Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12921.398ON34734714460.0
AAL008W1.398ON34935111281e-154
SAKL0D08778g1.398ON34835510561e-143
KLTH0H12100g1.398ON35035010121e-137
NCAS0C048901.398ON3673679701e-130
YNL007C (SIS1)1.398ON3523539631e-129
NDAI0C026101.398ON3403529501e-127
NDAI0G042501.398ON3633619461e-126
Kwal_0.2071.398ON3532017392e-95
TDEL0B059601.398ON3691827184e-92
KLLA0D04818g1.398ON3541827104e-91
NCAS0G036101.398ON3271766936e-89
Smik_14.3211.398ON3661826976e-89
ZYRO0E04598g1.398ON3571826967e-89
CAGL0H03707g1.398ON3491846941e-88
Skud_14.3201.398ON3681826906e-88
Suva_14.3411.398ON3591826889e-88
KAFR0H031501.398ON3591826811e-86
TBLA0C014801.398ON3531806774e-86
TPHA0B037601.398ON3551786281e-78
Kpol_457.151.398ON3571766262e-78
KNAG0H016801.398ON3631083328e-35
Kpol_1003.122.243ON408722532e-23
TBLA0E038102.243ON410722522e-23
CAGL0J09966g2.243ON407722424e-22
KLLA0F03333g2.243ON409722425e-22
TPHA0C031102.243ON407692401e-21
SAKL0E08734g2.243ON411682372e-21
NCAS0G030002.243ON410682311e-20
KAFR0J009402.243ON411702293e-20
ADL257C2.243ON410682274e-20
Ecym_32812.243ON409682275e-20
Smik_14.2632.243ON409722266e-20
KNAG0I019002.243ON409722213e-19
YNL064C (YDJ1)2.243ON409702213e-19
Skud_14.2682.243ON410702213e-19
Suva_14.2772.243ON409702195e-19
Kwal_23.48302.243ON411682188e-19
ZYRO0A01496g2.243ON412722171e-18
KLTH0G09394g2.243ON411682125e-18
NDAI0D010302.243ON411692117e-18
TDEL0C046002.243ON411692108e-18
AER427W2.218ON470711967e-16
TPHA0L007907.157ON446731941e-15
Ecym_53842.218ON503731932e-15
TBLA0A011007.157ON434711922e-15
TDEL0C043502.218ON462711896e-15
TBLA0J018707.157ON470731861e-14
KLLA0E07899g2.218ON495711852e-14
CAGL0J10296g2.218ON479711852e-14
NDAI0A028207.157ON482711842e-14
CAGL0J02750g7.217ON382711832e-14
KNAG0L013307.217ON396711805e-14
NCAS0E029307.217ON387711798e-14
TBLA0E036602.218ON448711808e-14
YIR004W (DJP1)7.157ON432711799e-14
Kpol_1070.227.217ON380711781e-13
ZYRO0C15048g2.218ON491711791e-13
SAKL0F04444g7.157ON429731781e-13
KLTH0A03740g7.217ON395731771e-13
NCAS0A132107.157ON414711772e-13
Ecym_43727.217ON579721782e-13
Kwal_47.181337.217ON393731772e-13
Skud_5.1587.217ON391731762e-13
Kpol_1002.1222.218ON503711763e-13
Kpol_1064.408.730ON387661753e-13
ADR015W7.157ON436731754e-13
Smik_5.1737.217ON391731744e-13
Suva_9.2137.157ON431711744e-13
Skud_9.1817.157ON421711744e-13
TDEL0H022907.217ON387711735e-13
Smik_9.2037.157ON432711735e-13
TPHA0C012607.217ON380711726e-13
YER048C (CAJ1)7.217ON391731727e-13
SAKL0H16984g8.264ON435701727e-13
KAFR0B047807.157ON423711728e-13
KLTH0F13398g7.157ON419731711e-12
NDAI0E045607.217ON394711701e-12
KLTH0G08756g2.218ON462711711e-12
YNL077W (APJ1)2.218ON528711711e-12
ZYRO0C01606g8.264ON432681701e-12
Kwal_23.30612.218ON458661701e-12
KAFR0A041608.730ON378731691e-12
Kpol_499.307.157ON408731701e-12
Smik_14.2492.218ON533711701e-12
KNAG0I007407.157ON425711692e-12
KAFR0C024507.217ON373731682e-12
ZYRO0G03850g7.157ON418731682e-12
Suva_14.2622.218ON536711692e-12
ZYRO0D16390g7.217ON398711673e-12
SAKL0F08052g7.217ON393711673e-12
KAFR0L007407.217ON364711673e-12
CAGL0L00957g7.217ON373731673e-12
NCAS0B050308.264ON433721673e-12
Ecym_44697.157ON433711673e-12
TDEL0H032107.157ON411731673e-12
TPHA0C029802.218ON554711683e-12
NDAI0B020008.264ON433681673e-12
Kwal_26.90248.730ON375731664e-12
TDEL0B037908.730ON373661664e-12
TBLA0E024907.217ON366711655e-12
TBLA0D042407.217ON389711655e-12
Skud_14.2532.218ON532711665e-12
SAKL0E09306g2.218ON461701655e-12
ZYRO0F15400g2.15ON525651666e-12
CAGL0J01936g7.157ON425711656e-12
KNAG0M020202.218ON460671656e-12
Suva_5.1507.217ON391731647e-12
SAKL0H05258g8.730ON368661647e-12
KLLA0F19184g8.264ON512671648e-12
KLLA0D13464g7.157ON433741631e-11
KLLA0E04423g7.217ON428731621e-11
KLTH0D12496g8.730ON375731621e-11
Kwal_55.209657.157ON421721612e-11
TDEL0F039108.264ON429701612e-11
AGR084C8.264ON427681612e-11
CAGL0F03729g8.730ON361661602e-11
Ecym_56262.350ON243671572e-11
Ecym_62368.730ON374661602e-11
Smik_12.1498.264ON460691603e-11
ZYRO0A06226g8.730ON377661593e-11
AER346W8.730ON367661583e-11
Ecym_43068.264ON434681584e-11
YLR090W (XDJ1)8.264ON459691576e-11
KNAG0G028808.730ON378661567e-11
NDAI0F038002.15ON638671577e-11
Smik_14.1062.15ON593641578e-11
Suva_10.1748.264ON456681569e-11
YNL227C (JJJ1)2.15ON590671569e-11
NCAS0B005308.730ON375661541e-10
KAFR0A079502.15ON551671551e-10
NCAS0D009602.350ON224651501e-10
KLLA0C07260g8.730ON368661532e-10
AFL190C2.350ON235671492e-10
CAGL0H04499g2.350ON232651492e-10
ZYRO0A07502g2.350ON238661492e-10
ABL194C2.15ON552671532e-10
SAKL0E06050g2.350ON232651482e-10
TBLA0G001702.15ON659671532e-10
Skud_12.1588.264ON455721522e-10
Kwal_56.237828.264ON414671513e-10
Kwal_23.44202.15ON592671523e-10
Suva_13.3978.730ON375661513e-10
KNAG0F008602.15ON626671523e-10
CAGL0J07370g2.15ON623671523e-10
Suva_14.1162.15ON600671523e-10
CAGL0G07469g8.698ON668701524e-10
KAFR0B048902.350ON220651464e-10
Skud_13.3232.350ON224651464e-10
SAKL0E14234g2.15ON678671515e-10
TBLA0B093802.350ON227651465e-10
KLTH0G13640g8.264ON414671495e-10
TDEL0E005002.15ON581671505e-10
NCAS0G013602.15ON616671497e-10
KLTH0B08338g2.15ON590671498e-10
Smik_13.4228.730ON378661479e-10
TDEL0G028002.350ON225651431e-09
YMR161W (HLJ1)2.350ON224651431e-09
Kpol_529.212.15ON622671481e-09
Kpol_526.62.350ON228651421e-09
TPHA0C045902.350ON233671421e-09
KLTH0F09944g2.350ON233651422e-09
NDAI0F024502.218ON530671462e-09
KLLA0E01629g2.350ON231661422e-09
Skud_14.1102.15ON596641462e-09
YMR214W (SCJ1)8.730ON377661442e-09
TPHA0O019402.15ON598671452e-09
KLLA0D19602g2.15ON620671453e-09
KNAG0I008602.350ON219661393e-09
Smik_13.3612.350ON224651393e-09
Skud_13.3838.730ON375661433e-09
TPHA0G006308.730ON393641423e-09
Suva_13.3402.350ON225661377e-09
NDAI0E008708.730ON376661381e-08
ADL111W7.217ON578721391e-08
Kwal_23.3578singletonOFF85631252e-08
NDAI0H031802.350ON229651333e-08
SAKL0C02904g1.92ON281741333e-08
Kwal_33.135331.113ON161691283e-08
Kpol_1072.48.698ON661701346e-08
TPHA0A017908.264ON439701336e-08
Kpol_543.408.264ON414641328e-08
AFR507W8.61ON474621329e-08
ZYRO0D10934g8.698ON663701329e-08
Smik_10.1681.297ON649661302e-07
NCAS0C012208.698ON669701302e-07
KNAG0G020508.264ON432561292e-07
ZYRO0G18436g1.185ON503671283e-07
Ecym_10971.92ON270731254e-07
TDEL0A064308.698ON666701274e-07
AFR639W1.113ON156591204e-07
KLLA0C09823g8.698ON669701274e-07
KAFR0A015301.92ON277491236e-07
KNAG0G011308.61ON500611256e-07
TBLA0A055601.92ON312701237e-07
TBLA0B037308.698ON693701248e-07
KAFR0G009101.113ON163651171e-06
TDEL0C036801.185ON556681231e-06
KNAG0A056502.350ON175631171e-06
KLTH0G18546gna 1ON283651201e-06
TBLA0B034908.730ON384651211e-06
CAGL0H02827g1.297ON656671221e-06
KAFR0H023108.698ON655701222e-06
TPHA0G014808.698ON660701222e-06
CAGL0L12276g8.264ON452701212e-06
Kwal_26.88798.698ON656701222e-06
TPHA0D005508.61ON486631212e-06
Smik_15.4378.698ON663761203e-06
Kwal_33.138601.185ON578671194e-06
KNAG0J018408.698ON650701194e-06
NDAI0B002001.185ON594671194e-06
TBLA0D026008.61ON5101361184e-06
KAFR0F018101.185ON555631185e-06
KLTH0F03124g1.113ON162691125e-06
NCAS0I028301.185ON491661175e-06
Skud_15.4208.698ON665761186e-06
YJL073W (JEM1)1.297ON645661186e-06
SAKL0D06226g1.297ON615661176e-06
KLTH0D11770g8.698ON652701176e-06
Skud_10.1691.297ON644661177e-06
YOR254C (SEC63)8.698ON663761177e-06
Suva_8.3038.698ON664701168e-06
TDEL0C058801.113ON159621091e-05
AFR659W1.92ON273711131e-05
SAKL0B01276gna 1ON292671131e-05
KLTH0H10032g1.297ON607661141e-05
TPHA0A056505.4ON433771141e-05
SAKL0H05984g8.698ON658701142e-05
KLTH0F04906g1.185ON590671132e-05
KNAG0B052401.297ON668661132e-05
Ecym_23748.698ON661701122e-05
KLTH0B09570g5.4ON428711122e-05
Kpol_2000.561.92ON290671112e-05
Suva_6.1481.297ON642661123e-05
SAKL0H00858g5.4ON432711113e-05
SAKL0C03476g1.113ON165661073e-05
NDAI0K012308.698ON680701113e-05
TBLA0C071605.4ON430721104e-05
TPHA0A028101.185ON492661104e-05
Kwal_14.24521.297ON607661104e-05
KNAG0B018901.92ON370721094e-05
CAGL0I06226g1.185ON455611095e-05
Ecym_63181.297ON624661105e-05
Kwal_14.1174na 1ON284631086e-05
SAKL0C05456g1.185ON583651096e-05
NCAS0G028502.218ON494721087e-05
ADL327W3.350ON305711078e-05
Smik_10.681.185ON560641088e-05
Kpol_1060.35.4ON432761079e-05
Kwal_26.94955.4ON428711061e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1292
         (347 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...   561   0.0  
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...   439   e-154
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...   411   e-143
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...   394   e-137
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398    378   e-130
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...   375   e-129
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}              370   e-127
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...   369   e-126
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...   289   2e-95
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...   281   4e-92
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...   278   4e-91
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398     271   6e-89
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...   273   6e-89
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...   272   7e-89
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...   271   1e-88
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...   270   6e-88
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...   269   9e-88
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...   266   1e-86
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...   265   4e-86
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...   246   1e-78
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...   245   2e-78
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...   132   8e-35
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   102   2e-23
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   101   2e-23
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...    98   4e-22
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...    98   5e-22
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...    97   1e-21
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...    96   2e-21
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...    94   1e-20
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...    93   3e-20
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...    92   4e-20
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...    92   5e-20
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...    92   6e-20
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...    90   3e-19
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...    90   3e-19
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...    90   3e-19
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...    89   5e-19
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...    89   8e-19
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...    88   1e-18
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...    86   5e-18
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...    86   7e-18
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...    86   8e-18
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...    80   7e-16
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    79   1e-15
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    79   2e-15
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    79   2e-15
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...    77   6e-15
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    76   1e-14
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    76   2e-14
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    76   2e-14
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    75   2e-14
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    75   2e-14
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    74   5e-14
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     74   8e-14
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    74   8e-14
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    74   9e-14
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    73   1e-13
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    74   1e-13
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    73   1e-13
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    73   1e-13
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    73   2e-13
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    73   2e-13
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    73   2e-13
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    72   2e-13
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    72   3e-13
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    72   3e-13
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    72   4e-13
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    72   4e-13
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    72   4e-13
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    72   4e-13
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    71   5e-13
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    71   5e-13
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    71   6e-13
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    71   7e-13
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...    71   7e-13
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               71   8e-13
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    70   1e-12
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             70   1e-12
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...    70   1e-12
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    70   1e-12
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...    70   1e-12
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...    70   1e-12
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...    70   1e-12
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    70   1e-12
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    70   1e-12
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    70   2e-12
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    69   2e-12
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    69   2e-12
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    70   2e-12
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    69   3e-12
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    69   3e-12
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    69   3e-12
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    69   3e-12
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264     69   3e-12
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    69   3e-12
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    69   3e-12
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    69   3e-12
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264     69   3e-12
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    69   4e-12
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    69   4e-12
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    68   5e-12
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    68   5e-12
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    69   5e-12
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...    68   5e-12
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    69   6e-12
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    68   6e-12
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...    68   6e-12
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    68   7e-12
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    68   7e-12
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...    68   8e-12
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    67   1e-11
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    67   1e-11
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    67   1e-11
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    67   2e-11
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...    67   2e-11
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...    67   2e-11
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    66   2e-11
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    65   2e-11
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...    66   2e-11
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...    66   3e-11
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    66   3e-11
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    65   3e-11
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...    65   4e-11
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...    65   6e-11
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    65   7e-11
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      65   7e-11
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    65   8e-11
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...    65   9e-11
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    65   9e-11
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       64   1e-10
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    64   1e-10
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    62   1e-10
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...    64   2e-10
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    62   2e-10
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    62   2e-10
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    62   2e-10
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    64   2e-10
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    62   2e-10
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    64   2e-10
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...    63   2e-10
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...    63   3e-10
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    63   3e-10
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    63   3e-10
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    63   3e-10
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    63   3e-10
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    63   3e-10
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    63   4e-10
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    61   4e-10
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    61   4e-10
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    63   5e-10
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    61   5e-10
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...    62   5e-10
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    62   5e-10
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    62   7e-10
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    62   8e-10
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    61   9e-10
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    60   1e-09
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    60   1e-09
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    62   1e-09
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    59   1e-09
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    59   1e-09
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    59   2e-09
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    61   2e-09
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    59   2e-09
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    61   2e-09
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    60   2e-09
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    60   2e-09
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    60   3e-09
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    58   3e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    58   3e-09
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    60   3e-09
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    59   3e-09
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    57   7e-09
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    58   1e-08
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    58   1e-08
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    53   2e-08
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      56   3e-08
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    56   3e-08
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    54   3e-08
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    56   6e-08
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...    56   6e-08
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...    55   8e-08
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    55   9e-08
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    55   9e-08
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    55   2e-07
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     55   2e-07
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...    54   2e-07
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    54   3e-07
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    53   4e-07
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    54   4e-07
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    51   4e-07
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    54   4e-07
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    52   6e-07
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    53   6e-07
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    52   7e-07
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    52   8e-07
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    50   1e-06
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    52   1e-06
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    50   1e-06
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    51   1e-06
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    51   1e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    52   1e-06
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    52   2e-06
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    52   2e-06
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...    51   2e-06
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    52   2e-06
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    51   2e-06
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    51   3e-06
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    50   4e-06
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    50   4e-06
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       50   4e-06
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    50   4e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    50   5e-06
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    48   5e-06
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    50   5e-06
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    50   6e-06
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    50   6e-06
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    50   6e-06
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    50   6e-06
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    50   7e-06
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    50   7e-06
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    49   8e-06
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    47   1e-05
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    48   1e-05
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    48   1e-05
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    49   1e-05
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    49   1e-05
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    49   2e-05
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    48   2e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    48   2e-05
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    48   2e-05
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    48   2e-05
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    47   2e-05
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    48   3e-05
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    47   3e-05
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    46   3e-05
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    47   3e-05
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    47   4e-05
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    47   4e-05
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    47   4e-05
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    47   4e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    47   5e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    47   5e-05
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    46   6e-05
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    47   6e-05
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     46   7e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    46   8e-05
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    46   8e-05
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    46   9e-05
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    45   1e-04
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    45   1e-04
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    46   1e-04
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    45   1e-04
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    45   1e-04
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    45   2e-04
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    45   2e-04
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    45   2e-04
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    44   2e-04
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    45   2e-04
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    45   2e-04
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    43   3e-04
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    44   3e-04
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    44   3e-04
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    44   3e-04
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    44   3e-04
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    44   3e-04
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    44   4e-04
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    44   4e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    44   5e-04
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    44   5e-04
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    44   5e-04
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    43   6e-04
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    42   7e-04
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    43   8e-04
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    42   8e-04
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    43   9e-04
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    43   0.001
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    43   0.001
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    42   0.001
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    43   0.001
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    43   0.001
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    43   0.001
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    42   0.001
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    42   0.001
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    42   0.001
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    42   0.001
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    42   0.001
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         42   0.001
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    42   0.001
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    42   0.002
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    42   0.002
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    42   0.002
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    40   0.002
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    41   0.002
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    42   0.002
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    42   0.002
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    41   0.003
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    41   0.003
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    41   0.003
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    40   0.005
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    40   0.005
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    40   0.005
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    40   0.005
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    39   0.006
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    40   0.006
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    39   0.007
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    39   0.007
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    39   0.008
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    40   0.009
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    40   0.009
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    39   0.009
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    40   0.010
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    39   0.011
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    40   0.011
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    38   0.011
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    39   0.012
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    39   0.012
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    39   0.012
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    39   0.014
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    39   0.016
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    39   0.018
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    38   0.021
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    39   0.024
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    39   0.024
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    37   0.025
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    38   0.032
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    37   0.035
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    37   0.042
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    37   0.043
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    37   0.043
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    37   0.051
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    37   0.052
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    36   0.053
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    37   0.060
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    37   0.063
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    37   0.070
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    37   0.071
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    37   0.072
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    36   0.084
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    36   0.090
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    36   0.11 
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    35   0.14 
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    35   0.15 
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    35   0.16 
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    35   0.22 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    35   0.24 
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    34   0.25 
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    34   0.25 
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    34   0.26 
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    35   0.32 
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    34   0.36 
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    34   0.38 
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    33   0.42 
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    34   0.42 
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    33   0.48 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    34   0.48 
KNAG0C01680 Chr3 (335056..337689) [2634 bp, 877 aa] {ON} Anc_1.3...    33   0.94 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    33   1.2  
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    32   1.5  
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    32   2.1  
YPR061C Chr16 complement(675977..676882) [906 bp, 301 aa] {ON}  ...    32   2.2  
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    31   4.8  
KLTH0H04532g Chr8 complement(404281..404928) [648 bp, 215 aa] {O...    30   5.2  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    30   6.4  
KLTH0E05522g Chr5 (488343..488969) [627 bp, 208 aa] {ON} conserv...    30   6.6  
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    30   7.0  

