DQRSFKSIFSRML  T VLAP+T  T+D L+E         C GG DG TCGL W   +
Sbjct: 303 TDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDST 362

Query: 368 WDGYYGLGEQASALEVIQNLLI------------HTKAPPLTKNAGGTSNGDPGAGLGTP 415
            DGYYGLGEQ SALE+I  LL+             + + P T ++GG S GD  AGL T 
Sbjct: 363 NDGYYGLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLNTT 422

Query: 416 MDNVLHSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
             NVL + L+I SKD+  AA+ TAV L +LVG ++WM+ 
Sbjct: 423 STNVLQNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/451 (59%), Positives = 325/451 (72%), Gaps = 4/451 (0%)

Query: 7   LYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWW 66
           + +LL  + + V   + LD  SK SIC AT  IQ G++DYY G   GG VGMF  PYYWW
Sbjct: 2   MITLLFPLLLTVAKAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPYYWW 61

Query: 67  EAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFI 126
           EAG  F GMLENW+LC+N  +   +Y++++AQTG++YD++P NQ+M EGNDDQ +WGL I
Sbjct: 62  EAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWGLTI 121

Query: 127 MGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTI 186
           M AVERNF D   G+ PGWL M QA+FN M++RWDS +CGGGLRWQIFTWN GYDYK+TI
Sbjct: 122 MDAVERNFTDPTDGS-PGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKSTI 180

Query: 187 ANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFV-VLKDEANVFDGAHIGDNCQDI 245
           +N CLFQLA+RLGRYTGN TYLD+A   + WLVDV F+ V    A V+DGA I +NC DI
Sbjct: 181 SNVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCTDI 240

Query: 246 KGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKI 305
             I+W+YNHG++LGG AY YNATNG  VWE+R+  I+ GA++ FF + IMYE ACQD   
Sbjct: 241 TTIDWSYNHGILLGGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDYDT 300

Query: 306 CNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTT 365
           CNNDQRSFKSIFSRML  TSVLAPFT  TIDPL++         C GG DG TCGL+W  
Sbjct: 301 CNNDQRSFKSIFSRMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNWQD 360

Query: 366 GSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMD--NVLHSR 423
            + DG YGLGEQ SALEVIQNLLIH +  P T + GG+S GD  AGL T     +VL + 
Sbjct: 361 KTCDGNYGLGEQMSALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLENN 420

Query: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           L I SKDR  AA+ITAV LG + G A+WM+ 
Sbjct: 421 LTITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/454 (57%), Positives = 331/454 (72%), Gaps = 7/454 (1%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           + +++Q ++ +  +       + LDV SKDSICAAT  IQ G++DYY G+  GG VGMF 
Sbjct: 5   LTVLLQAFNFITTVT-----AIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQ 59

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
            PYYWWEAG  F GM+ENW+LC N  Y+  +Y++++AQTG+NYDY+P+NQ+  E    + 
Sbjct: 60  PPYYWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK- 118

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
           ++G  +M A ERNF     G  P WL MAQAVFNTMYARWDS +CGGGLRWQI+TWN GY
Sbjct: 119 VFGGTVMDAAERNFTAPSDGK-PDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGY 177

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240
           +YKNT++N CLFQ+AARLGRYTGN TYL++A + F WLVDV FVVL DEANVFDGA+I  
Sbjct: 178 NYKNTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITS 237

Query: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300
           NC  +  +EW+YNHG++LGG AYMYNATNG   WE+ L ++L GA++ FF+NNIMYE+AC
Sbjct: 238 NCSAVVKLEWSYNHGIVLGGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQAC 297

Query: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCG 360
           QD+  CN DQRSFKSIFSRML +TSVLAP+T +TI PL++         C GG DG TCG
Sbjct: 298 QDHNTCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCG 357

Query: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420
           L+W  G+ DG YGLGEQ  ALE++ NLLI  +  P T + GGTS GDP AGL     +VL
Sbjct: 358 LNWNLGTNDGKYGLGEQMCALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVL 417

Query: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
            + L+I  KDR  AA++TAV L +L+G ++WM+ 
Sbjct: 418 SNNLDIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/452 (57%), Positives = 318/452 (70%), Gaps = 5/452 (1%)

Query: 7   LYSLL--LLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYY 64
           L+++L  L+  +     + L V  KDS+C+AT  IQ+G++DYY G   GG +GMF  PYY
Sbjct: 3   LHNILVWLVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYY 62

Query: 65  WWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGL 124
           WW+AG  F GM++NW+ C N  +   + E+M+ Q G +YDY+P NQ+M EGNDDQG+WGL
Sbjct: 63  WWQAGEAFGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGL 122

Query: 125 FIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKN 184
            +M AVERNF D   G  PGWL MAQAVFN +  RWD + C GG+RWQIFTWN GY+YKN
Sbjct: 123 TVMEAVERNFTDPGDGK-PGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKN 181

Query: 185 TIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQD 244
           TI+NGC FQLAARLGRYT N TYL++A + F WL DV FVVLKD+ NVFDGA   DNC  
Sbjct: 182 TISNGCYFQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQ 241

Query: 245 IKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQ--D 302
           +  +EWTYNHG+ILGG AYMYNATNG   WE R+ QIL GA  +FF++N+MYE  CQ  D
Sbjct: 242 VTELEWTYNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGD 301

Query: 303 NKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLD 362
           +  CNNDQRSFKSIFSRML +TSVL P   + +D LL          CSGG DG TCGL+
Sbjct: 302 SSNCNNDQRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLN 361

Query: 363 WTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHS 422
           W  GSWD  YGLGEQ SALEVIQN LIH   PP  ++ GG+S GD  AGL T   NVL  
Sbjct: 362 WFKGSWDNQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQK 421

Query: 423 RLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           +L I SKDR  AA+IT V L ++VG ++WM+ 
Sbjct: 422 KLKIQSKDRAGAAIITGVVLMVVVGGSVWMLF 453

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/430 (58%), Positives = 295/430 (68%), Gaps = 2/430 (0%)

Query: 7   LYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWW 66
           +Y+L++   V +C  L ++  S  SIC AT+ IQ+GI+DYY G  PGG VG F +PYYWW
Sbjct: 1   MYALVIFNIV-LCNALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWW 59

Query: 67  EAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFI 126
            AG VF GM+ENWYLCDN EY   L E+M++Q G N DY+P +Q M EGNDDQGIWGL +
Sbjct: 60  MAGDVFGGMVENWYLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLV 119

Query: 127 MGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTI 186
           M A ER+FPDA     PGWL +AQAVFNTM+ARWD  +C GGL WQI+ WN+GYDYKNTI
Sbjct: 120 MDAAERDFPDAPPDQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTI 179

Query: 187 ANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIK 246
           +NG LFQ+AARL R+TGNSTY  +A   F WLVD K V L + A V DGAH+  NC D  
Sbjct: 180 SNGYLFQIAARLARFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFT 239

Query: 247 GIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKIC 306
             EWTYN+GV+LGGCAYMYN TNG PVW  RL ++L GA   FF N IMYER CQD   C
Sbjct: 240 RYEWTYNYGVVLGGCAYMYNFTNGSPVWANRLNRVLNGA-LLFFENGIMYERTCQDVDRC 298

Query: 307 NNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTG 366
           NNDQR FKSIF+RMLA+TSVLAP T+  I+P +          C+GG DG TCGL W   
Sbjct: 299 NNDQRFFKSIFTRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNY 358

Query: 367 SWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNI 426
           +WDG  GLGEQ  ALE+IQN LIHTK PPLT   G  S GDP AGL +   ++       
Sbjct: 359 TWDGKAGLGEQLCALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSSRYDLPIVHPPS 418

Query: 427 GSKDRIKAAL 436
           G K  I   L
Sbjct: 419 GQKSSILTTL 428

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  510 bits (1314), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 243/403 (60%), Positives = 289/403 (71%), Gaps = 9/403 (2%)

Query: 17  PVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGML 76
           PV   ++L+V S  SIC AT  I +GI+DYY G+   G VGMF QPYYWW+AG  F GML
Sbjct: 22  PVGSSIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGML 81

Query: 77  ENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPD 136
           ENWYLC N  + S L ++M+ Q G +YDY+P NQ+M E NDDQG+WGL IMGAVERNF D
Sbjct: 82  ENWYLCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTD 141

Query: 137 AQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAA 196
            Q  +VPGWL MAQ++FN MY+RWD+  CGGGLRWQI+ WN GY+YKNTI+  CLFQ+AA
Sbjct: 142 PQGKDVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAA 201

Query: 197 RLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEA-NVFDGAHIGDNCQDIKGIEWTYNHG 255
           RLGRYTGNSTYL +A++TF W+VD+ ++ L   +  VFDGAHI  NC DI  +EW+YNHG
Sbjct: 202 RLGRYTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHG 261

Query: 256 VILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQ--DNKICNNDQRSF 313
           ++LGGCAYMYNAT   P W     +IL GA  +FF+N  M E ACQ  D   CNNDQR+F
Sbjct: 262 IVLGGCAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTF 320

Query: 314 KSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYYG 373
           KSIFSRML +TSV+APFT E IDPL+          C+GG D ETCGL+W  G  DGYYG
Sbjct: 321 KSIFSRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYG 380

Query: 374 LGEQASALEVIQNLLIHTKAPPL-----TKNAGGTSNGDPGAG 411
           LGEQ SALEVIQNLLIH + PP          GG S GDP AG
Sbjct: 381 LGEQLSALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  493 bits (1270), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 277/376 (73%), Gaps = 3/376 (0%)

Query: 21  GLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWY 80
            L LD  S  SIC AT  +Q+GI+DYY G+T GG VGMF  PYYWW +G  F  M+ENWY
Sbjct: 28  SLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHSGCAFGSMIENWY 87

Query: 81  LCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMG 140
           LC +  Y S + ++++AQ G NYD++P NQ+M EGNDDQG+WGL +M A ER FP  Q+ 
Sbjct: 88  LCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMDAAEREFP--QVK 145

Query: 141 NVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGR 200
             P WLTMA+ +F +M+ARWD+ +CGGGLRWQI++WN GYDYKNT++  CLFQLAARLGR
Sbjct: 146 GQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTTCLFQLAARLGR 205

Query: 201 YTGNSTYLDIANETFSWLVDVKFVVLKD-EANVFDGAHIGDNCQDIKGIEWTYNHGVILG 259
           YTGN TY+  AN+ F WL  V FV+ K+ +  VFDGA I  NC +IK  EW+YNHG++LG
Sbjct: 206 YTGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKYEWSYNHGIVLG 265

Query: 260 GCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRSFKSIFSR 319
           G AYMYN T+G   WETR  Q+L  A ++FF+N IM+E  CQ + ICNNDQRSF+SIF+R
Sbjct: 266 GAAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNNDQRSFRSIFAR 325

Query: 320 MLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYYGLGEQAS 379
           ML  TS++APFT ETIDPLL+         CSGGKDG TCGL+W   ++DG YGLGE+ S
Sbjct: 326 MLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNFDGNYGLGEEMS 385

Query: 380 ALEVIQNLLIHTKAPP 395
           A+EVIQNLLIH +  P
Sbjct: 386 AMEVIQNLLIHQRPAP 401

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  447 bits (1151), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/386 (53%), Positives = 266/386 (68%), Gaps = 3/386 (0%)

Query: 22  LQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYL 81
           +++D  SK+SIC AT  IQ G++DYY G+  GG VG+F  PYYWW++G  F  +L NWYL
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 82  CDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMGN 141
           C N  Y   +Y++++AQ G NYD++P NQ+M EGNDDQG++ + I+ A+ERNF     G+
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPKGS 136

Query: 142 VPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGRY 201
            P WL M Q VFN+MY RWD+  C GG+RWQI++WN GYDYKN ++ G LF +AARL RY
Sbjct: 137 -PSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARY 195

Query: 202 TGNSTYLDIANETFSWLVDVKFVVLKDE-ANVFDGAHIGDNCQDIKGIEWTYNHGVILGG 260
           TGN++Y  +A+  F WL  V +V+  D+   V DGA I  NC DI  IEWTYN G+I+ G
Sbjct: 196 TGNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDG 255

Query: 261 CAYMYNATNGDPVWETRLRQILGGAR-AFFFRNNIMYERACQDNKICNNDQRSFKSIFSR 319
           CAY+YNATNG   WE    ++L GA+  FF +N+IMYE ACQ N  CNNDQRSFK++ +R
Sbjct: 256 CAYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLAR 315

Query: 320 MLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYYGLGEQAS 379
            L  TSVLAP+T  TI P++          C+GG DG TCGL W  G+ DGYYG+GEQ S
Sbjct: 316 FLGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMS 375

Query: 380 ALEVIQNLLIHTKAPPLTKNAGGTSN 405
           ALE+IQNLLI+   PPL    GG  N
Sbjct: 376 ALEIIQNLLINDYPPPLVAPNGGCFN 401

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  430 bits (1105), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 216/456 (47%), Positives = 291/456 (63%), Gaps = 8/456 (1%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           MR+   + SL+ L    V  GL LDV   +S+  AT  +  G+MDYY G   G  +GMF 
Sbjct: 1   MRVFKLVLSLVTLFS-SVSFGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFA 59

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
            P YWW+AG  +  +L+ W+  +N  YN  L ++++ QTG N+DY+P NQ++TEGNDDQ 
Sbjct: 60  SPSYWWQAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQA 119

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
            WG  +M A ERN+P+    + P WL +AQAVFNTM +RWD   CGGGLRWQIFTWN GY
Sbjct: 120 FWGFAVMAAAERNYPNPP-DDEPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGY 178

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEAN--VFDGAHI 238
           DYKN+++N  LF L+ARL RYTGNS+Y + A + + W+ D++ +V ++     V+DGA I
Sbjct: 179 DYKNSVSNAALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASI 238

Query: 239 GDNCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYER 298
            +NC D    +WTYN G++L G AY+YN T  +  W  R +  L  +   FF N+IMYE 
Sbjct: 239 EENCTDTVKYQWTYNQGLMLSGSAYLYNFTESE-TWHERTKNFLN-SSGIFFNNSIMYEA 296

Query: 299 ACQDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGET 358
           ACQ +  CNNDQRSFK+ FSR L +T+ L P TR+T+  LL+         CSGG DG T
Sbjct: 297 ACQGSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHT 356

Query: 359 CGLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDN 418
           CGL+W  G WDG YGLGEQ +ALEV+QNL    +  P T + GGTS G+P AG      N
Sbjct: 357 CGLNWFYGGWDGKYGLGEQMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTN 416

Query: 419 VLHSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           +  + L IG  D+  A +ITAV    ++G+ +W++I
Sbjct: 417 L--APLTIGKGDQAGAGIITAVIGITIIGSVVWLII 450

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  429 bits (1104), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 215/445 (48%), Positives = 280/445 (62%), Gaps = 9/445 (2%)

Query: 12  LLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLV 71
           LL+  P  G + LDV   +S+  AT  +  G+MDYY G   G  +GMF  PYYWWEAG  
Sbjct: 14  LLLYSPT-GAMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNPYYWWEAGGA 72

Query: 72  FAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVE 131
           +  ML+ W+  +N  YN  + ++++ QTG ++DY+P NQS TEGNDDQ  WGL +M A E
Sbjct: 73  WGSMLDYWWYMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFWGLAVMAAAE 132

Query: 132 RNF--PDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANG 189
           RNF  PD      P WL +AQAVFNTM  RWD+  CGGGLRWQIFTWN GYDYKN+++NG
Sbjct: 133 RNFSNPDPDQ---PQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYKNSVSNG 189

Query: 190 CLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIE 249
            LF +AARL RYTGN +Y+D A + F W+ DV  +   D A V DG  I DNC  +   +
Sbjct: 190 ALFHIAARLARYTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCTSVTPYQ 249

Query: 250 WTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNND 309
           WTYNHG+I+ G AY+YN T G  VW  R ++ L  +  FF   +I++E ACQ +  CN D
Sbjct: 250 WTYNHGLIMAGSAYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQASNTCNTD 308