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
           similar to Ashbya gossypii AAL008W
          Length = 347

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/347 (81%), Positives = 284/347 (81%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK
Sbjct: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQXXXXXXXXX 120
           REVYDKYGLE                              SQEDAFNIFSQ         
Sbjct: 61  REVYDKYGLEAARGNGPAGFGGQAGAGGGFSGFGGGGHAFSQEDAFNIFSQFFGNSAGGA 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXHSTSTGMPGGFSGMPGASGMHSHSHAQQEEKVVQVN 180
                                   HSTSTGMPGGFSGMPGASGMHSHSHAQQEEKVVQVN
Sbjct: 121 SPFGFSSGGDEFGFGGGFPGGASFHSTSTGMPGGFSGMPGASGMHSHSHAQQEEKVVQVN 180

Query: 181 LPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGG 240
           LPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGG
Sbjct: 181 LPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGG 240

Query: 241 RQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQP 300
           RQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQP
Sbjct: 241 RQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQP 300

Query: 301 SEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
           SEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF
Sbjct: 301 SEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score =  439 bits (1128), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 248/351 (70%), Positives = 263/351 (74%), Gaps = 6/351 (1%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP+ +DAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DPNK
Sbjct: 1   MVKETKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPNK 60

Query: 61  REVYDKYGLEXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQXXXXXX 117
           REVYD YGLE                                 SQEDAFNIFSQ      
Sbjct: 61  REVYDTYGLEAARGNAPSGFGGAGPGGAGFGGFSTGGGGRHAFSQEDAFNIFSQFFGNSA 120

Query: 118 XXXXX-XXXXXXXXXXXXXXXXXXXXXXHSTSTGMPGGFSGMPGASGMHSHSHAQQEEKV 176
                                       H++S GMPGGF GMPG+SGMHSHS  Q EEK+
Sbjct: 121 GGASSPFGFSSAGGDEFGFGGFPGGAGLHTSSGGMPGGFGGMPGSSGMHSHS--QPEEKL 178

Query: 177 VQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNP 236
           VQVNLPVSLEDL+ GKRKSFKITRKG +GIPEKKQIDIQLRPGWKAGTKITYKNEGDYNP
Sbjct: 179 VQVNLPVSLEDLFVGKRKSFKITRKGQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNP 238

Query: 237 STGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQ 296
           STGGRQT+QFIIQEK H+F KRDGNDL YTLPL+FKESLLGF KTV TIDGRQI I KTQ
Sbjct: 239 STGGRQTIQFIIQEKPHEFFKRDGNDLIYTLPLTFKESLLGFDKTVRTIDGRQISIHKTQ 298

Query: 297 PVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
           PVQPSEE RYPGQGMPLSKNPSERGDLIVKYK DYPITL+E+Q+ AI  NF
Sbjct: 299 PVQPSEEMRYPGQGMPLSKNPSERGDLIVKYKTDYPITLTEKQRRAILENF 349

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
           to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score =  411 bits (1056), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 215/355 (60%), Positives = 245/355 (69%), Gaps = 15/355 (4%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVK+TKLYDLLGVSP+ ++ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDP K
Sbjct: 1   MVKDTKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXSQEDAFNIFSQXXXX 115
           RE+YD YGLE                                   SQEDAFNIFSQ    
Sbjct: 61  REIYDSYGLEAARNGGPSFGGAGAGAGGFPGGAGGFPGGAGQHAFSQEDAFNIFSQFFGG 120

Query: 116 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXHST---STGMPGGFSGMPGASGMHSHSHAQQ 172
                                          T   ++GMPGGF G        S +  Q+
Sbjct: 121 GSSMGGGSPFGFSTGGDENYGFSSGGFPGGGTSFHTSGMPGGFGGA-------SRAAPQR 173

Query: 173 EEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEG 232
           EE+ VQVNLPVSLEDL+AG++KSFKITRKGP  +PEKKQIDIQ++PGWKAGTKIT+KNEG
Sbjct: 174 EEETVQVNLPVSLEDLFAGRKKSFKITRKGPGSVPEKKQIDIQMKPGWKAGTKITFKNEG 233

Query: 233 DYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFI 292
           DYN  TGGRQT+QF+IQEK+H   KRDGN+L YTLPLSFKESLLGFSKT+ TIDGR + I
Sbjct: 234 DYNQQTGGRQTMQFVIQEKLHPHFKRDGNNLIYTLPLSFKESLLGFSKTIQTIDGRTLPI 293

Query: 293 SKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
           S+ QP+QPSE S YPGQGMPL K P++RGDLI+KYK+DYPI L+E QK AIA NF
Sbjct: 294 SRVQPIQPSETSTYPGQGMPLPKTPAQRGDLIIKYKVDYPIGLNEAQKRAIAENF 348

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
           {ON} some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 350

 Score =  394 bits (1012), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 236/350 (67%), Gaps = 3/350 (0%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVK+TKLYDLLGVSP+  + ELKKGYRKAALKYHPDKPTGD EKFKEISEAFEILNDP K
Sbjct: 1   MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAEKFKEISEAFEILNDPQK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQXXXXXXXXX 120
           RE+YD YGLE                              S EDAFNIFSQ         
Sbjct: 61  REIYDNYGLEAARNGGPAFGGAGGAGGAGGHPGFASSHSFSNEDAFNIFSQFFGGGSGGA 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXHSTSTGMPG---GFSGMPGASGMHSHSHAQQEEKVV 177
                                        G  G      GMPG       S    EEK V
Sbjct: 121 SPFGFGGDDAFGGGFPGGGSSGFSTGGFPGGAGFRTTTGGMPGGFSSSGASSPLPEEKTV 180

Query: 178 QVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPS 237
           QVNLPVSLEDL++GK+KSFKITRKGP G PEK+Q+DIQLRPGWKAGTKITYKNEGDYNP 
Sbjct: 181 QVNLPVSLEDLFSGKKKSFKITRKGPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPR 240

Query: 238 TGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQP 297
           TG RQT+QFIIQEK H+   RDGNDL YTLPL+FKESLLGF+KT+ TIDGR + IS+ QP
Sbjct: 241 TGRRQTMQFIIQEKPHENYTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPISRVQP 300

Query: 298 VQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
           VQPS+ S YPGQGMP++KNPS+RG+LIVKYKIDYP TL++ Q+ AI+ NF
Sbjct: 301 VQPSDVSTYPGQGMPVAKNPSQRGNLIVKYKIDYPATLNDSQRRAISENF 350

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398
          Length = 367

 Score =  378 bits (970), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 206/367 (56%), Positives = 239/367 (65%), Gaps = 20/367 (5%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLL V P  N+ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDP K
Sbjct: 1   MVKETKLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REVYDKYGLEXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQ-------- 111
           RE+YD+YGLE                               S EDAFNIFSQ        
Sbjct: 61  REIYDQYGLEAARNGGAIPTSDGGASFQGGFPGGAGGAHAFSNEDAFNIFSQFFGGGSGL 120

Query: 112 --XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSTSTGMPGGFS--GMPGA------ 161
                                               S++ GMPGGFS  GMPG       
Sbjct: 121 GGDAGFGGFPSGSNIRFSSSGFPGGGSSSGGFPSGFSSTGGMPGGFSSGGMPGGFSSGGM 180

Query: 162 -SGMHSHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGW 220
             G  S S  QQEEK  +V+LPVSLEDL+ GK+KSFK+ RKGP G  EK QIDIQL+PGW
Sbjct: 181 PGGYRSPSPEQQEEKTDEVHLPVSLEDLFVGKKKSFKVGRKGPDGKHEKTQIDIQLKPGW 240

Query: 221 KAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSK 280
           KAGTKITYK++GDYNP TGGR+TLQFII EK H   KR+ ++L YTLPL+FKESLLGFSK
Sbjct: 241 KAGTKITYKSKGDYNPKTGGRKTLQFIISEKPHPHFKREDDNLIYTLPLTFKESLLGFSK 300

Query: 281 TVHTIDGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQK 340
           T+ TIDG+ + +S+ QPVQPSE + YPGQGMP++K P +RGDL++KYK+DYPI L+  Q+
Sbjct: 301 TIQTIDGKNLPLSRGQPVQPSETTTYPGQGMPITKKPGQRGDLLIKYKVDYPINLTPAQR 360

Query: 341 LAIAGNF 347
            AI+ NF
Sbjct: 361 EAISNNF 367

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
           SIS1Type II HSP40 co-chaperone that interacts with the
           HSP70 protein Ssa1p; not functionally redundant with
           Ydj1p due to due to substrate specificity; shares
           similarity with bacterial DnaJ proteins
          Length = 352

 Score =  375 bits (963), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 206/353 (58%), Positives = 229/353 (64%), Gaps = 7/353 (1%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP+ N+ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDP K
Sbjct: 1   MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXSQEDAFNIFSQXXX 114
           RE+YD+YGLE                                    S EDAFNIFSQ   
Sbjct: 61  REIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQFFG 120

Query: 115 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSTSTGMPGGFSGMPGASGMHSHSHAQQEE 174
                                                 G      G     S     +EE
Sbjct: 121 GSSPFGGADDSGFSFSSYPSGGGAGMGGMPGGMGGMHGGMGGMPGGFRSASSSPTYPEEE 180

Query: 175 KVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDY 234
             VQVNLPVSLEDL+ GK+KSFKI RKGP G  EK QIDIQL+PGWKAGTKITYKN+GDY
Sbjct: 181 -TVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDY 239

Query: 235 NPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISK 294
           NP TG R+TLQF+IQEK H   KRDG+DL YTLPLSFKESLLGFSKT+ TIDGR + +S+
Sbjct: 240 NPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSR 299

Query: 295 TQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
            QPVQPS+ S YPGQGMP  KNPS+RG+LIVKYK+DYPI+L++ QK AI  NF
Sbjct: 300 VQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF 352

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score =  370 bits (950), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 203/352 (57%), Positives = 236/352 (67%), Gaps = 17/352 (4%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP+ ND E+KKGYRKAAL+YHPDKPTG+TEKFK+ISEA+EIL+D NK
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTEKFKQISEAYEILSDSNK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQXXX-----X 115
           REVYD+YGLE                              S +DAFNIFSQ         
Sbjct: 61  REVYDQYGLEAARSGGPSFGGAGGAGGFPGGAHSF-----SNDDAFNIFSQFFSGGDPFG 115

Query: 116 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSTSTGMPGGFSGMPGASGMHSHSHAQQEEK 175
                                             GMPGGF    GAS        + EE+
Sbjct: 116 GHSAGGFGGMPGGMGGMGGMPGGMGGMPSMGGMGGMPGGFRSATGAS-------QRPEEE 168

Query: 176 VVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYN 235
           VV VNLPVSLEDL+ GK+KSFKI RKGP G  EKKQIDIQL+ GWKAGTKITYKNEGD+N
Sbjct: 169 VVTVNLPVSLEDLFTGKKKSFKIGRKGPGGSQEKKQIDIQLKRGWKAGTKITYKNEGDFN 228

Query: 236 PSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKT 295
           P TGGR+TLQF++QEK H   KRDG +L YT+PLSF+ESLLGFSKTV TIDGR + +S+T
Sbjct: 229 PRTGGRKTLQFVLQEKAHPLFKRDGENLLYTVPLSFQESLLGFSKTVQTIDGRSLSLSRT 288

Query: 296 QPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
           QP+QP+E + YPGQGMP  KNP++RGDLI+ YKIDYPI+LS+ Q+ AI  NF
Sbjct: 289 QPIQPTETTTYPGQGMPNPKNPNQRGDLIITYKIDYPISLSDAQRQAIQQNF 340

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
           Anc_1.398
          Length = 363

 Score =  369 bits (946), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 239/361 (66%), Gaps = 14/361 (3%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGV+P+ N+ E+KKGYRKAALKYHPDKPTGDTEKFK+ISEA+EIL+D NK
Sbjct: 1   MVKETKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKQISEAYEILSDSNK 60

Query: 61  REVYDKYGLEXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQXXXXXX 117
           RE+YD+YGLE                                 S EDAFNIFSQ      
Sbjct: 61  REIYDQYGLEAARNGGAMPMPGQDGTTFTSTGGFPGGGGAHAFSNEDAFNIFSQFFGGGG 120

Query: 118 XXXXXXXXX-----XXXXXXXXXXXXXXXXXXHSTSTGMPGGFS-----GMP-GASGMHS 166
                                              S  MPGGFS     G+P G +  + 
Sbjct: 121 SDGGFGFQSFPGSGGSGHTNVKFSSSGFPGGFGGMSQEMPGGFSSASTGGIPNGFNSPYE 180

Query: 167 HSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKI 226
              + QEE V +V++ VSLEDL+AGK+KSFKI RKGP G+ EK QIDIQL+PGWKAGTK+
Sbjct: 181 ERMSAQEEGVDEVHISVSLEDLFAGKKKSFKIGRKGPGGVQEKTQIDIQLKPGWKAGTKL 240

Query: 227 TYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTID 286
           TYKN+GDYNP T GR+TLQFII EK H   +R+ ++L  T+PL+FKESLLGFSKTV TID
Sbjct: 241 TYKNKGDYNPRTHGRKTLQFIIDEKPHPTFQREDDNLVCTVPLTFKESLLGFSKTVQTID 300

Query: 287 GRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGN 346
           GR + IS++QP+QP+E +RYPGQGMP+SK P +RGDLIVKYKI YPITL++ Q+ AI  N
Sbjct: 301 GRNLPISRSQPIQPTEITRYPGQGMPISKKPGQRGDLIVKYKIAYPITLTQAQRDAIKTN 360

Query: 347 F 347
           F
Sbjct: 361 F 361

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
           YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
           82] FULL
          Length = 353

 Score =  289 bits (739), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 165/201 (82%), Gaps = 8/201 (3%)

Query: 147 TSTGMPGGFSGMPGASGMHSHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGI 206
           T+ GMPGGFS   GAS          EEKVVQVNLPVSLEDL++GK+KSFKITRKGP G 
Sbjct: 161 TAGGMPGGFSS--GAS------SPPPEEKVVQVNLPVSLEDLFSGKKKSFKITRKGPGGA 212

Query: 207 PEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYT 266
            EK+Q+DIQL+PGWKAGTKITYKNEGDYNP TG RQTLQFI+QEK H    RDGNDL Y+
Sbjct: 213 SEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEKPHSNYTRDGNDLIYS 272

Query: 267 LPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVK 326
           LPL+FKESLLGFSKT+ TIDGR + IS+ QPVQPS+ S YPGQGMP++K PS+RG+LIVK
Sbjct: 273 LPLTFKESLLGFSKTIQTIDGRTLPISRVQPVQPSDSSTYPGQGMPIAKTPSQRGNLIVK 332