Query: 310 QRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWD 369
           QRSFK+ FSR L +T+ L P +R  I   +          CSGG+DG TCG++W  GSWD
Sbjct: 309 QRSFKAYFSRFLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINWFNGSWD 368

Query: 370 GYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSK 429
           G+YGLGEQ +ALE+IQN+    +  P T   GG+S GD  AG  T   N+  + L I + 
Sbjct: 369 GFYGLGEQMAALEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNL--TPLTITAG 426

Query: 430 DRIKAALITAVCLGLLVGTALWMVI 454
            R  A +ITAV    +V  A+W+V+
Sbjct: 427 SRAGAGIITAVIGISIVACAVWLVL 451

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  420 bits (1079), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 278/451 (61%), Gaps = 14/451 (3%)

Query: 9   SLLLLICVPVCG---GLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYW 65
           +L+LLI     G    L+LD+ S +S+  AT  +  G+MDYY G+  G  VGMF  PYYW
Sbjct: 5   NLILLILSTFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSDPYYW 64

Query: 66  WEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLF 125
           WEAG  +  M++ WY  DN  YN  +  +++ QTG ++DYIP NQS TEGNDDQ  WG+ 
Sbjct: 65  WEAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAFWGIA 124

Query: 126 IMGAVERNF---PDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDY 182
           +M A ERNF   PD Q    P WL +AQAVFNTM  RWD   CGGGLRWQIFTWN GYDY
Sbjct: 125 VMTAAERNFTNPPDDQ----PQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDY 180

Query: 183 KNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNC 242
           KNT++NG LF LAARL RYTGN++Y+D A + ++W+ D   +    +  V+DGA + DNC
Sbjct: 181 KNTVSNGALFHLAARLARYTGNTSYVDWAEKVYNWMEDTYLISNGTQMFVYDGASVTDNC 240

Query: 243 QDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQD 302
             +   +WTYN G++L G AY+YN T  + +W  R +  L  A   FF N+IMYE ACQ 
Sbjct: 241 TTVTKYQWTYNQGLLLSGSAYLYNFTESE-LWHERTKGFL-NASVVFFNNSIMYEAACQG 298

Query: 303 NKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLD 362
            + CN DQRSFK+ FSR L  T+ L P TR+T+   +          CSGG DG TCG++
Sbjct: 299 PQTCNTDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGIN 358

Query: 363 WTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHS 422
           W  G WDGYYGLGEQ SALE++ N     K  P T   GG+S GD  AG      N+  S
Sbjct: 359 WFYGGWDGYYGLGEQMSALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL--S 416

Query: 423 RLNIGSKDRIKAALITAVCLGLLVGTALWMV 453
            LN+    +  A +ITAV    +    LW++
Sbjct: 417 PLNVTPGSKAAAGIITAVIGISIFACVLWLI 447

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  417 bits (1072), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 213/445 (47%), Positives = 273/445 (61%), Gaps = 5/445 (1%)

Query: 10  LLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAG 69
           L +L        ++LD+ + +S+  AT  I  G+MDYY G+  G  +GMF  PYYWWEAG
Sbjct: 10  LSVLFFTKFSNAVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYYWWEAG 69

Query: 70  LVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGA 129
             +  ML+ W+  DN  YN  +  +M+ Q+G + DYIP NQS TEGNDDQ  WG+  M A
Sbjct: 70  GAWGCMLDYWFFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGIAAMTA 129

Query: 130 VERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANG 189
            ERNF +    + P WL +AQAVFNTM  RWD+  CGGGLRWQIF WN GYDYKNT++NG
Sbjct: 130 AERNFTNPP-ADEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNG 188

Query: 190 CLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIE 249
            LF +AARL RYTGN TY+D A + + W+V V  +       V+DG  IGDNC  +   +
Sbjct: 189 ALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGDNCTKVTSYQ 248

Query: 250 WTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNND 309
           WTYN G++L G AY+YN T  D +W TR ++ L  ++  FF++ I+YE ACQ    CN D
Sbjct: 249 WTYNQGLLLAGSAYLYNFTGSD-LWHTRTKEFLNSSQV-FFQDGIVYEAACQGPNSCNTD 306

Query: 310 QRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWD 369
           QRSFK+ F+R L VT+ L P TR  I   L          CSGG DG TCGL+W  G+WD
Sbjct: 307 QRSFKAYFARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWD 366

Query: 370 GYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSK 429
           G YGLGEQ +ALEV+ N     K  P T + GG+S GD  AG      N+  + LNI   
Sbjct: 367 GMYGLGEQMAALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNL--APLNITKG 424

Query: 430 DRIKAALITAVCLGLLVGTALWMVI 454
            +  A +ITAV    +V  ALW+V 
Sbjct: 425 SKAGAGIITAVIGISIVACALWLVF 449

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  416 bits (1070), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 209/433 (48%), Positives = 270/433 (62%), Gaps = 5/433 (1%)

Query: 22  LQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYL 81
           L  DV ++ SI  AT  +  G++DYY G   G  +GMF  PYYWWEAG  +  +L+ W+ 
Sbjct: 21  LDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDFWWY 80

Query: 82  CDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMGN 141
             N  YN+ L E+++ Q G N+DYIP NQS TEGNDDQ  WGL +M A ERNF +     
Sbjct: 81  TQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPE-T 139

Query: 142 VPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGRY 201
            P WL +AQAVFNTM  RWD + CGGGLRWQIFTWN GYDYKNT++NG LF LAARL RY
Sbjct: 140 EPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARY 199

Query: 202 TGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEWTYNHGVILGGC 261
           TGN+TY+D A + F W+  +  +   D + V+DGA +  NC  I  + WTYN G+++ GC
Sbjct: 200 TGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMSGC 259

Query: 262 AYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRSFKSIFSRML 321
           AY+YN T G   W TR  + L  +   FF N+I+YER CQ+   CN DQRSFK+ FSR L
Sbjct: 260 AYLYNYT-GSETWHTRTFEFLNSSD-IFFNNSILYERTCQEANTCNTDQRSFKAYFSRFL 317

Query: 322 AVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYYGLGEQASAL 381
            +T+ L P  R  I   +          CSGG DG TCGL+W    WDG +GLGEQ +AL
Sbjct: 318 GLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMAAL 377

Query: 382 EVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKDRIKAALITAVC 441
           E++QN+L   +  P T   GG+S G+  AG  T   N+  S L+I +  R  A +ITAV 
Sbjct: 378 EIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGIITAVI 435

Query: 442 LGLLVGTALWMVI 454
              +V   +W+V+
Sbjct: 436 GLSIVACTVWLVL 448

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  416 bits (1069), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/444 (47%), Positives = 280/444 (63%), Gaps = 6/444 (1%)

Query: 12  LLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLV 71
           LL+ +    G+ LDV + +SI  AT  +  G++DYY G   G  +GMF  PYYWWEAG  
Sbjct: 11  LLVTLRGSLGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPYYWWEAGGA 70

Query: 72  FAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVE 131
           +  +L+ W+   N  YN  L ++++ Q+G N+DYIP NQS TEGNDDQ  WGL +M A E
Sbjct: 71  WGSILDYWHYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAE 130

Query: 132 RNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCL 191
           RNF +    + P WL +AQAVFNTM  RWD   CGGGLRWQIFTWN GYDYKNT++NG L
Sbjct: 131 RNFTNPP-PDQPQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKNTVSNGAL 189

Query: 192 FQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEWT 251
           F LAARL RYTGN TY++ A + F W+  +K +  ++E  V+DGA + DNC  I  + WT
Sbjct: 190 FHLAARLARYTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTVITKLIWT 249

Query: 252 YNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKI-CNNDQ 310
           YN G+++ G AY+YN T G   W TR  + L  +   FF N+++YERACQ   + CN DQ
Sbjct: 250 YNQGLLMSGSAYLYNYT-GAEKWHTRTFEFLNSSH-IFFNNSVLYERACQGVTVSCNTDQ 307

Query: 311 RSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDG 370
           RSFK+ FSR + +T+ L P +R  I   ++         CSGG+DG TCGL+W    WDG
Sbjct: 308 RSFKAYFSRFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNWFYDGWDG 367

Query: 371 YYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKD 430
            +GLGEQ SALE++QNLL   +  P T   GG+S G+  AG  T   N+  S L I +  
Sbjct: 368 KWGLGEQMSALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL--SPLAITAGS 425

Query: 431 RIKAALITAVCLGLLVGTALWMVI 454
           R  A +ITAV    +V   +W+V+
Sbjct: 426 RAAAGIITAVIGLSIVACTIWLVL 449

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  416 bits (1069), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/451 (47%), Positives = 272/451 (60%), Gaps = 5/451 (1%)

Query: 4   IVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPY 63
           ++ + +   L+       L++D+   DS+  AT  +  G+MDYY G+  G  +GMF  PY
Sbjct: 7   LLSIVTTTTLLLSHSTKALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPY 66

Query: 64  YWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWG 123
           YWWEAG  +  ML+ WY  DN  YN  +  +++ QTG N DY+P NQS TEGNDDQ  WG
Sbjct: 67  YWWEAGGAWGSMLDYWYYMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWG 126

Query: 124 LFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYK 183
           + +M A ERNF +    + P WL +AQAVFNTM  RWD   CGGGLRWQIF WN GYDYK
Sbjct: 127 IAVMTAAERNFTNPPE-DSPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYK 185

Query: 184 NTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQ 243
           NT++NG LF +AARL RYTGN +Y+D A + + W+ +V  V       V+DG +I +NC 
Sbjct: 186 NTVSNGALFHMAARLARYTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCS 245

Query: 244 DIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN 303
            I   +WTYNHG+++ G AY+YN T  + VW  R + ++  A   FF N+IMYE ACQ  
Sbjct: 246 TITPYQWTYNHGLVMAGAAYLYNFTENE-VWHNRTKMLV-DASTVFFNNSIMYEAACQGP 303

Query: 304 KICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDW 363
             CN DQRSFK+ FSR L  T+ L P TR  I PL+          CSGG DG TCGL+W
Sbjct: 304 NSCNTDQRSFKAYFSRFLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNW 363

Query: 364 TTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSR 423
             G WDG YGLGEQ  ALEV+ N     K  P T   GG+S GD  AG      N+  + 
Sbjct: 364 FIGDWDGMYGLGEQMCALEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHPTNL--AP 421

Query: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           L+I    R  A +ITAV    ++  ALW+V 
Sbjct: 422 LHITKGSRAGAGIITAVIGISILACALWLVF 452

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  415 bits (1067), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 216/445 (48%), Positives = 269/445 (60%), Gaps = 5/445 (1%)

Query: 10  LLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAG 69
           L +L        ++LD+ + +S+  AT  I  G+MDYY G+  G  VGMF  PYYWWEAG
Sbjct: 10  LGVLFATRFTNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAG 69

Query: 70  LVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGA 129
             +  ML+ W+  DN  YN  +  +MI Q G + DYIP NQS TEGNDDQ  WG+  M A
Sbjct: 70  GAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTA 129

Query: 130 VERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANG 189
            ERNF +    N P WL +AQAVFNTM  RWD+  CGGGLRWQIF WN GYDYKNT++NG
Sbjct: 130 AERNFTNPPE-NEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNG 188

Query: 190 CLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIE 249
            LF +AARL RYTGN TY+D A + + W+V V  +       V+DG  I DNC  +   +
Sbjct: 189 ALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQ 248

Query: 250 WTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNND 309
           WTYN G++L G AY+YN T  D +W TR ++ L  ++  FF + I+YE ACQ    CN D
Sbjct: 249 WTYNQGLLLAGSAYLYNFTGSD-LWHTRTKEFLNASQV-FFHDGIVYEAACQGPNSCNTD 306

Query: 310 QRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWD 369
           QRSFK+ F+R L VT+ L P TR  I   L          CSGG DG TCGL+W  G+WD
Sbjct: 307 QRSFKAYFARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWD 366

Query: 370 GYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSK 429
           G YGLGEQ SALEV+ N     K  P T   GG+S GD  AG      N+  + LNI   
Sbjct: 367 GMYGLGEQMSALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNL--APLNITKG 424

Query: 430 DRIKAALITAVCLGLLVGTALWMVI 454
            +  A +ITAV    +V  ALW+V 
Sbjct: 425 SKAGAGIITAVIGISIVACALWLVF 449

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  414 bits (1065), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 214/461 (46%), Positives = 279/461 (60%), Gaps = 15/461 (3%)

Query: 1   MRIIVQLYSLLLLICVPV----CGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIV 56
           M +   + + LLL    +       L LD+   +S+  AT  +  G+MDYY G+  G  V
Sbjct: 1   MLVSKSISTFLLLSLASILPSQVSALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTV 60

Query: 57  GMFIQPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGN 116
           GMF  PYYWW+AG  +  ML+ WY  +N  YN  +  +++ QTG + DY+P NQS TEGN
Sbjct: 61  GMFSDPYYWWQAGGAWGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGN 120

Query: 117 DDQGIWGLFIMGAVERNF---PDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQI 173
           DDQ  WG+ +M A ERNF   P+ Q    P WL +AQAVFNTM  RWDS  CGGGLRWQI
Sbjct: 121 DDQAFWGIAVMTAAERNFTNPPEDQ----PQWLYLAQAVFNTMAMRWDSDTCGGGLRWQI 176

Query: 174 FTWNLGYDYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVF 233
           F WN GYDYKNT++NG LF +A+RL RYTGN +Y+D A + + W+ DV  +       V+
Sbjct: 177 FIWNSGYDYKNTVSNGALFHIASRLARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVY 236

Query: 234 DGAHIGDNCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNN 293
           DG +IGDNC  +   +WTYN G++L GCAY+YN T G+ +W  R + +L  A   FF N+
Sbjct: 237 DGVNIGDNCTTVTPYQWTYNQGLLLSGCAYLYNFT-GEELWHNRTKNLLTAA-GVFFNNS 294

Query: 294 IMYERACQDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGG 353
           I+YE ACQ +  CN DQRSFK+ FSR L  T+ L P TR  I   +          CSGG
Sbjct: 295 ILYEAACQGHNTCNTDQRSFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGG 354

Query: 354 KDGETCGLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLG 413
            DG TCG++W    WDG YGLGEQ +ALE++ N    +KA P T + GG+S GD  AG  
Sbjct: 355 TDGHTCGINWFADGWDGMYGLGEQMAALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTE 414

Query: 414 TPMDNVLHSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
               N+  + L+I    R  A +ITAV    +V  ALW+V 
Sbjct: 415 PHPTNL--APLHITKGSRAGAGIITAVIGISIVTCALWLVF 453

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  412 bits (1060), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 212/445 (47%), Positives = 269/445 (60%), Gaps = 5/445 (1%)

Query: 10  LLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAG 69
           L +L        ++LD+ + +S+  AT  +  G+MDYY G+  G  +GMF  PYYWWEAG
Sbjct: 10  LSVLFATRFTNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAG 69

Query: 70  LVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGA 129
             +  ML+ W+  DN  YN  +  +MI Q G + DYIP NQS TEGNDDQ  WG+  M A
Sbjct: 70  GAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTA 129

Query: 130 VERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANG 189
            ERNF +    + P WL +AQAVFNTM  RWD+  CGGGLRWQIF WN GYDYKNT++NG
Sbjct: 130 AERNFTNPPEDD-PQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNG 188

Query: 190 CLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIE 249
            LF +AARL RYTGN TY+D A + + W+V V  +       V+DG  I DNC  +   +
Sbjct: 189 ALFHIAARLARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDNCTKVTSYQ 248

Query: 250 WTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNND 309
           WTYN G++L G AY+YN T  D +W TR ++ L  ++  FF + I+YE ACQ    CN D
Sbjct: 249 WTYNQGLLLAGSAYLYNFTGSD-LWHTRTKEFLNASQV-FFHDGIVYEAACQGPNSCNTD 306

Query: 310 QRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWD 369
           QRSFK+ F+R L VT+ L P TR  I   L          CSGG DG TCGL+W  G+WD
Sbjct: 307 QRSFKAYFARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWD 366

Query: 370 GYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSK 429
           G YGLGEQ SALEV+ N     +  P T   GG+S GD  AG      N+  + LNI   
Sbjct: 367 GMYGLGEQMSALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNL--APLNITKG 424