Query: 327 YKIDYPITLSEQQKLAIAGNF 347
           YKIDYP+TL++ Q+ AI  NF
Sbjct: 333 YKIDYPVTLNDSQRRAILENF 353

 Score =  128 bits (322), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 60/70 (85%), Positives = 64/70 (91%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
          MVK+TKLYDLLGVSP+  + ELKKGYRKAALKYHPDKP+GD EKFKEISEAFEILNDP K
Sbjct: 1  MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAEKFKEISEAFEILNDPQK 60

Query: 61 REVYDKYGLE 70
          REVYD YGLE
Sbjct: 61 REVYDTYGLE 70

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
           {ON} Anc_1.398 YNL007C
          Length = 369

 Score =  281 bits (718), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 155/182 (85%)

Query: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225
           S S +Q EE+VV VNLPVSLEDL AGK+KSFKI RKGP+G  EK QIDIQL+ GWKAGTK
Sbjct: 188 SASPSQVEEEVVSVNLPVSLEDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTK 247

Query: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285
           ITYKNEGDYNP TGGR+TLQF++QEK H   KRDG++L YTLPLSFKESLLGFSKT+ TI
Sbjct: 248 ITYKNEGDYNPRTGGRKTLQFVLQEKAHPLFKRDGDNLIYTLPLSFKESLLGFSKTIQTI 307

Query: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAG 345
           DGR + IS+ QP+QPSE SRYPGQGMP++K P +RGDLIVKYKIDYPI+L++ QK AI  
Sbjct: 308 DGRTLPISRVQPIQPSESSRYPGQGMPITKKPGQRGDLIVKYKIDYPISLNDAQKHAIDQ 367

Query: 346 NF 347
           NF
Sbjct: 368 NF 369

 Score =  131 bits (330), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/115 (61%), Positives = 74/115 (64%), Gaps = 5/115 (4%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP  N+ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND  K
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDSQK 60

Query: 61  REVYDKYGLEXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFS 110
           RE+YD+YGLE                                   S EDAFNIFS
Sbjct: 61  REIYDQYGLEAARNGGPAFGGASPGAGGFPGGAGGFSGGHGGHAFSNEDAFNIFS 115

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {ON}
           similar to gnl|GLV|CAGL0H03707g Candida glabrata
           CAGL0H03707g and some similarites with YNL007C
           uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score =  278 bits (710), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 131/182 (71%), Positives = 154/182 (84%)

Query: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225
           S   A+ EE+VVQVNLPVSLEDL++GK+KSFKITRKG  G+ EK QIDIQL+PGWKAGTK
Sbjct: 173 SRQQARPEEEVVQVNLPVSLEDLFSGKKKSFKITRKGAGGVSEKNQIDIQLKPGWKAGTK 232

Query: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285
           IT+K EGDYNP TGGRQTLQF++QEK H+F  R  NDL YTLPLSFKESLLGFSK V TI
Sbjct: 233 ITFKGEGDYNPRTGGRQTLQFVLQEKPHEFFTRQDNDLIYTLPLSFKESLLGFSKQVQTI 292

Query: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAG 345
           DG+ I I++TQP+QP++ S YPGQGM LSKNPS+RGDLI+K+KIDYP +L+ QQ+ AI  
Sbjct: 293 DGKTIPITRTQPIQPTQTSTYPGQGMTLSKNPSQRGDLIIKFKIDYPTSLTPQQRQAIMD 352

Query: 346 NF 347
           NF
Sbjct: 353 NF 354

 Score =  130 bits (326), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 76/116 (65%), Gaps = 5/116 (4%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVK+TKLYDLLG+SP+  +AE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAQK 60

Query: 61  REVYDKYGLEXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQ 111
           REVYD YGLE                                   SQ+DAFNIFSQ
Sbjct: 61  REVYDTYGLEAARGNAPQFGGAGGPGGPGGPGGFSSGGFAGGHAFSQDDAFNIFSQ 116

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score =  271 bits (693), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 155/176 (88%)

Query: 172 QEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNE 231
           +EE+VV VNLPVSLEDL+ GK+KSFKI RKGP G  EK QIDIQLRPGWKAGTK+TYKN+
Sbjct: 152 EEEEVVPVNLPVSLEDLFIGKKKSFKIGRKGPGGSQEKTQIDIQLRPGWKAGTKVTYKNQ 211

Query: 232 GDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIF 291
           GDYNP +GGR+TLQF+IQEK H   KRDG+DL Y L LSFKESLLGFSKT++TIDGR++ 
Sbjct: 212 GDYNPRSGGRKTLQFVIQEKAHPDFKRDGDDLIYILRLSFKESLLGFSKTINTIDGRKLP 271

Query: 292 ISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
           +S++QP+QP+E S YPGQGMP+SKNPS+RG+LI+KYKIDYPI+L++ Q++AI  NF
Sbjct: 272 LSRSQPIQPTEISTYPGQGMPVSKNPSQRGNLIIKYKIDYPISLNDNQRIAIEQNF 327

 Score =  136 bits (342), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/111 (64%), Positives = 76/111 (68%), Gaps = 1/111 (0%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP  N+ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPN 
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNT 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQ 111
           REVYD+YGLE                              S +DAFN+FSQ
Sbjct: 61  REVYDQYGLE-AARSGGPSFGGAGAGGFPGGAGGFSGHQFSNDDAFNMFSQ 110

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {ON}
           YNL007C (REAL)
          Length = 366

 Score =  273 bits (697), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 132/182 (72%), Positives = 151/182 (82%)

Query: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225
           S S    EE+ VQVNLPVSLEDL+ GK+KSFKI RKGP G  EK QIDIQL+PGWKAGTK
Sbjct: 185 SSSPTYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTK 244

Query: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285
           ITYKN+GDYNP TG R+TLQF+IQEK H   KRDG+DL YTLPLSFKESLLGFSKT+ TI
Sbjct: 245 ITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTI 304

Query: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAG 345
           DGR + +S+ QPVQPS+ S YPGQGMP  KNPS+RG+LIVKYK+DYPI+L++ QK AI  
Sbjct: 305 DGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDE 364

Query: 346 NF 347
           NF
Sbjct: 365 NF 366

 Score =  133 bits (334), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 75/117 (64%), Gaps = 6/117 (5%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP  N+ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND  K
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDSQK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXSQEDAFNIFSQ 111
           RE+YD+YGLE                                    S EDAFNIFSQ
Sbjct: 61  REIYDQYGLEAARSGGPSFGAGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQ 117

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {ON}
           some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 357

 Score =  272 bits (696), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 131/182 (71%), Positives = 152/182 (83%)

Query: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225
           S S    EE++V VNLPVSLEDL+AG++KSFKI RK   G  EK QIDIQL+PGWKAGTK
Sbjct: 176 SASPPSAEEEIVPVNLPVSLEDLFAGRKKSFKIGRKNRGGSFEKTQIDIQLKPGWKAGTK 235

Query: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285
           ITYKNEGDYNP TGGR+TLQF++QEK H   KRDG++L Y+LPLSFKESLLGFSKT+ TI
Sbjct: 236 ITYKNEGDYNPQTGGRKTLQFVLQEKSHPLYKRDGDNLIYSLPLSFKESLLGFSKTIQTI 295

Query: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAG 345
           DGR + ISK QPVQP+E S YPGQGMP+SK P +RGDL+VKYKIDYP++L+E QK AIA 
Sbjct: 296 DGRTLPISKIQPVQPTEVSSYPGQGMPVSKRPGQRGDLVVKYKIDYPLSLTEDQKRAIAE 355

Query: 346 NF 347
           NF
Sbjct: 356 NF 357

 Score =  128 bits (322), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 76/113 (67%), Gaps = 2/113 (1%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYD+LGVSP+ N+ ELKKGY+KAALKYHPDKP GDTEKFKEISEA+EIL+D +K
Sbjct: 1   MVKETKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTEKFKEISEAYEILSDSSK 60

Query: 61  REVYDKYGLEXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQ 111
           RE+YD+YGLE                                S EDAFNIFSQ
Sbjct: 61  REIYDQYGLEAARNGGPAFGGASPGAGGFPAGGAGGFSSHAFSNEDAFNIFSQ 113

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {ON}
           highly similar to uniprot|P25294 Saccharomyces
           cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score =  271 bits (694), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (82%)

Query: 164 MHSHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAG 223
             S S  Q EE+VV VNL VSLEDLY GK+K+F I RKGP+G PEK Q+DIQL+PGWKAG
Sbjct: 166 FRSASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAG 225

Query: 224 TKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVH 283
           TKITYKN GDYNP+TG R+TLQFIIQEK H F  RDGNDL YTLPL+FKESLLGF+KT+ 
Sbjct: 226 TKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQ 285

Query: 284 TIDGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAI 343
           TIDGR + +S+ QP+QPSE+S YPGQGMP+ K P +RGD+IV YK+DYPI+L+++Q+ AI
Sbjct: 286 TIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAI 345

Query: 344 AGNF 347
             NF
Sbjct: 346 DENF 349

 Score =  134 bits (336), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 77/111 (69%), Gaps = 1/111 (0%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLG+SP+ N+ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DP K
Sbjct: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQ 111
           REVYD+YGLE                              S +DAFNIFSQ
Sbjct: 61  REVYDQYGLE-AARNGGPAFGGAGGFRGGGFSSAGGAHAFSNDDAFNIFSQ 110

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {ON}
           YNL007C (REAL)
          Length = 368

 Score =  270 bits (690), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 131/182 (71%), Positives = 150/182 (82%)

Query: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225
           S S    EE+ VQVNLPVSLEDL+ GK+KSFKI RKGP G  EK QIDIQL+PGWKAGTK
Sbjct: 187 SSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTK 246

Query: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285
           ITYKN+GD+N  TG R+TLQF+IQEK H   KRDG+DL YTLPLSFKESLLGFSKT+ TI
Sbjct: 247 ITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTI 306

Query: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAG 345
           DGR + +S+ QPVQPS+ S YPGQGMP  KNPS+RG+LIVKYK+DYPI+L+E QK AI  
Sbjct: 307 DGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDE 366

Query: 346 NF 347
           NF
Sbjct: 367 NF 368

 Score =  132 bits (333), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 75/120 (62%), Gaps = 9/120 (7%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP  N+ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILND  K
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXSQEDAFNIFSQ 111
           RE+YD+YGLE                                       S EDAFNIFSQ
Sbjct: 61  REIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGAGGFSGGHAFSNEDAFNIFSQ 120

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {ON}
           YNL007C (REAL)
          Length = 359

 Score =  269 bits (688), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 151/182 (82%)

Query: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225
           S S +  EE+ VQVNLPVSLEDL+ GK+KSFKI RKGP G  EK QIDIQL+PGWKAGTK
Sbjct: 178 SSSPSYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGTSEKTQIDIQLKPGWKAGTK 237

Query: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285
           ITYKN+GD+NP T  R+TLQF+IQEK H   KRDG+DL YTLPLSFKESLLGFSKT+ TI
Sbjct: 238 ITYKNQGDFNPQTNRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTI 297

Query: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAG 345
           DGR + +S+ QPVQPS+ S YPGQGMP  KNPS+RG+LIVKYK+DYPI+L++ QK AI  
Sbjct: 298 DGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDE 357

Query: 346 NF 347
           NF
Sbjct: 358 NF 359

 Score =  132 bits (333), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
          MVKETKLYD+LGVSP  N+ ELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDP K
Sbjct: 1  MVKETKLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61 REVYDKYGLE 70
          RE+YD+YG+E
Sbjct: 61 REIYDQYGIE 70

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.398
           YNL007C
          Length = 359

 Score =  266 bits (681), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 155/182 (85%), Gaps = 1/182 (0%)

Query: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225
           S+S + QEE  VQV+LPVSLEDL+ GK+KSFKI RKG  GIPEK QIDIQL+PGWKAGTK
Sbjct: 179 SNSPSAQEE-TVQVSLPVSLEDLFHGKKKSFKIGRKGQGGIPEKTQIDIQLKPGWKAGTK 237

Query: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285
           ITYK++GDYNP TGGR+TLQF++QEK H   KR+G+DLT TLPL+FKESLLGF+K + TI
Sbjct: 238 ITYKSQGDYNPQTGGRKTLQFMLQEKNHPVFKREGDDLTCTLPLTFKESLLGFNKQIQTI 297

Query: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAG 345
           DGR + IS+TQP+QPSE S YPGQGMP+ K PS+RG+LIV+YKIDYPITL++ QK AI  
Sbjct: 298 DGRTLPISRTQPIQPSETSVYPGQGMPIPKTPSQRGNLIVRYKIDYPITLNDAQKNAILQ 357

Query: 346 NF 347
           NF
Sbjct: 358 NF 359

 Score =  134 bits (338), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 77/112 (68%), Gaps = 1/112 (0%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP+ ND E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D NK
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDKNK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-SQEDAFNIFSQ 111
           REVYD+YGL+                               + EDAFNIFSQ
Sbjct: 61  REVYDQYGLQAARSGGPQFGGAGGPGGAGGFPGGGFGGHAFTNEDAFNIFSQ 112

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {ON}
           Anc_1.398 YNL007C
          Length = 353

 Score =  265 bits (677), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 154/180 (85%)

Query: 168 SHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKIT 227
           S +  EE+VV V++PVSLEDL+ GK+KSFKI RKG  G PEK QIDI L+PGWK GTK+T
Sbjct: 174 SASPHEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLT 233

Query: 228 YKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDG 287
           YKN GDYNPSTGGR+TLQFII+EK H   KRDG+++ YTLPL+FKESLLGFSKT+ T+DG
Sbjct: 234 YKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDG 293

Query: 288 RQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
           R + +S++QPVQP+EE+ YPGQGMP+SKNP +RG+LI+KYKI+YPI+L++ Q+ AIA NF
Sbjct: 294 RTLPLSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353

 Score =  129 bits (323), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 76/111 (68%), Gaps = 5/111 (4%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVS + +DAE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D NK
Sbjct: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQ 111
           R VYD+YGL+                              S +DAFNIFSQ
Sbjct: 61  RSVYDQYGLD-----AARNGGPSFQGQSGFPGGGGSTHSFSNDDAFNIFSQ 106

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.398
           YNL007C
          Length = 355

 Score =  246 bits (628), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 115/178 (64%), Positives = 146/178 (82%)

Query: 166 SHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK 225
           S   +  EE+VV V+LPVSLEDL+ GK+K+FKI RKG +G+ EK Q+DIQL+ GWKAGTK
Sbjct: 174 SRGASPAEEEVVTVDLPVSLEDLFQGKKKTFKIGRKGQNGVQEKVQVDIQLKAGWKAGTK 233

Query: 226 ITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTI 285
           IT+KN GDYNPSTGGR+TLQF+I+EK+H   KR+ + L Y LPL+FKESLLGF KT+ TI
Sbjct: 234 ITFKNYGDYNPSTGGRKTLQFVIKEKVHPNFKREDDTLVYYLPLTFKESLLGFQKTIQTI 293

Query: 286 DGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAI 343
           DGR + IS+ QPVQP++ S YPGQGMP++K P +RGD+IVKYKI+YP TL++ Q+ AI
Sbjct: 294 DGRTLPISRVQPVQPNDSSTYPGQGMPMTKKPGQRGDMIVKYKIEYPTTLTDDQRRAI 351

 Score =  131 bits (329), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 62/70 (88%), Positives = 67/70 (95%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
          MVKETKLYDLLGVSP+ ND E+KKGYRKAALKYHPDKPTG+TEKFKEISEAFEIL+D NK
Sbjct: 1  MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTEKFKEISEAFEILSDSNK 60

Query: 61 REVYDKYGLE 70
          REVYD+YGLE
Sbjct: 61 REVYDQYGLE 70

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
           (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score =  245 bits (626), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 146/176 (82%)

Query: 172 QEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNE 231
           Q E+VVQV+LPVSLEDL+ GK+K+FKI RKGP+G  EK QI+I L+ GWKAGTKITYKN+
Sbjct: 182 QPEEVVQVDLPVSLEDLFEGKKKTFKIGRKGPNGEAEKAQIEIALKAGWKAGTKITYKNQ 241

Query: 232 GDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIF 291
           GDYNPSTGGR+TLQFI++EK +   KRD ++L YTLPL+FKESLLGF KT+ TIDG+ + 
Sbjct: 242 GDYNPSTGGRKTLQFILKEKPNTNFKRDEDNLIYTLPLTFKESLLGFQKTIKTIDGKTLP 301

Query: 292 ISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347
           IS+ QPVQPSE + YPGQGMP+SK+  +RGD+IVK+K+ YP +L+E QK  I  NF
Sbjct: 302 ISRVQPVQPSECTTYPGQGMPISKSVGQRGDMIVKFKVGYPTSLTEDQKRVINENF 357

 Score =  124 bits (310), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 73/111 (65%), Gaps = 5/111 (4%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKET LYDLL VSP  N+ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKETGLYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAEK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNIFSQ 111
           REVYD+YGL+                              + +DAFNIFSQ
Sbjct: 61  REVYDQYGLK-----AARGEAPQFANGGAGGFPGGGAHTFTNDDAFNIFSQ 106

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {ON}
           Anc_1.398 YNL007C
          Length = 363

 Score =  132 bits (332), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 68/108 (62%), Positives = 72/108 (66%)

Query: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60
           MVKETKLYDLLGVSP  N+ ELKKGYRK+ALKYHPDKPTGDTEKFKEISEAFEILND  K
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTEKFKEISEAFEILNDKQK 60

Query: 61  REVYDKYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQEDAFNI 108
           RE+YD+YGLE                              S EDAFNI
Sbjct: 61  REIYDQYGLEAARQGGPSFGAGGPGAGGAPGGGAGFAHSFSNEDAFNI 108

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa]
          {ON} complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  102 bits (253), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 61/72 (84%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDP 58
          MVKETK YDLLGVSPN +++E+KKGYRKAALKYHPDK PT +  EKFKE S A+E+L+D 
Sbjct: 1  MVKETKFYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAEKFKECSGAYEVLSDS 60

Query: 59 NKREVYDKYGLE 70
           KRE+YD+YG E
Sbjct: 61 QKREIYDQYGEE 72

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 65/134 (48%), Gaps = 4/134 (2%)

Query: 201 KGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDG 260
           KG     E+K +++ + PG + G K+T+K E D  P       + F++ EK H   KR G
Sbjct: 204 KGNKVANERKVLEVHVEPGMREGQKVTFKGEADQAPDIIPGDVI-FVVTEKPHKHFKRSG 262

Query: 261 NDLTYTLPLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPS 318
           +DL Y   +    ++ G    +  + G   ++ I   + + P       G+GMP+ K   
Sbjct: 263 DDLLYEAEVDLLTAIAGGDFAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG 322

Query: 319 ERGDLIVKYKIDYP 332
             G+LI+ +KI +P
Sbjct: 323 -YGNLIITFKIKFP 335

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa]
          {ON} Anc_2.243 YNL064C
          Length = 410

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 61/72 (84%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDP 58
          MVK+TK YD+LGVSP  +++E+KKGYRKAALKYHPDK PT +  EKFKE S A+E+L+DP
Sbjct: 1  MVKDTKFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAEKFKECSAAYEVLSDP 60

Query: 59 NKREVYDKYGLE 70
           KR+VYD+YG E
Sbjct: 61 EKRDVYDQYGEE 72

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++++ PG K G +I +K E D  P       + F++ EK H   +R GNDL Y  
Sbjct: 213 ERKILEVKIEPGMKDGQRIVFKGESDQAPDIIPGDVV-FVVNEKPHKHFQRSGNDLVYLA 271

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   +I I   + + P  +    G+GMP+ K     G+LI+
Sbjct: 272 EIDLLTAIAGGEFALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGG-YGNLII 330

Query: 326 KYKIDYP 332
           ++ I +P
Sbjct: 331 QFNIKFP 337

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064c YDJ1
          Length = 407

 Score = 97.8 bits (242), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 58/72 (80%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVK+TKLYD LGVSP  +DAE+KK YRK+ALKYHPDK   +   EKFKE+S A+EIL+D 
Sbjct: 1  MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAEKFKEVSSAYEILSDS 60

Query: 59 NKREVYDKYGLE 70
           KREVYD++G E
Sbjct: 61 QKREVYDQFGEE 72

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++++ PG K G KI +K E D  P       + F+I EK H   +R G+DL Y  
Sbjct: 210 ERKILEVRIEPGMKDGQKIVFKGEADQAPDVIPGDVV-FVISEKPHKHFQRAGDDLIYEA 268

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    +L G    +  + G   ++ I   + + P       G+GMP+ K     G+L++
Sbjct: 269 EIDLLTALAGGQFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGG-YGNLLI 327

Query: 326 KYKIDYP 332
           K+ I +P
Sbjct: 328 KFNIKFP 334

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
          envelope protein) heat shock protein
          Length = 409

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 59/72 (81%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVK+TKLYDLLGVSP  +D ++KK YRK+ALK+HPDK   +   EKFKEI+ A+EIL+D 
Sbjct: 1  MVKDTKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAEKFKEITSAYEILSDS 60

Query: 59 NKREVYDKYGLE 70
           KREVYD++GLE
Sbjct: 61 QKREVYDQFGLE 72

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 65/129 (50%), Gaps = 4/129 (3%)

Query: 206 IPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTY 265
           + E+K +++ + PG K G +I ++ E D +P       + F++ E+ H   KRDGNDL Y
Sbjct: 207 VNERKVLEVNIEPGMKDGQRIVFQGEADQSPGIIPGDVV-FVVSEQPHPVFKRDGNDLHY 265

Query: 266 TLPLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDL 323
              +    ++ G    V  + G   ++ I   + + P       G+GMP+ K     G+L
Sbjct: 266 DAEIDLLSAIAGGQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKY-GGYGNL 324

Query: 324 IVKYKIDYP 332
           ++K+ I +P
Sbjct: 325 LIKFNIKFP 333

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa]
          {ON} Anc_2.243 YNL064C
          Length = 407

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (79%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVKETK YDLLGVSPN ++ E+KKGYRK ALKYHPDK   +   EKFKE S A+E+L+D 
Sbjct: 1  MVKETKFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAEKFKECSAAYEVLSDS 60

Query: 59 NKREVYDKY 67
           KREVYD+Y
Sbjct: 61 QKREVYDQY 69

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (47%), Gaps = 4/134 (2%)

Query: 201 KGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDG 260
           KG     E+K +++ + PG + G KI +K E D  P       + F++ EK H   KR G
Sbjct: 204 KGKKIANERKVLEVHVEPGMREGQKIVFKGEADQAPDVIPGDVI-FVVVEKPHKHFKRAG 262

Query: 261 NDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKT--QPVQPSEESRYPGQGMPLSKNPS 318
           +DL Y   +    ++ G    +  + G  + +S    + +    +    G+GMP+ K   
Sbjct: 263 DDLLYEAEIDLLTAIAGGEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGG 322

Query: 319 ERGDLIVKYKIDYP 332
             G+LIV +KI +P
Sbjct: 323 -YGNLIVTFKIKFP 335

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
          to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
          yeast dnaJ homolog (nuclear envelope protein) heat
          shock protein
          Length = 411

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/68 (70%), Positives = 58/68 (85%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDP 58
          MVK+TKLYDL+GVSP  +DA++KK YRKAALKYHPDK PT +  EKFKEIS A+EIL+D 
Sbjct: 1  MVKDTKLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAEKFKEISSAYEILSDS 60

Query: 59 NKREVYDK 66
           KRE+YD+
Sbjct: 61 QKREMYDQ 68

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G KI ++ E D  P       + F++ E+ H+   R G+DL Y  
Sbjct: 213 ERKILEVHIEPGMKDGQKIVFQGEADQAPDV-VPGDVVFVVSERPHERFNRKGDDLYYEA 271

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    V  + G   ++ I   + + P       G+GMP+ K     G+LIV
Sbjct: 272 EVDLLTAIAGGEFAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGG-FGNLIV 330

Query: 326 KYKIDYP 332
           K+KI +P
Sbjct: 331 KFKIKFP 337

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa]
          {ON} Anc_2.243
          Length = 410

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/68 (67%), Positives = 57/68 (83%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDP 58
          MVK+TKLYD+LGVSP   D+E+KK YRK+ALKYHPDK PT +  EKFKE+S A+EIL+D 
Sbjct: 1  MVKDTKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAEKFKEVSAAYEILSDS 60

Query: 59 NKREVYDK 66
           KRE+YD+
Sbjct: 61 EKREIYDQ 68

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 61/127 (48%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G  I +K E D  P       + F++ +K H   +R G+DL Y  
Sbjct: 215 ERKILEVHIEPGMKDGQNIVFKGEADQAPDVIPGDVI-FVVAQKPHKHFQRSGDDLVYEA 273

Query: 268 PLSFKESLLGFSKTVHTIDGRQIFISKT--QPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G  + +S    + + P  +    G+GMP+ K     G+LIV
Sbjct: 274 EIDLLTAIAGGEFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGG-HGNLIV 332

Query: 326 KYKIDYP 332
            + + +P
Sbjct: 333 HFTVKFP 339

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MV+ETKLYD+LGVSP  +D+E+KK YRK ALKYHPDK   +   EKFKE S A+E+L+D 
Sbjct: 1  MVRETKLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAEKFKEASSAYEVLSDS 60

Query: 59 NKREVYDKYG 68
           KR++YD++G
Sbjct: 61 EKRDIYDQFG 70

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K + + + PG K G K+ +K E D  P       + F+I EK H   +R G+DL Y  
Sbjct: 211 ERKILQVNVDPGMKNGQKVVFKGEADQAPDIIPGDVI-FVISEKPHKHFQRVGDDLIYEA 269

Query: 268 PLSFKESLLGFSKTVHTIDGRQIFISKT--QPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G  + +S    + + P+      G+GMP+ K     G+LI+
Sbjct: 270 EIDLLTAVAGGEFALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGG-YGNLII 328

Query: 326 KYKIDYP 332
           K+ I +P
Sbjct: 329 KFSIKFP 335

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL064C
          (YDJ1)
          Length = 410

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 57/68 (83%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVK+TKLYDLLGVSP+ NDA++KK YRK+ALKYHPDK   +   +KFK+I+ A+EIL+D 
Sbjct: 1  MVKDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAADKFKQITGAYEILSDS 60

Query: 59 NKREVYDK 66
           KRE+YD+
Sbjct: 61 QKREMYDQ 68

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ ++PG K G KI ++ E D  P       + F++ E+ H    R+G++L Y  
Sbjct: 213 ERKILEVNIQPGMKHGQKIVFQGEADQQPGQIPGDVV-FVVNEQEHPRFVRNGDNLHYEA 271

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   +I I   + + P       G+GMP+ K  S  GDL++
Sbjct: 272 EIDLLTAIAGGQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGDLLI 330

Query: 326 KYKIDYP 332
           K+ + +P
Sbjct: 331 KFNVKFP 337

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
          similar to Ashbya gossypii ADL257C
          Length = 409

 Score = 92.0 bits (227), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 58/68 (85%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDP 58
          MVK+TKLYDLLGVS + NDA++KK YRKAALKYHPDK P+ +  +KFK+++ A+EIL+D 
Sbjct: 1  MVKDTKLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAADKFKQMTAAYEILSDS 60

Query: 59 NKREVYDK 66
           KREVYD+
Sbjct: 61 QKREVYDQ 68

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G K+ ++ E D  P       + F++ E+ H    R+G++L Y  
Sbjct: 212 ERKILEVNIEPGMKNGQKVVFQGEADQQPGQIPGDVV-FVVNEQEHPKFVRNGDNLHYEA 270

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P       G+GMP+ K  S  G+L++
Sbjct: 271 QIDLLTAVAGGQFALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGNLLI 329

Query: 326 KYKIDYP 332
           K+ + +P
Sbjct: 330 KFNVKFP 336

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa]
          {ON} YNL064C (REAL)
          Length = 409

 Score = 91.7 bits (226), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 53/72 (73%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVKETK YD+LGVS    D E+KK YRK ALKYHPDK   +   EKFKE S A+EIL+D 
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASSAYEILSDS 60

Query: 59 NKREVYDKYGLE 70
           KREVYD++G E
Sbjct: 61 EKREVYDQFGEE 72

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G +I +K E D  P       + FI+ E+ H   KRDG+DL Y  
Sbjct: 212 ERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FIVSERPHKNFKRDGDDLVYEA 270

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P       G+GMP+ K     G+L++
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGG-YGNLVI 329

Query: 326 KYKIDYP 332
           K+ I +P
Sbjct: 330 KFTIKFP 336

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON}
          Anc_2.243 YNL064C
          Length = 409

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/72 (59%), Positives = 55/72 (76%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVK+TKLYD+LGVS    D E+KK YRK ALK+HPDK   +   EKFKE S A+E+L+D 
Sbjct: 1  MVKDTKLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAEKFKEASSAYEVLSDA 60

Query: 59 NKREVYDKYGLE 70
          +KR+ YD++GLE
Sbjct: 61 DKRDTYDQFGLE 72

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G K+ +K E D  P       + F+I EK H   +R G++L Y  
Sbjct: 211 ERKILEVHVDPGMKNGQKVVFKGEADQAPDVIPGDVV-FVINEKPHKHFQRSGDNLVYEA 269

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P       G+GMP++K     G+LI+
Sbjct: 270 EVDLLTAIAGGEFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGG-YGNLII 328

Query: 326 KYKIDYP 332
           K+ + +P
Sbjct: 329 KFTVKFP 335

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
          YDJ1Type I HSP40 co-chaperone involved in regulation of
          the HSP90 and HSP70 functions; involved in protein
          translocation across membranes; member of the DnaJ
          family
          Length = 409

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVKETK YD+LGV     D E+KK YRK ALKYHPDK   +   EKFKE S A+EIL+DP
Sbjct: 1  MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDP 60

Query: 59 NKREVYDKYG 68
           KR++YD++G
Sbjct: 61 EKRDIYDQFG 70

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G +I +K E D  P       + FI+ E+ H   KRDG+DL Y  
Sbjct: 212 ERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FIVSERPHKSFKRDGDDLVYEA 270

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P       G+GMP+ K     G+LI+
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGG-YGNLII 329

Query: 326 KYKIDYP 332
           K+ I +P
Sbjct: 330 KFTIKFP 336

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa]
          {ON} YNL064C (REAL)
          Length = 410

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/70 (62%), Positives = 52/70 (74%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVKETK YD+LGVS    D E+KK YRK ALKYHPDK   +   EKFKE S A+EIL+D 
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASSAYEILSDS 60

Query: 59 NKREVYDKYG 68
           KR+VYD++G
Sbjct: 61 EKRDVYDQFG 70

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G +I +K E D  P       + F++ E+ H   KRDG+DL Y  
Sbjct: 213 ERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FLVSERPHKSFKRDGDDLVYEA 271

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P       G+GMP+ K     G+LI+
Sbjct: 272 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLII 330

Query: 326 KYKIDYP 332
           K+ + +P
Sbjct: 331 KFTVKFP 337

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa]
          {ON} YNL064C (REAL)
          Length = 409

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVKETK YD+LGVS    D E+KK YRK ALK+HPDK   +   EKFKE S A+E+L+D 
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAEKFKEASSAYEVLSDS 60

Query: 59 NKREVYDKYG 68
           KREVYD++G
Sbjct: 61 EKREVYDQFG 70

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G KI +K E D  P       + F++ E+ H   KRDG+DL Y  
Sbjct: 212 ERKILEVHVEPGMKDGQKIVFKGEADQAPDVIPGDVV-FLVSERPHKHFKRDGDDLVYEA 270

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P       G+GMP+ K     G+LIV
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIV 329

Query: 326 KYKIDYP 332
           K+ I +P
Sbjct: 330 KFTIKFP 336

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa]
          {ON} YNL064C (YDJ1) - yeast dnaJ homolog (nuclear
          envelope protein); heat shock protein [contig 5] FULL
          Length = 411

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 55/68 (80%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVK+TK YDLLGVSP+ NDA++KK YRK ALK+HPDK   +   +KFKE++ A+EIL+D 
Sbjct: 1  MVKDTKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAADKFKELTVAYEILSDS 60

Query: 59 NKREVYDK 66
           KR++YD+
Sbjct: 61 QKRDIYDQ 68

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G KI ++ E D  P       + F+I ++ H   +R G+DL Y  
Sbjct: 213 ERKILEVHIEPGMKDGQKIVFQGEADQAPGIIPGDVV-FVISQRPHKHFERKGDDLLYQA 271

Query: 268 PLSFKESLLGFSKTVHTIDGRQIFISKT--QPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G  + +S    + + P       G+GMP+ K     G+LIV
Sbjct: 272 EVDLLSAIAGGEFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGG-YGNLIV 330

Query: 326 KYKIDYP 332
            +KI++P
Sbjct: 331 TFKINFP 337

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa]
          {ON} highly similar to gnl|GLV|CAGL0J09966g Candida
          glabrata CAGL0J09966g and similar to YNL064C
          uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
          yeast dnaJ homolog (nuclear envelope protein) heat
          shock protein
          Length = 412

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVKETK YDLLGVS   ++ E+KK YRK ALKYHPDK   +   EKFKE S A+E+L D 
Sbjct: 1  MVKETKFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAEKFKEASSAYEVLMDA 60

Query: 59 NKREVYDKYGLE 70
           KRE YD++G E
Sbjct: 61 EKREAYDQFGEE 72

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G KI +K E D  P       + F++ E+ H   +RD +DL Y  
Sbjct: 214 ERKILEVHVDPGMKDGQKIVFKGEADQAPDIIPGDVI-FVVSERPHKHFRRDSDDLVYEA 272

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P       G+GMP+ K     G+L+V
Sbjct: 273 DIDLLTAIAGGEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGG-FGNLLV 331

Query: 326 KYKIDYP 332
           K+ I +P
Sbjct: 332 KFNIVFP 338

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
          envelope protein) heat shock protein
          Length = 411

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 56/68 (82%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDP 58
          MVKETK YDLLGV  + NDA++KKGYRK ALK+HPDK P+ +  +KFKE++ A+E+L+D 
Sbjct: 1  MVKETKFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAADKFKELTVAYEVLSDS 60

Query: 59 NKREVYDK 66
           KR++YD+
Sbjct: 61 QKRDIYDQ 68

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 63/127 (49%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G KI ++ E D  P       + F+I ++ H   +R G++L Y  
Sbjct: 212 ERKILEVHIEPGMKDGQKIVFQGEADQAPGVIPGDVI-FVISQRPHKHFERKGDNLYYQA 270

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P       G+GMP+ K     GDLIV
Sbjct: 271 EVDLLSAIAGGEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-FGDLIV 329