Query: 430 DRIKAALITAVCLGLLVGTALWMVI 454
            +  A +ITAV    +V  ALW+V 
Sbjct: 425 SKAGAGIITAVIGISIVACALWLVF 449

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  412 bits (1058), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 209/450 (46%), Positives = 275/450 (61%), Gaps = 10/450 (2%)

Query: 10  LLLLICV-----PVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYY 64
           LL + C+      +   + LD+ + +S+  AT  +  G+MDYY G   G  +GMF  PYY
Sbjct: 8   LLFVNCILSLYSSLTSAVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYY 67

Query: 65  WWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGL 124
           WWEAG  +  ML+ W+  +N  YN  + ++++ Q G   DY+P NQS TEGNDDQ  WG+
Sbjct: 68  WWEAGGAWGCMLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGI 127

Query: 125 FIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKN 184
             M A ERNF +    + P WL +AQAVFNTM  RWD+  CGGGLRWQIF WN GYDYKN
Sbjct: 128 AAMMAAERNFTNPAE-DEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKN 186

Query: 185 TIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQD 244
           +++NG LF +AARL RYTGN +Y + A + + W+VDV  +       V+DG    DNC  
Sbjct: 187 SVSNGALFHIAARLARYTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCTT 246

Query: 245 IKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNK 304
           I   +WTYN G+IL GCAY+YN T G  +W TR +  L  + + FF + I+YE ACQ+ +
Sbjct: 247 ITKYQWTYNQGLILSGCAYLYNYT-GSELWHTRTKNFL-SSSSVFFNDTILYEAACQNQE 304

Query: 305 ICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWT 364
            CN DQRSFK+ FSR L VT+ L P TR+ I   ++         CSGG DG TCG++W 
Sbjct: 305 TCNTDQRSFKAYFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINWF 364

Query: 365 TGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRL 424
            G WDG YGLGEQ +ALE++ N     +  P T + GG+S GD  AG  T   N+  S L
Sbjct: 365 YGGWDGKYGLGEQMAALEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--SPL 422

Query: 425 NIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           NI +  R  A +ITAV    +V  A W+VI
Sbjct: 423 NITAGSRAGAGIITAVIGISIVACACWLVI 452

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  410 bits (1055), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 212/444 (47%), Positives = 267/444 (60%), Gaps = 5/444 (1%)

Query: 11  LLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGL 70
           +L         ++LD+ +  S+  AT  I  G+MDYY G   G  VGMF  PYYWWEAG 
Sbjct: 12  VLFATTRFTNAVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWEAGG 71

Query: 71  VFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAV 130
            +  ML+ W+  +N  YN  +  +MI Q G + DYIP NQS TEGNDDQ  WG+  M A 
Sbjct: 72  AWGCMLDYWFFMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAA 131

Query: 131 ERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGC 190
           ERNF +    + P WL +AQAVFNTM  RWD+  CGGGLRWQIF WN GYDYKNT++NG 
Sbjct: 132 ERNFTNPP-SDEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGA 190

Query: 191 LFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEW 250
           LF +AARL RYTGN TY+D A + + W+V V  +       V+DG  I DNC  +   +W
Sbjct: 191 LFHIAARLARYTGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQW 250

Query: 251 TYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQ 310
           TYN G++L G AY+YN T  D +W TR ++ L  ++  FF + I+YE ACQ    CN DQ
Sbjct: 251 TYNQGLLLAGSAYLYNFTGSD-LWHTRTKEFLNASQV-FFHDGIVYEAACQGPNSCNTDQ 308

Query: 311 RSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDG 370
           RSFK+ F+R L VT+ L P TR  I   L          CSGG DG TCGL+W  G+WDG
Sbjct: 309 RSFKAYFARFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDG 368

Query: 371 YYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKD 430
            YGLGEQ +ALEV+ N     +  P T + GG+S GD  AG      N+  S LNI    
Sbjct: 369 MYGLGEQMAALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLNITKGS 426

Query: 431 RIKAALITAVCLGLLVGTALWMVI 454
           +  A +ITAV    +V  ALW+V 
Sbjct: 427 KAGAGIITAVIGISIVACALWLVF 450

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  408 bits (1049), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 208/454 (45%), Positives = 281/454 (61%), Gaps = 6/454 (1%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           MR +  +  + L +       L+LDV    S+ +AT  I  G++DYY G  PG  +GMF 
Sbjct: 1   MRSVWVILGVFLNLLGTDVSALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFS 60

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
            PYYWWEAG  +  +++ W+  +N  YN  + ++++ Q G   DY+P NQS TEGNDDQ 
Sbjct: 61  SPYYWWEAGAAWGALIDYWFYMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQA 120

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
            WG+ +M A E+ FP+    + P WL +AQAVFNTM  RWDS  C GGLRWQIFTWN GY
Sbjct: 121 FWGIAVMSAAEKGFPNPDP-DQPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGY 179

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFV-VLKDEANVFDGAHIG 239
           DYKN+++NG LF LAARL RYTGN +Y D A + + W+  V+ +    D   V+DGA I 
Sbjct: 180 DYKNSVSNGALFHLAARLARYTGNQSYADWAEKVYDWMASVQLINQTGDWTFVYDGAFIH 239

Query: 240 DNCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERA 299
           DNC     ++W+YNHG+ILGGCAY+ + T  D VW  R  ++L  A + FF N ++ E A
Sbjct: 240 DNCSRPSVLQWSYNHGLILGGCAYLTDFTGSD-VWHNRTLRLLRSA-SIFFPNGVVTEVA 297

Query: 300 CQDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETC 359
           CQ+   CN DQRSFK+ F R L +T+ L P +RE     +          CSGG+DG TC
Sbjct: 298 CQEAGTCNTDQRSFKAYFMRFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTC 357

Query: 360 GLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNV 419
           G++++ GS+D  YGLGEQ +ALE IQNL    K  PLT + GGTS G+PGAG    +  +
Sbjct: 358 GMNYSRGSYDESYGLGEQLAALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL 417

Query: 420 LHSRLNIGSKDRIKAALITAVCLGLLVGTALWMV 453
             S L+I + DR  A +ITA+    L+   +W+V
Sbjct: 418 --SPLDISNADRAGAGIITALVGFSLISCIVWLV 449

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  406 bits (1043), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 213/450 (47%), Positives = 272/450 (60%), Gaps = 5/450 (1%)

Query: 5   VQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYY 64
           ++ ++L+L   +     L+LD+    S+  AT  +  G+MDYY G+  GG VGMF  PYY
Sbjct: 5   IKTFALILSTLIWRSQSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSPYY 64

Query: 65  WWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGL 124
           WWEAG  F  +L+ WY  DN  YN  +  +M+ Q G ++DYIP NQS TEGNDDQ  WG+
Sbjct: 65  WWEAGGAFGTLLDFWYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFWGI 124

Query: 125 FIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKN 184
             M A ERNF +    + P WL +AQAVFNTM  RWD+  CGGGLRWQIFTWN GYDYKN
Sbjct: 125 AAMTAAERNFTNPA-SDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDYKN 183

Query: 185 TIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQD 244
           +++NG LF LAARL RYTGN +Y+D A + ++W+ D  F+   +   V+DGA   DNC  
Sbjct: 184 SVSNGALFHLAARLARYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDNCSS 243

Query: 245 IKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNK 304
           +   +WTYN G+IL G AY+YN +    +W  R    L  +   F  N+IM E ACQ   
Sbjct: 244 VTKYQWTYNQGLILSGAAYLYNYSE-SSLWYNRTMTAL-SSSGVFLNNSIMCEAACQPAG 301

Query: 305 ICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWT 364
            C+ DQRSFK+ F+R L VT+ L P TR  I   +          CSGG DG TCGL+W 
Sbjct: 302 TCDTDQRSFKAYFARFLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGLNWF 361

Query: 365 TGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRL 424
            GSWDGYYGLGEQ SALEV+ N     K  P     GG+S GD  AG  T   N+  + L
Sbjct: 362 LGSWDGYYGLGEQMSALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNL--APL 419