Query: 326 KYKIDYP 332
            +K+++P
Sbjct: 330 TFKVNFP 336

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa]
          {ON} Anc_2.243
          Length = 411

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          MVK+TK YD+LGVSP+ + +E+KK YRK ALKYHPDK   +   EKFKE S A+E+L+D 
Sbjct: 1  MVKDTKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAEKFKEASAAYEVLSDD 60

Query: 59 NKREVYDKY 67
           KRE+YD++
Sbjct: 61 EKREMYDQF 69

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 62/127 (48%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G K+ +K E D  P       + F++ +K H+  +R G+DL Y  
Sbjct: 214 ERKILEVHIEPGMKDGQKVVFKGEADQAPDIIPGDVI-FVVSQKPHEHFQRAGDDLVYEA 272

Query: 268 PLSFKESLLGFSKTVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G    +  + G   ++ I   + + P        +GMP+ K     G+LIV
Sbjct: 273 EIDLLTAIAGGEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGG-YGNLIV 331

Query: 326 KYKIDYP 332
           K+ I +P
Sbjct: 332 KFNIKFP 338

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 56/69 (81%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILNDP 58
          MVK++K YDLLGVS +  + E+KK YRK+ALKYHPDK P+ +  EKFKE+S A+E+L+D 
Sbjct: 1  MVKDSKYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAEKFKEVSSAYEVLSDS 60

Query: 59 NKREVYDKY 67
           KR+VYD++
Sbjct: 61 EKRQVYDQF 69

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTL 267
           E+K +++ + PG K G KI +K E D  P       + F++ EK H   +R G+DL Y  
Sbjct: 213 ERKILEVHVDPGMKDGQKIVFKGEADQAPDVIPGDVI-FVVSEKPHKNFQRVGDDLVYEA 271

Query: 268 PLSFKESLLG--FSKTVHTIDGRQIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIV 325
            +    ++ G  FS    + D  ++ I   + + P       G+GMP++K     G+L+V
Sbjct: 272 EIDLLTAVAGGEFSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGG-YGNLLV 330

Query: 326 KYKIDYP 332
            +KI++P
Sbjct: 331 TFKINFP 337

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILND 57
          MVK+T+LYD+LGV P  + AELKK Y+ AAL+YHPDK        ++F++I++A+ +L D
Sbjct: 1  MVKDTRLYDVLGVQPGVSAAELKKSYKLAALRYHPDKNGHSEASKQRFQQIADAYRVLGD 60

Query: 58 PNKREVYDKYG 68
             R++YD+YG
Sbjct: 61 ERLRKIYDRYG 71

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 77/162 (47%), Gaps = 17/162 (10%)

Query: 198 ITRKGPSG-IPEKKQIDIQLRPGWKAGTKITYKNEGD--YNPSTGGRQTL----QFIIQE 250
            T  G +G + E+K  ++++RPG +AG+++ +  E D   N   G  Q L       I+E
Sbjct: 216 CTSCGGAGYLRERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEE 275

Query: 251 KMHDF---LKRDGNDLTYTLPLSFKESLLGFSKTVHTID---GR--QIFISKTQPVQPSE 302
                    + D N L   L +  + SL G   TV+  D   G+  Q+ I   + ++P  
Sbjct: 276 ATPATRYQCRGDANLLLTELHVDLRTSLCG--GTVYIEDHPSGKLIQLEIIPGELLEPGA 333

Query: 303 ESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIA 344
                  GMP   +PS+ G L +K+ +D+P TL++    AIA
Sbjct: 334 IKCIEHLGMPHPDDPSQYGHLFIKFHVDFPKTLADSTITAIA 375

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV ET+ YDLLG+S    D E+KK YRK ++K HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVLETEYYDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATERFQAISEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
             R  YDKYG E
Sbjct: 61 KQLRSNYDKYGKE 73

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
          Ashbya gossypii AER427W
          Length = 503

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (73%), Gaps = 5/73 (6%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILN 56
          MVK+T+ YDLL VSP  +  ELKK Y+ AAL+YHPDK  G +E     F++I+EA+ IL+
Sbjct: 1  MVKDTRFYDLLNVSPTVSPQELKKSYKLAALRYHPDK-NGHSESAKQAFQQITEAYGILS 59

Query: 57 DPNKREVYDKYGL 69
          D  KR++YD+YG+
Sbjct: 60 DERKRKIYDRYGV 72

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 69/160 (43%), Gaps = 34/160 (21%)

Query: 199 TRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPST--GGRQTLQ----FIIQEKM 252
           T +G   I E+K  +++++PG    ++I    E D   ST  G +Q +      I+QE+ 
Sbjct: 240 TCRGTGYIRERKIFEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQC 299

Query: 253 HDFLKRDGNDLTYTLPLSFKESLLGFSKTV----HTIDGRQIFISKTQPVQPSEESRYPG 308
                R            F+ES L  ++ V     ++ G  I+I      +P +    PG
Sbjct: 300 STGRYR-----------RFRESDLVLTRCVVDLRTSLCGGSIYIDDHPSGRPIKLEVIPG 348

Query: 309 Q-------------GMPLSKNPSERGDLIVKYKIDYPITL 335
           +             GMP   NPS+ GDL +K+ +++P  L
Sbjct: 349 ELLNPGSIKCVENLGMPKRDNPSQYGDLYIKFCVNFPERL 388

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV  T+ YDLLGV PN  D E+KK YRK ++K HPDK   +   T+KF+ ISEA+++L+D
Sbjct: 1  MVVNTEYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPDATKKFQAISEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
           N R  YDK+G
Sbjct: 61 KNLRSNYDKFG 71

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON}
          Anc_2.218 YNL077W
          Length = 462

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+LYD+L VSP  +  E++K YR  ALK+HPDK     E   KF E++EA+EIL D
Sbjct: 1  MVKDTRLYDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHSEESKSKFLEVNEAYEILID 60

Query: 58 PNKREVYDKYG 68
            KR +YD+YG
Sbjct: 61 EKKRSLYDQYG 71

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 69/157 (43%), Gaps = 22/157 (14%)

Query: 201 KGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTG-GRQT------LQFIIQEKMH 253
           +G   I E+K  D++++PG   G +I    E D    T  G +T      +  IIQ K  
Sbjct: 225 EGEGCIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDP 284

Query: 254 DF--LKRDGNDL-TYTLPLSFKESLLGFSKTVHTIDGR------QIFISKTQPVQPSEES 304
            F  + R+G DL      +    SL G      +IDG        + I   + ++P+   
Sbjct: 285 KFQRVNRNGCDLMVRNCKIPLVTSLCGGK---LSIDGHPNGKLINVTILPGELIKPNHFK 341

Query: 305 RYPGQGMPL---SKNPSERGDLIVKYKIDYPITLSEQ 338
                GMP     + P   G+L +++++++P TL+ +
Sbjct: 342 SIENLGMPRYEEKRAPEGYGNLYIQFQVEFPETLASE 378

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 52/73 (71%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YD+LG++P    AE+KK YRK ++K HPDK   D   TE+F++ISEA+++L+D
Sbjct: 1  MVVDTTYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATERFQQISEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
           + R  YD++G E
Sbjct: 61 EHLRNNYDQFGKE 73

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa]
          {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
          CAGL0J10296g and weakly similar to YNL077W
          uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
          Putative chaperone of the HSP40 (DNAJ) family
          overexpression interferes with propagation of the [Psi
          ] prion
          Length = 495

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILND 57
          M K TKLYD+L V+    + E+KK YRK ALK+HPDK     E    F++IS A+E L++
Sbjct: 1  MAKNTKLYDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSN 60

Query: 58 PNKREVYDKYG 68
           NKRE+YD+YG
Sbjct: 61 SNKRELYDQYG 71

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 63/147 (42%), Gaps = 17/147 (11%)

Query: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGD--YNPSTGGRQ--------TLQFIIQEK 251
           G   I E+K  D+++ PG + G +I    E D   N   G  +        T+Q    E+
Sbjct: 253 GNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVINTEYGKERVIPGDVIITIQLTRNEE 312

Query: 252 ---MHDFLKRDGNDLTYTLPLSFKESLLGFSKTVH---TIDGRQIFISKTQPVQPSEESR 305
               + +L  D + +     +  K SL G +  +    + +  +I +   + ++P     
Sbjct: 313 SNMRYKYLVHDHDLILDNFEVDLKTSLCGGTIIIEDHPSGNPFKIEVLSGELLKPGCIKC 372

Query: 306 YPGQGMPLSKNPSERGDLIVKYKIDYP 332
              +GMP+  N    G+L +++++ +P
Sbjct: 373 VENKGMPVDSN-GNFGNLYIRFRVKFP 398

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077w
          Length = 479

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+LYDLL V  + +   +KK +  AAL+ HPDK     E   +F+EIS+A+E+L+D
Sbjct: 1  MVKDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSD 60

Query: 58 PNKREVYDKYG 68
          P  RE+YD+YG
Sbjct: 61 PKSREMYDRYG 71

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLG+ P+    E+KK YRK ++K HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTAYYDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATERFQAISEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
           + R  YDKYG
Sbjct: 61 ESLRLKYDKYG 71

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LG+SP    +E+KK YRK A+  HPDK   D E   KF+ + EA+++LND
Sbjct: 1  MVKDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLND 60

Query: 58 PNKREVYDKYG 68
          P  R+ YD++G
Sbjct: 61 PALRKQYDEFG 71

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MVKET+ YD+LG+ P     E+KK YR+ A++ HPDK   D   +E+F+++ EA+++L+D
Sbjct: 1  MVKETEYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASERFQQVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
          P+ R+ YD++G
Sbjct: 61 PDLRKQYDEFG 71

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T  YD+LGV P    AE+KK YR+ A++ HPDK   D E   KF+E+ EA+++L+D
Sbjct: 1  MVKDTGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
          P  R  YD++G
Sbjct: 61 PGLRSRYDEFG 71

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON}
          Anc_2.218 YNL077W
          Length = 448

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+ +LY+ L + P  + +++KK YR  AL+YHPDK     E   KF++ISEA+ IL D
Sbjct: 1  MVKDPRLYNALNIPPTASQSDIKKAYRVQALRYHPDKNNESEESKKKFQDISEAYSILRD 60

Query: 58 PNKREVYDKYG 68
           N+R++YDKYG
Sbjct: 61 ENQRKMYDKYG 71

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 68/156 (43%), Gaps = 12/156 (7%)

Query: 199 TRKGPSGI---PEKKQIDIQLRPGWKAGTKITYKNEGD--YNPSTGGRQTLQFIIQEKMH 253
           T +G +G+    E K  D+++ PG K GT+I + NEGD   N        +   I E   
Sbjct: 242 TCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVIPGNVIIHINEIED 301

Query: 254 DFLKR--DGNDLTY-TLPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQPSEESRYPGQ- 309
           +  KR  DG DL Y    +    SL G    +      ++      P +  E     G  
Sbjct: 302 NKFKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHPNNKLIKVDILPGEIIESGSVKGVE 361

Query: 310 --GMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAI 343
             GMP +K  +E G L +++++ YP  L+ +   AI
Sbjct: 362 SLGMPKNKG-NEYGILYIQFQVKYPEKLNMESIKAI 396

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLLGVS   +  E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGD 60

Query: 58 PNKREVYDKYG 68
           + R  YDKYG
Sbjct: 61 DDLRAKYDKYG 71

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LGV P    AE+KK YR+ A++ HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTQYYDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEAQSKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
          P  R  YD++G
Sbjct: 61 PGLRSRYDEFG 71

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
          {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
          CAGL0J10296g and some similarites with YNL077W
          uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
          Putative chaperone of the HSP40 (DNAJ) family
          overexpression interferes with propagation of the [Psi
          ] prion
          Length = 491

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M ++T+LYD L VSP+   +E+K+ Y+  ALKYHPDK     +   KF+E+ +A+EIL D
Sbjct: 1  MARDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSEDAKNKFQEVCKAYEILAD 60

Query: 58 PNKREVYDKYG 68
           +KR +YD+YG
Sbjct: 61 EDKRVMYDRYG 71

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 63/152 (41%), Gaps = 21/152 (13%)

Query: 201 KGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGD--YNPSTGGRQ--------TLQFIIQE 250
           +G S I E+K  D+++  G   G  I    E D     S G  +        T+  +   
Sbjct: 252 RGESYIKERKIFDVEVSKGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKDS 311

Query: 251 KMHDFLKRDGNDLTY-TLPLSFKESLLGFSKTVHTIDGR------QIFISKTQPVQPSEE 303
           K H  + R G DL   +  +    SL G       IDG       ++ I   + + P+  
Sbjct: 312 KFHR-VNRYGCDLVMGSCSIDLSTSLCGGDIY---IDGHPSGKLLKVSIVPGELIGPNCL 367

Query: 304 SRYPGQGMPLSKNPSERGDLIVKYKIDYPITL 335
               G GMP   +   +G+L ++++++YP+ L
Sbjct: 368 KSIEGMGMPKYGHDGGKGNLYIQFQLEYPVGL 399

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGVSPN    E+KK YRK +++ HPDK   D   TE+F+ IS+A+++L++
Sbjct: 1  MVVDTTYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQVLSN 60

Query: 58 PNKREVYDKYGLE 70
             R  YDK+G E
Sbjct: 61 EELRTKYDKFGKE 73

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YDLLG+ P+ +  E+KK YRK A+  HPDK   D E   KF+ I +A+++L+D
Sbjct: 1  MVKDTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGQAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
          P  R  YD++G E
Sbjct: 61 PELRSRYDEFGKE 73

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  Y+LLG+SP+    E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTAYYELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
             R  YDKYG
Sbjct: 61 DTLRLKYDKYG 71

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+TK YD+LGV P+    ++KK YRK A++ HPDK   D E   KF+E+S+A+++L+D
Sbjct: 1  MVKDTKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEAQAKFQEVSKAYKVLSD 60

Query: 58 PNKREVYDKYGL 69
             R  YD+ GL
Sbjct: 61 GELRSRYDEVGL 72

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YDLLG+ P+ +  ++KK YRK A+  HPDK   D E   KF+ I EA+++L+D
Sbjct: 1  MVKDTEYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
          P+ R  YD++G E
Sbjct: 61 PDLRSRYDEFGKE 73

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVKET+ YD+LG+ P+    E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKETEYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
          P  R  YD++G E
Sbjct: 61 PGLRSKYDEFGKE 73

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
          (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILND 57
          MV  ++LYD+L +S N +  ++KK YR  ALKYHPDK     E    F++ISEA+E+L D
Sbjct: 1  MVMSSELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHSEESKVMFQKISEAYEVLID 60

Query: 58 PNKREVYDKYG 68
            KR++YD+YG
Sbjct: 61 VEKRKLYDQYG 71

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
          (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +LG+S NCN+ E+K  YR+ + K+HPDK   D +   KF EI EA+E+L+DP KR +Y
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDEDAHNKFIEIGEAYEVLSDPEKRRMY 84

Query: 65 DKYGLE 70
          D++G +
Sbjct: 85 DQFGAD 90

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 257 KRDGNDLTYTLPLSFKESLLG-FSKTVHTIDGRQIFISKTQP---VQPSEESRYPGQGMP 312
           +R G DL  T  L+ +E++ G +S+ +  +D  +    K  P   V   E  + PG GMP
Sbjct: 296 RRRGKDLFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMP 355

Query: 313 LSKNPSERGDLIVKYKIDYP 332
           +  +  + GDL + Y +  P
Sbjct: 356 ILGSKGKFGDLYIDYVVIKP 375

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGVSP+    E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+ 
Sbjct: 1  MVVDTAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLSS 60

Query: 58 PNKREVYDKYGLE 70
             R  YDK+G E
Sbjct: 61 DELRAKYDKFGKE 73

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVKET+ YD+LG+ P     E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKETEYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
          P  R  YD++G E
Sbjct: 61 PGLRSKYDEFGKE 73

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLLGVS   +  E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATERFQAISEAYQVLGD 60

Query: 58 PNKREVYDKYG 68
             R  YDKYG
Sbjct: 61 NELRVKYDKYG 71

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLLGVS   +  E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATERFQAISEAYQVLGD 60

Query: 58 PNKREVYDKYG 68
             R  YDK+G
Sbjct: 61 DELRAKYDKFG 71

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LGVSP     E+KK YRK A++ HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEAETKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
             R  YD++G
Sbjct: 61 TELRSRYDQFG 71

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +++ YDLLGVS      E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDSEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATERFQAISEAYQVLGD 60

Query: 58 PNKREVYDKYG 68
             R  YDKYG
Sbjct: 61 DELRAKYDKYG 71

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LGV+P     ++KK YRK A++ HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEAQSKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
          P  R  YD++G
Sbjct: 61 PGLRSKYDQFG 71

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVKET+ YD+LG+ P     E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
          P  R  YD++G E
Sbjct: 61 PGLRSKYDQFGKE 73

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 435

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 6/70 (8%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58
          TKLY++LGV+P+ +  E+KK YRK AL++HPDK   +        KFKEI+ A+EIL+D 
Sbjct: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61

Query: 59 NKREVYDKYG 68
          + R+ YD YG
Sbjct: 62 DSRKKYDVYG 71

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 71/138 (51%), Gaps = 10/138 (7%)

Query: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPS--TGGRQTLQFIIQE--KMHDFLK 257
           G   I E+K + + +  G + G  +  + E D  P   TG    L F+I+E  +    L+
Sbjct: 222 GKCVISEEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTGD---LLFVIEENPETSTNLE 278