Query: 425 NIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           NI    +  AA+ITAV    L+   LW++ 
Sbjct: 420 NITGGSKAAAAIITAVIGISLIACTLWIIF 449

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  404 bits (1038), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 209/445 (46%), Positives = 267/445 (60%), Gaps = 5/445 (1%)

Query: 10  LLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAG 69
           L LL        L LD+ +  S+   T  +  G+MDYY G   G  VGMF  PYYWWEAG
Sbjct: 8   LFLLTFTHRANALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSNPYYWWEAG 67

Query: 70  LVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGA 129
             +  ML+ W+  +N  YN  +  +++ QTG N DYIP NQS TEGNDDQ  WG+  M A
Sbjct: 68  GAWGTMLDYWFFMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAFWGIAAMTA 127

Query: 130 VERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANG 189
            ERNF +    + P WL +AQAVFNTM  RWD+Q+CGGGLRWQIF WN GYDYKN+++NG
Sbjct: 128 AERNFTNPPESS-PQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDYKNSVSNG 186

Query: 190 CLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIE 249
            LF LAARL RYTGN +Y+D A +T+ W+ DV  +    +  V+DG  I  NC  I   +
Sbjct: 187 ALFHLAARLARYTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNCTTITSYQ 246

Query: 250 WTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNND 309
           W+YN G++L G AY+YN T G  +W  R   +L  A + FF N+IMYE ACQ    CNND
Sbjct: 247 WSYNQGLMLAGAAYLYNFT-GSTIWLNRTMDLL-DATSVFFNNSIMYEVACQPTGTCNND 304

Query: 310 QRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWD 369
           QRSFKS  +R L +T+ L   T+  I   L          CSGG DG TCGL+W    WD
Sbjct: 305 QRSFKSYLARFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLNWFDNGWD 364

Query: 370 GYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSK 429
           GYYGLGEQ SAL+V+ N  +  +  P     GG+S GD  AG      N+    +  GSK
Sbjct: 365 GYYGLGEQMSALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNLAPLHITKGSK 424

Query: 430 DRIKAALITAVCLGLLVGTALWMVI 454
             + AA ITA     +V T++W+++
Sbjct: 425 --VGAAFITAAIGLSIVFTSIWIIL 447

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  404 bits (1037), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 211/454 (46%), Positives = 280/454 (61%), Gaps = 9/454 (1%)

Query: 4   IVQLYSLLLLICV-PV-CGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQ 61
           +V+++SLL  I + P+    L++D+    S+  AT  I  G+MDYY G   G ++GMF +
Sbjct: 1   MVKIHSLLFQISLLPLFTNALKIDLDDFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAK 60

Query: 62  PYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGI 121
           PYYWWEAG  +  +L+ WY   N  YN  + E+++ QTG   DY+P NQS TEGNDDQ  
Sbjct: 61  PYYWWEAGGAWGCLLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAF 120

Query: 122 WGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYD 181
           WG+  + A ERNF +    + P WL +AQAVFNTM  RWD   C GGLRWQIF WN GY 
Sbjct: 121 WGIAAITAAERNFTNPP-PDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYS 179

Query: 182 YKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEAN--VFDGAHIG 239
           YKN+++NG LF +AARL RYTGN +Y++ A++ + W+     +  + E    V+DGA+I 
Sbjct: 180 YKNSVSNGALFHIAARLARYTGNQSYVEWADKIYDWMFGTGIISDEYETYKFVYDGANIE 239

Query: 240 DNCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERA 299
            NC DI   +WTYN G++L GCAY+YN T  D  W  R  Q L G+   FFR+N++YE A
Sbjct: 240 TNCTDITRYQWTYNQGLVLAGCAYLYNHTQ-DEKWLIRTEQFLNGS-VVFFRDNVIYEAA 297

Query: 300 CQDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETC 359
           CQ NK CNNDQRSFK+ F+R L VT+ L P TR+TI   +          CSGG DG TC
Sbjct: 298 CQPNKNCNNDQRSFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTC 357

Query: 360 GLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNV 419
           G+DW    WDGYYGLGEQ +ALE + N       PP T   GG+S G   A  GT  D  
Sbjct: 358 GMDWVWKGWDGYYGLGEQMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAA--GTERDPT 415

Query: 420 LHSRLNIGSKDRIKAALITAVCLGLLVGTALWMV 453
             S L+I +  +  A++IT +    ++  A+W+V
Sbjct: 416 NLSPLHITAGSKAGASIITCIVSISILTGAMWLV 449

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  400 bits (1028), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 256/429 (59%), Gaps = 6/429 (1%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           MR++  L  L+ L+ V    GL+LD+    S+  AT  +  G+MDYY G   G  VGMF 
Sbjct: 1   MRLVTLLSGLVSLVSV---FGLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFS 57

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
            PYYWW+AG  +  ML+ WY   N  YN  +  +++ QTG N DY+P NQS TEGNDDQ 
Sbjct: 58  DPYYWWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQA 117

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
            WG+ +M A ER FP+    + P WL + QAVFNTM  RWDS+ CGGGLRWQIF WN GY
Sbjct: 118 FWGIAVMQAAERKFPNPP-DDKPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGY 176

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240
           DYKNT++NG LF +AARL RYTGN +Y+D A   + W+ DV  +       V+DG  I D
Sbjct: 177 DYKNTVSNGALFHIAARLARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSIND 236

Query: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300
           NC  +   +WTYN G++L G AY++N T  D +W  R    L  +R  FF N+I+YE AC
Sbjct: 237 NCTTVTKYQWTYNQGLMLSGSAYLFNMTGSD-LWHERTHAFLNASRV-FFNNSILYEAAC 294

Query: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCG 360
           Q    CN DQRSFK+ F+R L  T+ L P TR+ I   L          CSGG DG TCG
Sbjct: 295 QGPNTCNTDQRSFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCG 354

Query: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420
           L+W    WDG YGLGEQ +ALEV+ N     +APP     GG S GD  AG      N+ 
Sbjct: 355 LNWFRDDWDGMYGLGEQMAALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNLA 414

Query: 421 HSRLNIGSK 429
              +  GS+
Sbjct: 415 PLHITGGSR 423

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  394 bits (1013), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 203/435 (46%), Positives = 264/435 (60%), Gaps = 7/435 (1%)

Query: 22  LQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYL 81
           L LDV    SI  AT  +  G+MDYY G   G  VG F  PYYWWEAG  +  +L+ WY 
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 82  CDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMGN 141
            +N  YN  L +S++ Q G +  Y P N++ TEGNDDQ  WG+ +M A ER  P+    +
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPP-AD 140

Query: 142 VPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGRY 201
            P  L +AQAVFNTM  RWD + C GGLRWQIF WN GY YKN+++NG LF +AARL RY
Sbjct: 141 QPQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRY 200

Query: 202 TGNSTYLDIANETFSWLVDVKFV--VLKDEANVFDGAHIGDNCQDIKGIEWTYNHGVILG 259
           TGN+TYL+ A   + W+  V  +  V  +   V+DG  I DNC ++  ++WTYNHG+I+ 
Sbjct: 201 TGNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMA 260

Query: 260 GCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRSFKSIFSR 319
           GCA++YN T  D +W  R  + L  AR  F  N+ +YE  CQ    CN DQRSFK+ FSR
Sbjct: 261 GCAFIYNHTQ-DELWHQRTLRFLDSAR-IFLSNDTLYEAGCQGGDNCNIDQRSFKAYFSR 318

Query: 320 MLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYYGLGEQAS 379
            L +T+ L P +RETI   +          CSGG+DG TCGL+W    WDG +GLGEQ +
Sbjct: 319 FLGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMA 378

Query: 380 ALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKDRIKAALITA 439
           ALE+IQNL    +  P T   GGTS GDP AG  T  +N+    L+I + DR  A +ITA
Sbjct: 379 ALEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENL--PPLDIKAGDRAGAGIITA 436

Query: 440 VCLGLLVGTALWMVI 454
           +     +   LW++I
Sbjct: 437 LIGSSFLACTLWLII 451

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  393 bits (1010), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 209/457 (45%), Positives = 269/457 (58%), Gaps = 13/457 (2%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           M II  L+++      P+   + L++ S  S+  AT  +  G+MDYY G   G  VGMF 
Sbjct: 1   MNIIYLLFTVSSF-SFPIAA-VDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFS 58

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
            PYYWWEAG  +  ML+ WY   N  YN  +  +++ Q G + +YIP NQS TEGNDDQ 
Sbjct: 59  DPYYWWEAGGAWGTMLDYWYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQA 118

Query: 121 IWGLFIMGAVERNF---PDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWN 177
            WG+ +M A ERNF   P+ Q    P WL +AQAVFNTM  RWD+  CGGGLRWQIF WN
Sbjct: 119 FWGITVMTAAERNFTNPPEDQ----PQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWN 174

Query: 178 LGYDYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAH 237
            GYDYKN+++NG LF +AARL RYTGN +Y+D A   + W+ DV  +       V+DGA 
Sbjct: 175 SGYDYKNSVSNGALFHMAARLARYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGAS 234

Query: 238 IGDNCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYE 297
             DNC  +   +WTYN G++L G AY+YN T  D  W  R  Q+L  A + FF N+I+YE
Sbjct: 235 TTDNCTVLTTYQWTYNQGLLLSGAAYLYNYTGSD-TWLLRTNQLL-NASSVFFNNSILYE 292

Query: 298 RACQDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGE 357
            ACQ +  CNNDQRSFK+ F R L  T+ L   T+ TI   L          CSGG DG 
Sbjct: 293 AACQKSGTCNNDQRSFKAYFLRFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGH 352

Query: 358 TCGLDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMD 417
           TCGL+W +G WDG YGLGEQ SALE + N  +     P     GG+S G+  AG      
Sbjct: 353 TCGLNWFSGGWDGMYGLGEQMSALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEAT 412

Query: 418 NVLHSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
           N+    +  GSK    AA+IT+V    +V   +W++I
Sbjct: 413 NLAPLHITDGSK--AAAAIITSVVGISIVAAGVWLII 447

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  392 bits (1006), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/406 (49%), Positives = 247/406 (60%), Gaps = 3/406 (0%)

Query: 10  LLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAG 69
           L L   V     L +D+ + DSI  AT  I  G+MDYY G   G  VGMF  PYYWWEAG
Sbjct: 17  LALSAVVSKVAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWWEAG 76

Query: 70  LVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGA 129
             +  ML+  +  DN  Y+S +  +M+ QTG + +YIP NQS TEGNDDQ  WG+  M A
Sbjct: 77  GAWGSMLDYSWFMDNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAAMTA 136

Query: 130 VERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANG 189
            ERNF +    + P WL +AQAVFNTM  RWD++ CGGGLRWQIF WN GYDYKNT++NG
Sbjct: 137 AERNFTNPPE-DKPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVSNG 195

Query: 190 CLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIE 249
            LF +A+RL RYTGN +Y+D A + + W+ DV  +       V+DG    DNC  +   +
Sbjct: 196 ALFHMASRLARYTGNQSYVDWAEKVYDWMWDVHVISNSTYMFVYDGVDANDNCSTVTQYQ 255

Query: 250 WTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNN-IMYERACQDNKICNN 308
           WTYNHG++L G AY+YN T GD VW  R ++++  A+ FF     IMYE ACQ    CNN
Sbjct: 256 WTYNHGLLLAGSAYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQAALTCNN 314

Query: 309 DQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSW 368
           DQRSFK+ FSR L +T+ L P TR  I   L          CSGG DG TCGL+W    W
Sbjct: 315 DQRSFKAYFSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWFKDGW 374

Query: 369 DGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGT 414
           DG YGLGEQ SALE I N     K  P T   GG+S G+     G+
Sbjct: 375 DGMYGLGEQMSALECILNTRALMKPAPYTATNGGSSKGESSRWYGS 420

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  390 bits (1002), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 207/449 (46%), Positives = 270/449 (60%), Gaps = 6/449 (1%)

Query: 7   LYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWW 66
           L SLL  +       ++LD+ + DS+  AT  +  G+MDYY G   G  +GMF  PYYWW
Sbjct: 7   LISLLCTVWFRAGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNPYYWW 66

Query: 67  EAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFI 126
           EAG  +  M++ WY   N  YN  + +++  QTG N DY+P NQS TEGNDDQ  WG+ +
Sbjct: 67  EAGGAWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFWGIAV 126

Query: 127 MGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTI 186
           M A ERNF +    + P WL +AQAVFNTM  RWD Q C GGLRWQIF WN GYDYKN++
Sbjct: 127 MSAAERNFTNPP-ADRPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYKNSV 185

Query: 187 ANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDE-ANVFDGAHIGDNCQDI 245
           +NG LF + ARL R+TGN +Y++ A + + W+  V  +    + A V+DG +IGDNC  +
Sbjct: 186 SNGALFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVNIGDNCTKV 245

Query: 246 KGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKI 305
             ++WTYNHG+IL GCAY+YN T GD  W  R  + L  A  FF R  +M+E ACQ    
Sbjct: 246 TNLQWTYNHGLILSGCAYLYNYT-GDAKWYNRTERFLEYAYVFFNR-TVMFEAACQGVHT 303

Query: 306 CNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTT 365
           C  DQR+FK+ FSR L +T+ L P T+ TI   +          CSGG DG TCG++W  
Sbjct: 304 CTTDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGINWFY 363

Query: 366 GSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLN 425
           G WDGYYGLGEQ  ALEV+ N        P     GG+S GD  AG      N+  S LN
Sbjct: 364 GGWDGYYGLGEQMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--SPLN 421

Query: 426 IGSKDRIKAALITAVCLGLLVGTALWMVI 454
           I S  R  A +ITA+    ++   LW+++
Sbjct: 422 ITSGSRAGAGIITAIIGISIIACGLWLIV 450

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  389 bits (999), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/454 (44%), Positives = 269/454 (59%), Gaps = 10/454 (2%)

Query: 1   MRIIVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFI 60
           MR++  L S            + +D+ + +SI  A+  +  G+MDYY G   G  +GMF 
Sbjct: 4   MRLLAALASTF-----ACANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFS 58

Query: 61  QPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQG 120
            PYYWWEAG  +  ML+ W+   N  YN  + ++++ Q G + DY+P NQS TEGNDDQ 
Sbjct: 59  DPYYWWEAGGAWGCMLDYWWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQA 118

Query: 121 IWGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGY 180
            WG+  M A ERNF +    + P WL +AQAVFNTM  RWD+  C GGLRWQIF WN GY
Sbjct: 119 FWGIAAMTAAERNFTNPP-SDQPQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGY 177

Query: 181 DYKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGD 240
           DYKNT++NG LF LAARL RYTGN +Y+D A++ + W+  V  +   +   V+DG +I  
Sbjct: 178 DYKNTVSNGALFNLAARLARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAH 237

Query: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300
           NC +I G +W+YNHG++L GCAY+YN T  D  W  R  + L  A + F+ N+++YE AC
Sbjct: 238 NCANITGYQWSYNHGLMLSGCAYLYNMTK-DEKWGNRTFEYLNSA-SIFYNNSVLYEVAC 295

Query: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCG 360
           Q    CN DQRSFK+ F+R L VT+ L P  R+     +          CSGG DG TCG
Sbjct: 296 QTVNKCNTDQRSFKAYFTRFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCG 355

Query: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420
           ++W    WDG YGLGEQ SALE + N     + PP     GG+S GD  AG      N+ 
Sbjct: 356 INWFYDGWDGMYGLGEQMSALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL- 414

Query: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
            S L+I +  R  A +IT V    ++  ALW+++
Sbjct: 415 -SPLDITAGSRAGAGIITCVIGISILSCALWLIL 447

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  389 bits (998), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 194/441 (43%), Positives = 266/441 (60%), Gaps = 7/441 (1%)

Query: 17  PVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGML 76
           P    L +D+    ++  A+  + +G+MDYY G   G  +GMF  PYYWWEAG  +  ++
Sbjct: 17  PSASALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEAGGAWNTLI 76

Query: 77  ENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPD 136
           + W+   N  YN  + E+++ Q+G N+DY+P NQS  EGNDDQ  WG+ ++ A ER FP+
Sbjct: 77  DYWFYMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLNAAERKFPN 136