Query: 258 RDGNDLTYTLPLSFKESLLGFSKTV-HTIDGR--QIFISKTQPVQPSEESRYPGQGMPLS 314
           R G+DL   L +S  E++ GF K V  T+D R  ++ I + + ++P    R   +G PL 
Sbjct: 279 RRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLD 338

Query: 315 KNPSERGDLIVKYKIDYP 332
            + ++ GD+ V+  I++P
Sbjct: 339 DSGNKFGDMYVQVHIEFP 356

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLG++PN    E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L++
Sbjct: 1  MVVDTAYYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATERFQAISEAYQVLSN 60

Query: 58 PNKREVYDKYG 68
             R  YD+ G
Sbjct: 61 DELRAKYDRLG 71

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGVSP+    ++KK YRK +++ HPDK   D   TE+F+ IS+A+++L+ 
Sbjct: 1  MVVDTTYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSK 60

Query: 58 PNKREVYDKYGLE 70
           + R  YDK+G E
Sbjct: 61 DDLRAKYDKFGKE 73

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LGV P+    E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
          P  R  YD++G
Sbjct: 61 PGLRSRYDEFG 71

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
          family overexpression interferes with propagation of
          the [Psi ] prion
          Length = 462

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 5/71 (7%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILND 57
          V  ++LYD+LGVS + +  ++KK YR  ALK+HPDK  G +E    KF++I +A+EIL D
Sbjct: 4  VSNSELYDILGVSASASRQDIKKAYRVNALKHHPDK-NGHSEESKLKFQQICKAYEILKD 62

Query: 58 PNKREVYDKYG 68
            KRE+YD++G
Sbjct: 63 ERKREMYDRFG 73

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}
          APJ1Putative chaperone of the HSP40 (DNAJ) family;
          overexpression interferes with propagation of the
          [Psi+] prion; the authentic, non-tagged protein is
          detected in highly purified mitochondria in
          high-throughput studies
          Length = 528

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M + T LYD L V+   + +E+KK YR AALKYHPDK     E   KF+EI +A+EIL D
Sbjct: 1  MQQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKD 60

Query: 58 PNKREVYDKYG 68
             R +YD+YG
Sbjct: 61 NRLRALYDQYG 71

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 432

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDPNK 60
          LYD LGVS +    E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D  K
Sbjct: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 61 REVYDKYG 68
          R  YD YG
Sbjct: 63 RSKYDTYG 70

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 7/139 (5%)

Query: 201 KGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHD----FL 256
           +G   I E K + + +  G + G +I ++ E D          L FI+ E         L
Sbjct: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRL 275

Query: 257 KRDGNDLTYTLPLSFKESLLGFSKTV-HTIDGRQIFIS--KTQPVQPSEESRYPGQGMPL 313
           +R G DL   + +S  E++ G  +T+  T+DGR + +S    + + P +  +   +G PL
Sbjct: 276 ERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL 335

Query: 314 SKNPSERGDLIVKYKIDYP 332
           + + ++ GDL V   I +P
Sbjct: 336 NSHATKFGDLYVLVDIVFP 354

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa]
          {ON} YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 5/66 (7%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILNDPNKRE 62
          LYD LGV+ N +  E+KK YR  ALK+HPDK  G +E    KF++I +A+EIL D  KRE
Sbjct: 9  LYDTLGVAANASRQEIKKAYRLKALKHHPDK-NGHSEQSKLKFQQICKAYEILGDDKKRE 67

Query: 63 VYDKYG 68
          +YD++G
Sbjct: 68 MYDRFG 73

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 59/145 (40%), Gaps = 13/145 (8%)

Query: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGD------YNPSTGGRQTLQFIIQEKMHDF 255
           G   + E+K  +I+++ G + G  +    E D      Y         +  I+++  H  
Sbjct: 230 GQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILEQLPHRS 289

Query: 256 LKR--DGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQP---VQPSEESRYPGQG 310
           LKR  D + L     +  K SL G +  V +    ++      P   ++P         G
Sbjct: 290 LKRGHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQSMG 349

Query: 311 MPLSKNPSERGDLIVKYKIDYPITL 335
           MP SK     GDL +K+K+ +P  L
Sbjct: 350 MPKSKGGY--GDLFIKFKVIFPDNL 372

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          ++     Y +LGV+ + ND E+K  YR+ + KYHPDK  GD E   KF E+ EA+++L+D
Sbjct: 17 LINAQDYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDEEAHNKFIEVGEAYDVLSD 76

Query: 58 PNKREVYDKYGLE 70
            KR +YD+YG +
Sbjct: 77 SEKRNIYDQYGAD 89

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLL +       E+KK YRK ++K HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTEYYDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATERFQAISEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
           N R  YDK+G E
Sbjct: 61 KNLRANYDKFGKE 73

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
          (REAL)
          Length = 533

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M   T LYD L V+   + +E+KK YR AALKYHPDK     E   KF+EI +A+E+L D
Sbjct: 1  MQHNTSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEVLKD 60

Query: 58 PNKREVYDKYG 68
           + R +YD+YG
Sbjct: 61 NHLRSLYDQYG 71

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  Y++LGV+P     E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTGYYEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATERFQAISEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
           + R  YD++G
Sbjct: 61 EDLRGKYDRFG 71

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILND 57
          MVKET  Y+LLGV P+   +E+KK YRK AL   P+K     G  EKF+ I+EA+++L+ 
Sbjct: 1  MVKETAYYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANEKFQAIAEAYQVLHS 60

Query: 58 PNKREVYDKYGLE 70
             RE YDK G E
Sbjct: 61 KELREKYDKLGKE 73

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ YDLLGV     D E+KK YRK ++  HPDK   D   TE+F+ ISEA+++L++
Sbjct: 1  MVVDTEYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATERFQSISEAYQVLSN 60

Query: 58 PNKREVYDKYGLE 70
           + R  YDK G E
Sbjct: 61 KDLRANYDKSGKE 73

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
          (REAL)
          Length = 536

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M   T LYD L V+   + +E+KK YR AAL+YHPDK     E   KF+EI +A+E+L D
Sbjct: 1  MQHNTSLYDSLNVTTTASTSEIKKAYRNAALRYHPDKNNHTEESKRKFQEICQAYEVLKD 60

Query: 58 PNKREVYDKYG 68
           + R +YD+YG
Sbjct: 61 NHLRSLYDQYG 71

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD LG+SP     E+KK YR+ A++ HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAENKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
           + R  YD+YG
Sbjct: 61 ESLRARYDEYG 71

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD LG+SP+    E+KK YRK A+  HPDK   D +   KF+ + +A+++L+D
Sbjct: 1  MVKDTEYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSD 60

Query: 58 PNKREVYDKYG 68
          P  R  YD++G
Sbjct: 61 PGLRSRYDEFG 71

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T+ YD+LG+ P+    E+KK YRK A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDAQSKFQSVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
           + R+ YD++G
Sbjct: 61 DDLRKRYDEFG 71

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MVK+T+ YD+LGV P    AE+KK YR+ A++ HPDK   D     KF+ + EA+++L+D
Sbjct: 1  MVKDTEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNAQAKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
             R+ YD+ G E
Sbjct: 61 DELRKRYDQLGKE 73

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON}
          Anc_8.264
          Length = 433

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 49/72 (68%), Gaps = 8/72 (11%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK----PTGDTE----KFKEISEAFEILN 56
          T LY +LGV+ N  D+++KK YRK AL++HPDK     + D E    KFKEIS A+EIL+
Sbjct: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61

Query: 57 DPNKREVYDKYG 68
          D +KR  YD YG
Sbjct: 62 DEDKRAHYDLYG 73

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 61/136 (44%), Gaps = 14/136 (10%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYN---PSTGGRQTLQFIIQEKMH---DF-LKRDG 260
           E K + + +  G + G  I   NE D     P TG    L F I+E      D  L+R G
Sbjct: 222 ESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTG---DLIFSIEEDQRCPKDVQLERKG 278

Query: 261 NDLTYTLPLSFKESLLGFSK--TVHTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKN 316
           ++    L +S  E+L GF       T DGR   + I   + ++P    +   +G PL+  
Sbjct: 279 SNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGE 338

Query: 317 PSERGDLIVKYKIDYP 332
            ++ GDL +   I++P
Sbjct: 339 ATKFGDLYISVNIEFP 354

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T  YDLLGVSP+    ++KK YRK +++ HPDK   D   TE+F+ ISEA+++L  
Sbjct: 1  MVFDTTYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLGS 60

Query: 58 PNKREVYDKYG 68
             R  YDK+G
Sbjct: 61 DELRAKYDKFG 71

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV +T+ Y+LLG+       E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+D
Sbjct: 1  MVVDTEYYELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATERFQAISEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
           + R  YDK+G E
Sbjct: 61 SDLRANYDKFGKE 73

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON}
          Anc_2.218 YNL077W
          Length = 554

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILND 57
          MV  T+LYD+L V  + +++ +KK YR  ALKYHPDK     E    F++ISEA+ +L++
Sbjct: 1  MVASTQLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEESKQMFQKISEAYVVLSN 60

Query: 58 PNKREVYDKYG 68
           +KR++YDKYG
Sbjct: 61 KDKRQMYDKYG 71

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON}
          Anc_8.264
          Length = 433

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILNDPNK 60
          LY +LGV+ +  D+E+KK YRK AL+YHPDK   P    E   KFKEI+ A+EIL+D  K
Sbjct: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 61 REVYDKYG 68
          R  YD YG
Sbjct: 64 RAHYDLYG 71

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 12/141 (8%)

Query: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEK------MHDF 255
           G   + E KQ+ + +  G +    I  +NE D          +  +I+E       +H F
Sbjct: 212 GKGLLSENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVH-F 270

Query: 256 LKRDGNDLTYTLPLSFKESLLGFSKTV--HTIDGRQIFIS--KTQPVQPSEESRYPGQGM 311
           + R G D    L LS  E+L GF       ++DGR + +S    + ++P    +   +G 
Sbjct: 271 I-RKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGW 329

Query: 312 PLSKNPSERGDLIVKYKIDYP 332
           P++   S+ GDL V  KI++P
Sbjct: 330 PVNPQASKFGDLYVIIKIEFP 350

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON}
          YMR214W (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          +V     Y +LGVS + +D E+K  YR+ + K+HPDK  GD +   KF E+ EA+E+L+D
Sbjct: 20 LVAAQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDEDAHHKFIEVGEAYEVLSD 79

Query: 58 PNKREVYDKYGLE 70
            KR++YD++G E
Sbjct: 80 DQKRQIYDQHGAE 92

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 257 KRDGNDLTYTLPLSFKESLLG-FSKTVHTID-GRQIFISKTQ--PVQPSEESRYPGQGMP 312
           +R G  L  T  LS KE+LLG + + +   D  +++ + + Q  PV+  E  R PG GMP
Sbjct: 285 RRRGPHLYRTEVLSLKEALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMP 344

Query: 313 LSKNPSERGDLIVKYKIDYPITLS 336
              +  + GDL V Y +  P  +S
Sbjct: 345 TGGH-GKHGDLFVDYVVVIPKKVS 367

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa]
          {ON} Anc_8.730 YMR214W
          Length = 373

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +LG++ + +D E+K  YR+ + K+HPDK  GD E   KF EI EA+E+L+DP KR+++
Sbjct: 23 YAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGDEEAHHKFIEIGEAYEVLSDPEKRKIF 82

Query: 65 DKYGLE 70
          D+YG +
Sbjct: 83 DQYGAD 88

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 257 KRDGNDLTYTLPLSFKESLLG-FSKTVHTIDGRQ---IFISKTQPVQPSEESRYPGQGMP 312
           +R G  L  T  LS +E+L G + + V  +D ++   I  +K   V   E  R PG GMP
Sbjct: 282 RRRGPHLYRTEVLSAREALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMP 341

Query: 313 LSKNPSERGDLIVKYKIDYPITLSE 337
                   GDL ++Y +  P  +S+
Sbjct: 342 QPNGKHAFGDLFIEYVVVMPHEISK 366

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+ + YD+LGVSP  +  E+KK YRK A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKDLEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPDAQAKFQRVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
             R+ YD++G
Sbjct: 61 EELRKRYDEFG 71

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+ + YD+LG+ P+   AE+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKDMEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDAQSKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYG 68
          P  +  YD++G
Sbjct: 61 PQLKSRYDQFG 71

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
          (REAL)
          Length = 532

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          M   T LYD L V+   + +E+KK YR AALKYHPDK     E   KF+EI +A+E L D
Sbjct: 1  MQHNTSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYETLKD 60

Query: 58 PNKREVYDKYG 68
           + R +YD+YG
Sbjct: 61 NHLRSLYDQYG 71

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
          family overexpression interferes with propagation of
          the [Psi ] prion
          Length = 461

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDP 58
          VK T+LYD L +S +    E+KK YR AALK HPDK     +   KF+EI +A+EIL D 
Sbjct: 4  VKNTELYDTLNISVDATPQEIKKAYRLAALKSHPDKNNHSEDSKRKFQEICKAYEILGDA 63

Query: 59 NKREVYDKYG 68
           K+ +YD+YG
Sbjct: 64 KKKLLYDRYG 73

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 67/157 (42%), Gaps = 16/157 (10%)

Query: 192 KRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGD-YNPSTGGRQTLQ----- 245
           +RK      KG   I E+K  +I+++PG   G +I    E D    +T G++ +      
Sbjct: 218 RRKDVCSECKGQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVI 277

Query: 246 FIIQEKMHDFLK--RDGNDLTYTLPLSFKESLLGFSKTVH---TIDGRQIFISKTQPVQP 300
            I+Q+  H   +   D + +     +  K SL G    +         +I +   + ++P
Sbjct: 278 IIVQQVKHPLFQIHNDTDLVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKP 337

Query: 301 SEESRYPGQGMPLSKNPSER--GDLIVKYKIDYPITL 335
                    GMP   +P  +  G+L +++++D+P  L
Sbjct: 338 GCVKCVESMGMP---HPQSQGFGNLYIRFQVDFPDKL 371

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LLGVS   +D ELKK +R+ AL+YHPDK   +    TE F +I  A+E+LNDP +
Sbjct: 3  TCYYELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVEEATETFAQIRAAYEVLNDPQE 62

Query: 61 REVYD 65
          R  YD
Sbjct: 63 RAWYD 67

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          MV ++  YDLLG+ P     E+KK YRK +++ HPDK   D   TE+F+ ISEA+++L+ 
Sbjct: 1  MVVDSTYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSS 60

Query: 58 PNKREVYDKYG 68
             R  YDK+G
Sbjct: 61 EELRAKYDKFG 71

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa]
          {ON} Anc_2.218 YNL077W
          Length = 460

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILNDPNKREV 63
          LYD+LGV+ + + +E+KK YRK AL+YHPDK  GD    E F++IS A+ +L D  +R+ 
Sbjct: 4  LYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEAFQKISHAYGVLGDVAQRQR 63

Query: 64 YDKYGLE 70
          YD+ G E
Sbjct: 64 YDQSGDE 70

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVKET+ YD+LG+ P     E+KK YR+ A++ HPDK   D +   KF+ + EA+++L+D
Sbjct: 1  MVKETEYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PNKREVYDKYGLE 70
             R  YD++G E
Sbjct: 61 QGLRSKYDEFGKE 73

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGDT--EKFKEISEAFEILNDPNKREVY 64
          Y +LGVS    D ++K  YR+ + KYHPDK P  D+   KF E+ EA+E+L+DP KR++Y
Sbjct: 22 YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSAHNKFIEVGEAYEVLSDPEKRKIY 81

Query: 65 DKYGLE 70
          D+YG E
Sbjct: 82 DQYGAE 87

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 6/67 (8%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDPNKR 61
           YD+LGV  +  + E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+DP  +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 62  EVYDKYG 68
             YD YG
Sbjct: 134 SRYDMYG 140

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 72/149 (48%), Gaps = 11/149 (7%)

Query: 192 KRKSFKITRKGPSG---IPEKKQIDIQLRPGWKAGTKITYKNEGD--YNPSTGGRQTLQF 246
           ++KS   T K  SG   I E+K   + +  G + G +       D  Y   TG    +  
Sbjct: 280 RKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETG--DVIIV 337

Query: 247 IIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTV-HTIDGRQIFIS--KTQPVQPSEE 303
           I ++     L+R  NDL  TL +S  ++L GFS  V  T D R++ ++    + ++P   
Sbjct: 338 IDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNY 397

Query: 304 SRYPGQGMPLSKNPSERGDLIVKYKIDYP 332
            ++ G+G PLS N    GD+ V+  I++P
Sbjct: 398 FKFKGEGWPLS-NGDSFGDMYVQINIEFP 425

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 5/74 (6%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK----PTGDTEKFKEISEAFEILN 56
          MV +T  YDLLGV+ +    ++KK YRK ++K HPDK    PT  TE+F+ ISEA+++L+
Sbjct: 1  MVVDTTYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTA-TERFQAISEAYQVLS 59

Query: 57 DPNKREVYDKYGLE 70
              R  YDK+G E
Sbjct: 60 SEELRMKYDKFGKE 73

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 52/73 (71%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MVK+T  YD+L VS + +  E+KK YRK A+K HPDK   D +   KF+E+++A+++L D
Sbjct: 1  MVKDTTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAYQVLID 60

Query: 58 PNKREVYDKYGLE 70
           + R+ YD++GL+
Sbjct: 61 DDLRKKYDQFGLD 73

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON}
          similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 375

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILND 57
          +V     Y +LGVS + ++ E+K  YR+ + KYHPDK  GD     KF E+ EA+E+L+D
Sbjct: 19 VVVAQDYYAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGDETAHHKFIEVGEAYEVLSD 78

Query: 58 PNKREVYDKYGLE 70
            KR++Y++YG E
Sbjct: 79 DQKRQIYNQYGAE 91

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 6/86 (6%)

Query: 257 KRDGNDLTYTLPLSFKESLLG-FSKTVHTID-GRQIFISKTQ--PVQPSEESRYPGQGMP 312
           +R G  L  T  L+ KE+L G + + +  +D  +++ + +    PV+  E  R PG GMP
Sbjct: 286 RRRGVHLHRTEVLTLKEALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMP 345

Query: 313 LSKNPSERGDLIVKYKIDYPITLSEQ 338
             K+    GDL V Y +  P  +S Q
Sbjct: 346 --KDGRHFGDLFVDYVVLTPHKVSAQ 369

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILNDP 58
          V +T  YDLLGV P+    ++KK YRK +++ HPDK   D   TE+F+ IS+A+++L+  
Sbjct: 3  VIDTTYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSKE 62

Query: 59 NKREVYDKYGLE 70
          + R  YDKYG E
Sbjct: 63 DLRAKYDKYGKE 74

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON}
          Anc_8.264 YLR090W
          Length = 429

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDP 58
          + LY++LGV  +    E+KK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61

Query: 59 NKREVYDKYG 68
           KR  YDKYG
Sbjct: 62 EKRARYDKYG 71

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 62/132 (46%), Gaps = 9/132 (6%)

Query: 208 EKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHD----FLKRDGNDL 263
           E K + + L  G +   +I  K E D          L F I+E         L+R G DL
Sbjct: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286

Query: 264 TYTLPLSFKESLLGFSKTV-HTIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSER 320
              L LS  E++ GFSKT+  T+DGR  Q+ I   + ++P    + P +G P+    S  
Sbjct: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-- 344

Query: 321 GDLIVKYKIDYP 332
           GDL V   I++P
Sbjct: 345 GDLYVVVHIEFP 356

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR090W
          (XDJ1)
          Length = 427

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 49/68 (72%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNK 60
          LY++LG++ + ++ E+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +L+D  K
Sbjct: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 61 REVYDKYG 68
          R  YD++G
Sbjct: 65 RAEYDQFG 72

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 74/138 (53%), Gaps = 11/138 (7%)

Query: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQT--LQFIIQEK--MHDFLK 257
           G   + E+  I + +  G + G ++ Y  + D  P   G++T  L F+I E+  +   L+
Sbjct: 216 GKCVVQEESIISVYVPRGSQHGDRLRYPGQSDMEP---GKETGDLVFVIDEQTDVSSSLE 272

Query: 258 RDGNDLTYTLPLSFKESLLGFSKTV-HTIDGR--QIFISKTQPVQPSEESRYPGQGMPLS 314
           R G DL  T+ +S  E+L GF++ V  T D R  +I I + + ++P    ++  +G P+ 
Sbjct: 273 RKGTDLYCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPI- 331

Query: 315 KNPSERGDLIVKYKIDYP 332
           ++ +  GD+ V+  I++P
Sbjct: 332 EDGARFGDMYVQVLIEFP 349

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214w SCJ1
          Length = 361

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +LG+S + +D E+K  YR+ + KYHPDK  GD E   KF E+ EA++IL DP KR+ Y
Sbjct: 22 YAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEKRKTY 81

Query: 65 DKYGLE 70
          D +G +
Sbjct: 82 DVHGAD 87

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           Y+LL +    +D+++KK YRK A+K HPDK   P    E FK+I+ AFE+L+D NKR+V
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRA-AEAFKKINRAFEVLSDENKRKV 83

Query: 64 YDKYGLE 70
          YD+ G +
Sbjct: 84 YDQIGCD 90

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
          Ashbya gossypii AER346W
          Length = 374

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +LGV    +D ++K  YR+ + KYHPDK  GD +   +F E+ EA+E L+DP KR++Y
Sbjct: 23 YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGDEDAHNRFIEVGEAYEALSDPEKRKIY 82

Query: 65 DKYGLE 70
          D++G E
Sbjct: 83 DQFGAE 88

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 257 KRDGNDLTYTLPLSFKESLLG-FSKTVHTIDGRQIFI---SKTQPVQPSEESRYPGQGMP 312
           +R G DL  T  LS  E+L G + + +  +D ++  +   SK  PVQ  E     G GMP
Sbjct: 284 RRRGPDLFRTEVLSLTEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMP 343

Query: 313 LSKNPSERGDLIVKYKIDYP 332
           L ++ ++ GDL V Y I  P
Sbjct: 344 L-ESGTKYGDLYVDYVIVMP 362

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
          (REAL)
          Length = 460

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPN 59
          +LYD+LGV+ + +  E+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP 
Sbjct: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68

Query: 60 KREVYDKYG 68
          K+  YD YG
Sbjct: 69 KKSHYDLYG 77

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILNDPNKREVY 64
          Y +LG++ + +D ++K  YR+ + KYHPDK  GD    ++F E+ EA+E+L+DP KR ++
Sbjct: 21 YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESAHQRFIEVGEAYEVLSDPEKRGIF 80

Query: 65 DKYGLE 70
          D+YG +
Sbjct: 81 DQYGAD 86

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 244 LQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLG-FSKTVHTID-GRQIFIS--KTQPVQ 299
           ++F   +K +   +R G+ L  T  LS +E+L G +S+ +  +D  +++ +   K   V 
Sbjct: 271 VEFTESDKNNMGYRRRGDHLFRTEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVH 330

Query: 300 PSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSE 337
             E  + PG GMP   +    GDL V+Y +  P    +
Sbjct: 331 HGEIEQIPGFGMPKGSSGKSFGDLFVEYAVVMPAQFKQ 368

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILNDPNKREVY 64
          Y +LGV     + ++K  YR+ + KYHPDK  GDT     F E+ EA+E L+DP KR +Y
Sbjct: 23 YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHNFIEVGEAYEALSDPEKRRIY 82

Query: 65 DKYGLE 70
          D+YG E
Sbjct: 83 DQYGAE 88

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 5/83 (6%)

Query: 257 KRDGNDLTYTLPLSFKESLLG-FSKTVHTID-GRQIFIS--KTQPVQPSEESRYPGQGMP 312
           +R G +L  T  LS KE+L G + + +  +D  +++  S  K Q VQ  E  R PG GMP
Sbjct: 278 RRQGANLFRTEVLSLKEALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMP 337

Query: 313 LSKNPSERGDLIVKYKIDYPITL 335
           L  + +  GDL V Y +  P T 
Sbjct: 338 LP-DSAGFGDLYVDYVVILPGTF 359

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
          similar to Ashbya gossypii AGR084C
          Length = 434

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNK 60
          LY +LG+  N  + E+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D  K
Sbjct: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 61 REVYDKYG 68
          R  YD YG
Sbjct: 65 RSEYDHYG 72

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 4/80 (5%)

Query: 256 LKRDGNDLTYTLPLSFKESLLGFSKTV-HTIDGR--QIFISKTQPVQPSEESRYPGQGMP 312
           L+R G DL  ++ +S  E+L GF++ V  T D R  +I I   + ++P    ++  +G P
Sbjct: 275 LERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP 334

Query: 313 LSKNPSERGDLIVKYKIDYP 332
           ++ N S  GDL VK  I++P
Sbjct: 335 IN-NGSRFGDLYVKVNIEFP 353

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}
          XDJ1Putative chaperone, homolog of E. coli DnaJ,
          closely related to Ydj1p; the authentic, non-tagged
          protein is detected in highly purified mitochondria in
          high-throughput studies
          Length = 459

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (63%), Gaps = 6/69 (8%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPN 59
          +LYD+LGV+ +    E+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP 
Sbjct: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68

Query: 60 KREVYDKYG 68
          K+  YD YG
Sbjct: 69 KKSHYDLYG 77

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 68/153 (44%), Gaps = 14/153 (9%)

Query: 194 KSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMH 253
           K+F     G   + +K+ I + + PG      IT K   D          L+F + EK  
Sbjct: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284

Query: 254 D------FLKR----DGNDLTYTLPLSFKESLLGFSKTV-HTIDGRQIFISKT--QPVQP 300
           +      FLK      G DL  ++ +S  E+L GF K +  T D R + +S    + V+P
Sbjct: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRP 344

Query: 301 SEESRYPGQGMPLSKNPSER-GDLIVKYKIDYP 332
            +  +   +G P+  NP  R GDL V   I++P
Sbjct: 345 GDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +LGV+ + ++ ++K  YR+ + K+HPDK  GD E   KF EI EA+E+L+D  KR  Y
Sbjct: 21 YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEAHHKFIEIGEAYEVLSDSEKRATY 80

Query: 65 DKYGLE 70
          D++G +
Sbjct: 81 DRFGAD 86

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LLGV    +DAELKK YRK AL++HPDK   +    TE F  I  A+E+L+DP +
Sbjct: 3  TCYYELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVDEATENFATIRAAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 4/64 (6%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNKREV 63
          Y+LLGV  + +D ELKK YRK AL+YHPDK   +    TEKF  I  A+E+L+DP +R  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATEKFAIIRAAYEVLSDPQERAW 65

Query: 64 YDKY 67
          YD +
Sbjct: 66 YDSH 69

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
          (REAL)
          Length = 456

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILNDPN 59
          +LYD+LGV+   +  E+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP 
Sbjct: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68

Query: 60 KREVYDKY 67
          K+  YD Y
Sbjct: 69 KKSHYDLY 76

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 20/91 (21%)

Query: 175 KVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTK--ITYKNEG 232
           K + ++L  +++DLY GK+  F++ R+   G  +          GWKA  K  +T++ E 
Sbjct: 127 KDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGS--------GWKAKKKVHVTHEMEC 178

Query: 233 DYNPSTGGRQTL----------QFIIQEKMH 253
           +     G ++ L          Q+++ EK H
Sbjct: 179 ESCGGKGSKERLKRFGPGLVASQWVVCEKCH 209

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LLGV  + +D ELKK YRK AL+YHPDK   +    T+KF  I  A+E+L+DP +
Sbjct: 3  TCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILNDPNKREVY 64
          Y +LG++ +  D E+K  YR+ + K+HPDK  G+    +KF E+ EA+E+L+DP KR+ +
Sbjct: 23 YQILGIAKDATDKEIKSAYRQLSKKFHPDKNPGNEDAHQKFIEVGEAYEVLSDPQKRQTF 82

Query: 65 DKYGLE 70
          D++G +
Sbjct: 83 DQFGAD 88

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 66/152 (43%), Gaps = 9/152 (5%)

Query: 190 AGKRKSFKITRKGPSG---IPEKKQIDIQLRPGWKAGTKITYKNEGDYNPST-GGRQTLQ 245
            GK + FK   +   G   +P+KK+  ++L  G K         E D NP    G   ++
Sbjct: 210 GGKGQLFKKQCRKCHGNKVMPQKKEFQVKLPKGAKRHYMDVKHGEADKNPDLEAGDLLIE 269

Query: 246 FIIQEKMHDFLKRDGNDLTYTLPLSFKESLL-GFSKTVHTIDGR---QIFISKTQPVQPS 301
           F   +K +   +R G +L  T  L+  E+L  G+ + +  +D +   Q+       V   
Sbjct: 270 FNENDKSNMGYRRRGQNLYRTEVLNVTEALYGGWQREIPFLDPKKKLQVGRESNIVVSHG 329

Query: 302 EESRYPGQGMPLSKNPSER-GDLIVKYKIDYP 332
           E  R PG GMP  K   E  GDL + Y +  P
Sbjct: 330 EVERIPGFGMPTGKGKKETFGDLFIDYVVIMP 361

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTG---DTEKFKEISEAFEILNDPNK 60
          T  Y+LLGV  + +D ELKK YRK AL+YHPDK PT     TE F  I  A+E+L+DP +
Sbjct: 3  TCYYELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATEIFATIRTAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           Y++L V    ND E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D  KR++
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKA-SEAFKIINRAFEVLSDVEKRQL 81

Query: 64 YDKYG 68
          YD+ G
Sbjct: 82 YDRIG 86

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILNDPNKREVY 64
          Y +LGV    ++ E+K  YR+ + KYHPDK  G+ E    F E+ EA+++L+DP KR++Y
Sbjct: 22 YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEKRQIY 81

Query: 65 DKYGLE 70
          D++G +
Sbjct: 82 DRHGAD 87

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 4/88 (4%)

Query: 257 KRDGNDLTYTLPLSFKESLLG-FSKTVHTIDG-RQIFISK--TQPVQPSEESRYPGQGMP 312
           +R GN L  T  LSFKE+L G + + +   D  + + +S+     VQ  E       GMP
Sbjct: 275 RRRGNTLYRTEILSFKEALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMP 334

Query: 313 LSKNPSERGDLIVKYKIDYPITLSEQQK 340
           +     + GDLI+ Y I  P   S   K
Sbjct: 335 IPSATDKFGDLIIDYVILLPGEWSTSSK 362

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           Y+LL V    +D ++KK YRK A+K HPDK   P    E FK+++ AFE+L+D  KR V
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRA-AEAFKKVNRAFEVLSDEKKRRV 83

Query: 64 YDKYGLE 70
          YD+ G +
Sbjct: 84 YDQLGYD 90

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           YD+L V  + +D ++KK YRK A+K HPDK   P    E FK I+ AFE+L+D  KR++
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKA-HEAFKLINRAFEVLSDSQKRQI 80

Query: 64 YDKYG 68
          YD+ G
Sbjct: 81 YDQIG 85

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKRE 62
          + Y++L V    ND E+KK YRK A++ HPDK   P   +E FK I+ AFE+L D  KR 
Sbjct: 22 QFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRA-SEAFKLINRAFEVLGDSEKRS 80

Query: 63 VYDKYG 68
          +YD+ G
Sbjct: 81 LYDRLG 86

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LLGV    +D +LKK YR+ AL+YHPDK  G+    TE F  I  A+E+L+D  +
Sbjct: 3  TCYYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATEIFASIRAAYEVLSDAQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILNDPNKREV 63
          + Y+LL V    +D E+KK YRK A++ HPDK T    +E FK I+ AFE+L+D  KR +
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEAFKRINRAFEVLSDVGKRRM 83

Query: 64 YDKYG 68
          +D+ G
Sbjct: 84 FDQLG 88

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK----PTGDTEKFKEISEAFEILNDPNK 60
          T  Y+LL VS   +D ELKK YRK AL+YHPDK    P   T  F EI  A+E+L+DP +
Sbjct: 3  TCYYELLEVSEYASDLELKKAYRKKALQYHPDKNRENPEEATAIFSEIRAAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
          (REAL)
          Length = 455

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 45/72 (62%), Gaps = 6/72 (8%)

Query: 3  KETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56
          +  +LY +LGV+ + +  E+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65

Query: 57 DPNKREVYDKYG 68
          DP K+  YD YG
Sbjct: 66 DPEKKSHYDLYG 77

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa]
          {ON} YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig
          173] FULL
          Length = 414

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNKR 61
          YD LGV+P+    E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++  KR
Sbjct: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 62 EVYDKYG 68
            YD YG
Sbjct: 64 RNYDTYG 70

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 63/134 (47%), Gaps = 3/134 (2%)

Query: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGN 261
           G    PE K +++ +  G +   +I  + E D  P       +  I ++     L+R G+
Sbjct: 209 GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGS 268

Query: 262 DLTYTLPLSFKESLLGFSKTVH-TIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPS 318
           DL   + +S  ++L GF K V  T+DGR  ++ I   Q ++P        +G PL     
Sbjct: 269 DLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGK 328

Query: 319 ERGDLIVKYKIDYP 332
           + G++ V+  I++P
Sbjct: 329 KFGNMYVQINIEFP 342

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDPNK 60
          T  Y+LLGV    +DA+LKK YRK AL YHPDK   + E+    F  I  A+E+L DP +
Sbjct: 3  TCYYELLGVETTASDADLKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYEVLADPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +L +  + ++ E+K  YR+ + KYHPDK  G  E   KF EI EA+E+L+DP K+++Y
Sbjct: 25 YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEAHHKFIEIGEAYEVLSDPEKKKIY 84

Query: 65 DKYGLE 70
          D++G +
Sbjct: 85 DQFGAD 90

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDPNK 60
          T  Y+LLGV  N  D ELKK YR+ AL++HPDK   + E+    F  +  A+E+L DP +
Sbjct: 3  TCYYELLGVETNATDVELKKAYRRKALQFHPDKNPDNVEETTAIFASVRAAYEVLADPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDDH 69

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDPNK 60
          T  YDLL V  + +D +LKK YR+ AL+YHPDK   + E+    F EI  A+E+L+DP +
Sbjct: 3  TCYYDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LLGV  + +D ELKK YRK AL+YHPDK   +    TEKF  I  A+E+L+D  +
Sbjct: 3  TCYYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATEKFAIIRAAYEVLSDSQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKP---------TGDTEKFKEISEAFEILNDP 58
           YDLLG+SP+ +D ++K  YR+ +LK+HPDK          T   E + +IS+A E L DP
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 59  NKREVYDKYG 68
             RE Y KYG
Sbjct: 187 IVRENYLKYG 196

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           Y++L V+   ND+E+KK YRK A+K HPDK   P    E FK I+ AFE+L +  KRE+
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKA-AEAFKLINRAFEVLGNSEKREI 81