Query: 137 AQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAA 196
               + P WL + QAVFNTM  RWD+  CGGGLRWQIFTWN GYDYKNT++NG LF +AA
Sbjct: 137 PP-DDQPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSNGALFHIAA 195

Query: 197 RLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEAN--VFDGAHIGDNCQ-DIKGIEWTYN 253
           RL  +TGNS+Y+D A   + W+ DVK +  +++ N  V+DG  + +NC   +  I WTYN
Sbjct: 196 RLAYFTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIVWTYN 255

Query: 254 HGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRSF 313
           HG++L GCAY+Y  T GD +W  R +  L  A   F+ ++I+YE +CQ +K CN DQRSF
Sbjct: 256 HGLVLSGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEYSCQQSKTCNVDQRSF 314

Query: 314 KSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYYG 373
           KS +S  LA T+ L P  RE I  ++          C GG DG TCG++W    WDG YG
Sbjct: 315 KSYYSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWNQKGWDGQYG 374

Query: 374 LGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKDRIK 433
           LGEQ +ALE +       K  P     GG S GD  AG  T   N+    L+I +  R  
Sbjct: 375 LGEQMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTNL--KPLHITAGSRAG 432

Query: 434 AALITAVCLGLLVGTALWMVI 454
           A +IT V    ++ + LW+V+
Sbjct: 433 AGIITCVVGFSIIASFLWLVM 453

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  381 bits (979), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 273/454 (60%), Gaps = 8/454 (1%)

Query: 4   IVQLYSLLLLICV--PVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQ 61
           +V  +SLLL I V   +   + L++    S+  A   +  G+MDYY G+  G  +GMF  
Sbjct: 1   MVTFHSLLLKISVITTITNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSD 60

Query: 62  PYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGI 121
           PYYWWEAG  +  ML+ WY   N  YN  +YE++  QTG + DYIP NQS TEGNDDQ  
Sbjct: 61  PYYWWEAGGAWGCMLDYWYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAF 120

Query: 122 WGLFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYD 181
           WG+  + A ERNF +    + P WL +AQAVFNTM  RWDS  C GGLRWQIF WN GY 
Sbjct: 121 WGIAAITAAERNFTNPP-PDKPQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYS 179

Query: 182 YKNTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEAN-VFDGAHIGD 240
           YKN+++NG LF +AARL RYTGN +Y+D + + + W++    +        V DG +I  
Sbjct: 180 YKNSVSNGALFHIAARLARYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIET 239

Query: 241 NCQDIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERAC 300
           NC DI   +WTYN G++L GCAY+YN T  D  W  R  Q L G+   FF N+++YE AC
Sbjct: 240 NCTDITPYQWTYNQGLLLAGCAYLYNFTQ-DEKWLIRTNQFLNGS-GVFFNNSVIYEAAC 297

Query: 301 QDNKICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCG 360
           Q NK CNNDQRSFK+ F+R L VT+ L P TR+TI   ++         CSGG DG TCG
Sbjct: 298 QPNKNCNNDQRSFKAYFARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCG 357

Query: 361 LDWTTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVL 420
           +DW    WDGYYGLGEQ +ALE + N       PP T + GG+S G   AG      N+ 
Sbjct: 358 MDWNWNGWDGYYGLGEQMAALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL- 416

Query: 421 HSRLNIGSKDRIKAALITAVCLGLLVGTALWMVI 454
              LNI +  +  A +IT V    ++  ++W+V+
Sbjct: 417 -GPLNITAGSKAGAGIITCVVGISILACSMWLVV 449

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  381 bits (979), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 201/443 (45%), Positives = 261/443 (58%), Gaps = 8/443 (1%)

Query: 14  ICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFA 73
           I       + L++    S+  A   +  G+MDYY G   G  +GMF  PYYWWEAG  + 
Sbjct: 13  ILASFSTAVHLNLNVTSSLQNAASLVAVGLMDYYNGDQYGQTIGMFSNPYYWWEAGGAWG 72

Query: 74  GMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERN 133
            M++ WY   N  YN  + ++++ QTG   DYIP NQS TEGNDDQ  WG+ +M A ERN
Sbjct: 73  CMIDYWYFMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAFWGITVMSAAERN 132

Query: 134 FPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQ 193
           F +    + P WL +AQAVFNTM  RWD   C GGLRWQIF WN GY YKN+++NG LF 
Sbjct: 133 FTNPP-PDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFH 191

Query: 194 LAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEAN-VFDGAHIGDNCQDIKGIEWTY 252
           +AARL RYTGN +Y+D A + + W+     +        V+DGA I  NC DI   +WTY
Sbjct: 192 MAARLARYTGNQSYVDWAVKVYDWMEKTGLISNDTYFKFVYDGASIETNCTDITQFQWTY 251

Query: 253 NHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRS 312
           N G+IL GCAY+YN T  D  W TR  Q + G+ A FF N+I+YE ACQ +K C+NDQRS
Sbjct: 252 NQGLILSGCAYLYNHTE-DSKWLTRTEQFVNGS-AVFFNNSIVYEAACQGSKRCDNDQRS 309

Query: 313 FKSIFSRMLAVTSVLAPFTRETIDPLLEXXXXXXXXXCSGGKDGETCGLDWTTGSWDGYY 372
           F++ F+R L VT+ L P T++ I   +          CSGG DG TCGL+W    WDGYY
Sbjct: 310 FRAYFARFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCGLNWFNIGWDGYY 369

Query: 373 GLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKDRI 432
           GLGEQ  ALE + N        P T + GG+S G+  AG   P  N+    L+I    + 
Sbjct: 370 GLGEQMGALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL--GPLHITDGSKA 427

Query: 433 KAALITAVC-LGLLVGTALWMVI 454
            A +IT V  L +L+ T  W+ +
Sbjct: 428 GAGIITCVIGLSILLCTT-WLAL 449

>CAGL0K10208g Chr11 complement(994696..995625) [930 bp, 309 aa] {ON}
           highly similar to uniprot|P32345 Saccharomyces
           cerevisiae YDR075w PPH3 protein ser/thr phosphatase
          Length = 309

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 24  LDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYLCD 83
           L V + D I  A Q +  G  + +     GG+V ++  P Y +  G V A +     + D
Sbjct: 224 LHVNNVDLIARAHQLVMEGYKEMF----DGGLVTVWSAPNYCYRCGNVAAVL----KIED 275

Query: 84  NMEYNSTLYESMIAQTGANYDYIPSNQSMTE 114
           N+E   T++E++ AQ G     IP+ ++  +
Sbjct: 276 NLERKYTIFEAVQAQNGVGNTIIPTKKAQMD 306

>NDAI0C05940 Chr3 (1359850..1360779) [930 bp, 309 aa] {ON} Anc_8.199
          Length = 309

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 43  IMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGAN 102
           +M+ Y     GG+V ++  P Y +  G V A +     + D++E N T++E++  Q G  
Sbjct: 239 VMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVL----RIEDDLERNYTIFEAVQPQDGVG 294

Query: 103 YDYIPSNQ 110
              IP+ +
Sbjct: 295 NTIIPTKK 302

>Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ACR078W
          Length = 482

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 42/110 (38%), Gaps = 9/110 (8%)

Query: 206 TYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEWTYNHGVILGGCA-YM 264
           T LD+       L  VK  VL +  N+ D   +GD C  +K          +   C   +
Sbjct: 219 TVLDLMRRKMIQLGTVKVFVLDEADNMLDKQGLGDQCIRVKKF--------LPKDCQLVL 270

Query: 265 YNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRSFK 314
           ++AT  D V     R +         RN +  E   Q    CN+++  F+
Sbjct: 271 FSATFDDSVRNYARRVVPDANSLELERNEVNVEAIRQLFMDCNDEKHKFQ 320

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,619,837
Number of extensions: 2155640
Number of successful extensions: 4058
Number of sequences better than 10.0: 56
Number of HSP's gapped: 4008
Number of HSP's successfully gapped: 56
Length of query: 454
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 341
Effective length of database: 40,524,141
Effective search space: 13818732081
Effective search space used: 13818732081
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)