Query: 64 YDKYG 68
          +++ G
Sbjct: 82 FNRIG 86

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILNDPNKREV 63
          + Y++L V     D E+KK YRK A+K HPDK +    +E FK I+ AFE+L++  KR +
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDKYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDPNK 60
          T  Y+LLGV    +D ELKK YRK ALKYHPDK   + E+    F  I  A+E+L+DP +
Sbjct: 3  TCYYELLGVESIASDLELKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           YD+L V     D E+KK YRK A+K HPDK   P   +E FK I+ AFE+L D  KR +
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKA-SEAFKRINRAFEVLGDEKKRVL 83

Query: 64 YDKYG 68
          +D+ G
Sbjct: 84 FDRIG 88

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 414

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 6/67 (8%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNKR 61
          Y+ LGV+P+    E+KK YR+ AL++HPDK + ++       KFKE++ A+E+L++  KR
Sbjct: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 62 EVYDKYG 68
          + YD YG
Sbjct: 64 QNYDTYG 70

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 3/129 (2%)

Query: 207 PEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYT 266
           PE K +++ +  G + G ++  K E D  P       +  I +      L+R G+DL   
Sbjct: 214 PESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAK 273

Query: 267 LPLSFKESLLGFSKTVH-TIDGR--QIFISKTQPVQPSEESRYPGQGMPLSKNPSERGDL 323
           + +S  ++L GF K V  T+DGR  ++ +   Q V+P    R   +G PL    S+ GD+
Sbjct: 274 ITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDM 333

Query: 324 IVKYKIDYP 332
            V+  I++P
Sbjct: 334 YVQIDIEFP 342

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LL V P  +D ELKK YR+ AL+YHPDK   +    TE F  I  A+E+L+DP +
Sbjct: 3  TCYYELLDVQPFADDNELKKAYRRKALQYHPDKNPENVEEATEIFASIRAAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LLGV     D ELKK YRK AL++HPDK   +    TE F  I  A+E+L+DP +
Sbjct: 3  TCYYELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVDEATEIFATIRSAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILNDPNK 60
          T  Y+LLGV    +D++LKK YR+ AL+YHPDK   + E+    F  I  A+E+L DP +
Sbjct: 3  TCYYELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEATTVFATIRSAYEVLADPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
          (REAL)
          Length = 378

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +L V  + ++ E+K  YR+ + KYHPDK +G  E   KF E+ EA+++L+DP K+++Y
Sbjct: 25 YAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGSEEAHHKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DKYGLE 70
          D++G +
Sbjct: 85 DQFGAD 90

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           Y++L +  + +D E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D  KR +
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRA-SEAFKVINRAFEVLSDEEKRRL 83

Query: 64 YDKYG 68
          YD+ G
Sbjct: 84 YDRLG 88

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPT--GDTEKFKEISEAFEILNDPNKREV 63
          + Y++L V     D+E+KK YRK A+K HPDK +     E FK I+ AFE+L++  KR +
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDKYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LLGV     D ELKK YRK AL++HPDK   +    TE F  I  A+E+L+DP +
Sbjct: 3  TCYYELLGVDITATDIELKKAYRKKALQFHPDKNPDNVEEATEIFATIRSAYEVLSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (67%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           Y++L V  + ++ E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D  KRE+
Sbjct: 23 FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKA-SEAFKVINRAFEVLSDNEKREI 81

Query: 64 YDKYG 68
          +D+ G
Sbjct: 82 FDRIG 86

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           YD+L V  + +  E+KK YRK A+K HPDK   P    E FK I+ AFE+L+D  KR V
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKA-GEAFKVINRAFEVLSDDEKRSV 83

Query: 64 YDKYGLE 70
          +D+ G +
Sbjct: 84 FDRIGRD 90

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           Y++L +    +D E+KK YRK A+K HPDK   P   +E FK I+ AFE+L+D  KR +
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRA-SEAFKRINRAFEVLSDEQKRRI 81

Query: 64 YDKYG 68
          +D+ G
Sbjct: 82 FDQVG 86

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa]
          {ON} Anc_2.218
          Length = 530

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKR 61
          T+LY +L V       E+K  Y+K ALKYHPDK     E   KF+EI +A+E+L+D +K+
Sbjct: 12 TRLYSILQVPTAATLFEIKNAYKKLALKYHPDKNNHSEESKLKFQEICKAYEVLHDKDKK 71

Query: 62 EVYDKYG 68
           +YD YG
Sbjct: 72 LLYDTYG 78

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 47/66 (71%), Gaps = 4/66 (6%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKRE 62
          + Y++L V  + +++++KK YRK A+K HPDK   P   +E FK+I+ AFE+L+D +KR 
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRA-SEAFKKINRAFEVLSDDSKRR 80

Query: 63 VYDKYG 68
          ++D+ G
Sbjct: 81 IFDQLG 86

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNKREV 63
          Y+LLGV  + +D ELKK YRK AL+YHPDK   +    T+KF  I  A+E+L+D  +R  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAIIRAAYEVLSDSQERAW 65

Query: 64 YDKY 67
          YD +
Sbjct: 66 YDSH 69

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
          several homologs of bacterial chaperone DnaJ, located
          in the ER lumen where it cooperates with Kar2p to
          mediate maturation of proteins
          Length = 377

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +L +  +  + E+K  YR+ + KYHPDK  G  E   KF E+ EA+++L+DP K+++Y
Sbjct: 25 YAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DKYGLE 70
          D++G +
Sbjct: 85 DQFGAD 90

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  Y+LL V    +DA+LKK YR+ AL+YHPDK   +    T+ F  I  A+EIL+DP +
Sbjct: 3  TCYYELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEATDIFANIRTAYEILSDPQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RVWYDSH 69

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILNDPNK 60
          T  YDLL V  +  D +LK+ YRK AL YHPDK   +    TE F +I  A+E+L+D  +
Sbjct: 3  TCYYDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIEEATEVFAQIRAAYEVLSDAQE 62

Query: 61 REVYDKY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILNDPNKRE 62
          ++ Y++L V    +D E+KK YR+ A+K HPDK       E FK I+ AFE+L D +KR 
Sbjct: 22 SEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEAFKVINRAFEVLGDEDKRR 81

Query: 63 VYDKYG 68
          ++D+ G
Sbjct: 82 LFDQLG 87

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPT--GDTEKFKEISEAFEILNDPNKREV 63
          + Y++L V     D+++KK YRK A+K HPDK +     E FK I+ AFE+L++  KR +
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDKYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +L +    ++ E+K  YR+ + K+HPDK  G  E   KF E+ EA+++L+DP K+++Y
Sbjct: 25 YAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DKYGLE 70
          D++G E
Sbjct: 85 DQFGAE 90

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa]
          {ON} Anc_8.730 YMR214W
          Length = 393

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILNDPNKREVY 64
          Y +LG+    ++  +K  YR+ + KYHPDK   D E    F EI EA+E+L+DP KR  Y
Sbjct: 31 YKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDEEAHNHFIEIGEAYEVLSDPEKRRTY 90

Query: 65 DKYG 68
          D++G
Sbjct: 91 DQFG 94

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 66/138 (47%), Gaps = 10/138 (7%)

Query: 202 GPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPST-GGRQTLQFIIQEKMHDFL--KR 258
           G   + + K+I++++  G         +N GD   +   G   +QF  QE   + L  +R
Sbjct: 245 GQKLVTKSKEINVKVPAGAPRDFLKIVENGGDKELNAEAGDLLVQF--QEIAQNNLGYRR 302

Query: 259 DGNDLTYTLPLSFKESLL-GFSKTVHTID-GRQIFISKTQ--PVQPSEESRYPGQGMPLS 314
            GNDL  T  L FK+++  G+++T+   D  R + IS+    PV   E  +  G GMP+ 
Sbjct: 303 RGNDLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPI- 361

Query: 315 KNPSERGDLIVKYKIDYP 332
           +     GDL + Y I  P
Sbjct: 362 QGSDRFGDLYIDYVIIVP 379

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKRE 62
          + Y +L V     D E+KK YRK A+K HPDK   P   +E FK I+ AFE+L++  KR 
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKA-SEAFKIINRAFEVLSNEEKRG 79

Query: 63 VYDKYG 68
          +YD+ G
Sbjct: 80 LYDRIG 85

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa]
          {ON} Anc_8.730
          Length = 376

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKREVY 64
          Y +L +  +  D +++  YR+ + KYHPDK   D +   KF E+ +A+EIL+DP KR+ Y
Sbjct: 24 YKILELDKDATDKDIRSAYRQLSKKYHPDKNPNDEDAHHKFIEVGQAYEILSDPEKRQRY 83

Query: 65 DKYGLE 70
          D++G E
Sbjct: 84 DQFGPE 89

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 66/148 (44%), Gaps = 9/148 (6%)

Query: 199 TRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEG--DYNPS-TGGRQTLQFIIQEKMHDF 255
           T  G   + + K  +I+L  G  A  K  +   G  D +P    G   ++F   +K +  
Sbjct: 224 TCHGSKVVQKPKDFEIELPAG--APRKFVHAEHGAADKHPDYDSGDVYIEFTENDKDNMG 281

Query: 256 LKRDGNDLTYTLPLSFKESLLG-FSKTVHTIDGRQIFISKTQP---VQPSEESRYPGQGM 311
            +R G  L  T  L+  E+L G + + +  +D  +I   K +P   +Q  E  R  G GM
Sbjct: 282 YRRRGPHLYRTEVLNATEALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGM 341

Query: 312 PLSKNPSERGDLIVKYKIDYPITLSEQQ 339
           PL       GDL + Y +  P +LS ++
Sbjct: 342 PLGNGRKGFGDLFIDYVVVMPESLSGEE 369

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPD-KPTG--DTEKFKEISEAFEILND 57
          MV +T  YD+LGV+P+    +  K YR  A++ HPD  PT      KF+E+S+A+++L+D
Sbjct: 1  MVLDTTYYDILGVTPSAFAEQNNKAYRMKAIQTHPDMNPTHPYAHAKFQEVSKAYKVLSD 60

Query: 58 PNKREVYDKYGL 69
          P+ +  Y ++GL
Sbjct: 61 PDLKNRYTEFGL 72

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDPNKREVY 64
           Y++L V    +D E+KK YRK A+K HPDK      +E FK I+ AFE+L+D  KR + 
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEAFKRINRAFEVLSDEQKRRIL 82

Query: 65 DKY 67
           ++
Sbjct: 83 TRW 85

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPNKREV 63
           Y++L V     + E+KK YRK A++ HPDK   P   +E FK I+ AFE+L+D  KR +
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKA-SEAFKIINRAFEVLSDNEKRRI 80

Query: 64 YDKYG 68
          +D+ G
Sbjct: 81 FDQLG 85

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 42/74 (56%), Gaps = 10/74 (13%)

Query: 4  ETKLYDLLGVSPNCNDA-------ELKKGYRKAALKYHPDKPTGDT---EKFKEISEAFE 53
             LY +LG SP   DA       +++K YRK AL+YHPDK   DT    KF ++S A +
Sbjct: 12 RVNLYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDKNPHDTSLIHKFHQVSVATK 71

Query: 54 ILNDPNKREVYDKY 67
          IL+D   R +YD +
Sbjct: 72 ILSDSRLRSLYDSW 85

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPD---KPTGDTEKFKEISEAFEILND 57
          MV     Y++LGV  +CN+ ++KK Y+   L  HPD   K  G+    +EI EA+ +L +
Sbjct: 1  MVNNRSFYEILGVEADCNEVDIKKAYKAKLLSTHPDKVGKDVGNKVLIEEIKEAYRVLIE 60

Query: 58 PNKREVYDK 66
             RE YDK
Sbjct: 61 SPSREKYDK 69

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 40/70 (57%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           YDLLGVS   +D E+K  YRK +LK+HPDK   D          E + +IS+A+E L D 
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 59  NKREVYDKYG 68
             ++ Y  YG
Sbjct: 182 LVKQNYLMYG 191

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa]
          {ON} Anc_8.264 YLR090W
          Length = 439

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 40/70 (57%), Gaps = 11/70 (15%)

Query: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55
          LY +L V       ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 56 NDPNKREVYD 65
          +D  KR+ YD
Sbjct: 72 SDEEKRKQYD 81

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 7/146 (4%)

Query: 194 KSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQE--K 251
           K+F +   G   I   + I + +  G      I   N+ D          L F+++E   
Sbjct: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265

Query: 252 MHDFLKRDGN-DLTYTLPLSFKESLLGFSK--TVHTIDGR--QIFISKTQPVQPSEESRY 306
               LKR G+ DL   L +S  +++ GF +   V T+DGR  ++ I   + ++  +  + 
Sbjct: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKV 325

Query: 307 PGQGMPLSKNPSERGDLIVKYKIDYP 332
            G+G PL+KN +  GDL +K+ I++P
Sbjct: 326 EGEGWPLNKNATRSGDLYIKFNIEFP 351

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
          (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 6/64 (9%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNKR 61
          Y++LGV+ +    E+KK YRK AL+YHPDK   + +      KFK+I+ A++ L+D +KR
Sbjct: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 62 EVYD 65
            YD
Sbjct: 74 NEYD 77

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 63/145 (43%), Gaps = 6/145 (4%)

Query: 194 KSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKM- 252
           K+F     G   I     I + +  G   G  I  K E D          L F I E + 
Sbjct: 204 KNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIID 263

Query: 253 -HDFLKRDGNDLTYTLPLSFKESLLGFSK--TVHTIDGRQIFIS--KTQPVQPSEESRYP 307
            ++ L+R GN L     +S  E++ GF     V T D R +++S  K + ++P +     
Sbjct: 264 SNNDLERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVK 323

Query: 308 GQGMPLSKNPSERGDLIVKYKIDYP 332
            +G P+ K  +  G+L V  +I++P
Sbjct: 324 NEGWPMDKYGASFGNLYVILEIEFP 348

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 42/62 (67%), Gaps = 2/62 (3%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDPNKREVYD 65
           Y+ LGV+ + + +++KK Y K A ++HPD  K  G  +KF ++  A+EIL+D NKR  YD
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKDEGAEKKFHDLQNAYEILSDENKRRQYD 102

Query: 66  KY 67
           ++
Sbjct: 103 QF 104

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 255 FLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQPSEESRYPGQGMPLS 314
           F  ++  D+ Y   +    + LG + ++ T+DG QI +      QP +    P +G+P  
Sbjct: 328 FQIKNNYDIWYVQEIPITTAALGGTVSIPTVDGDQIRLKVIPGTQPDQVVSIPNKGVPRG 387

Query: 315 KNPSERGDLIVKYKI 329
            + + RGD+ V+Y+I
Sbjct: 388 LSGA-RGDMKVQYRI 401

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK------PTGDT---EKFKEISEAFEILNDP 58
           Y++LGVS +  D E+K  YRK ++K+HPDK      P   T   E + +I++A+E L D 
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 59  NKREVYDKYG 68
           N +E Y +YG
Sbjct: 184 NVKENYLRYG 193

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILNDPN 59
           Y +LGVSPN N  E++K Y     KYHPDK   +         E   +I+EA+E L+D +
Sbjct: 544 YKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSDED 603

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 604 KRKEYD 609

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y+LLG+S + +D ++K  YRK ++K+HPDK + D          EK+ +I++A+E L D 
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 59  NKREVYDKYG 68
             +E + KYG
Sbjct: 183 VIKENFLKYG 192

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON}
          Anc_8.264 YLR090W
          Length = 432

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILND 57
          YD+LGV  +  D E++K YRK ALK+HPDK     E      KFKEI+ A+EIL++
Sbjct: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 65/140 (46%), Gaps = 15/140 (10%)

Query: 206 IPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHD---------FL 256
           I EK+Q+ + +  G +    I +K +GD +  T  R+    + + K+HD          +
Sbjct: 221 IKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRT--RRAGDIVFRLKLHDEPNGGDPDILV 278

Query: 257 KRDGNDLTYTLPLSFKESLLGFSK--TVHTIDGRQIFISKTQ--PVQPSEESRYPGQGMP 312
            ++G DL   + +   E++ G        T D R + ++  Q   ++P +     G+G P
Sbjct: 279 TKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWP 338

Query: 313 LSKNPSERGDLIVKYKIDYP 332
            + N +E GD+ V   +++P
Sbjct: 339 KTPNGTEFGDMFVHVNVEFP 358

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 163 GMHSHSHAQQEEKVVQVNLPVSLEDLYAGKRKSFKITR 200
           G H     +   +  Q+ + V+L+DLY GK   F++TR
Sbjct: 100 GGHPQREDESTNEATQIEIEVTLKDLYNGKNVKFQLTR 137

>ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON}
          similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and weakly similar to YJL162C uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 503

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDPN 59
          + ET  Y  LG+S N +D E+ K Y K A + HPDK   D   E FK IS A  +L D  
Sbjct: 9  LDETTYYSTLGLSTNASDKEIHKSYVKLARELHPDKSKSDGAAELFKLISHAHSVLMDKE 68

Query: 60 KREVYDK 66
          K++ YDK
Sbjct: 69 KKDAYDK 75

>Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON}
          similar to Ashbya gossypii AFR659W
          Length = 270

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 9/73 (12%)

Query: 4  ETKLYDLLGVS-------PNCNDAELKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEI 54
          +  LYD L ++        N + ++L+K YR+ ALKYHPDK T     EKF +I  AF++
Sbjct: 11 DINLYDELQIAILSKEDLNNVSISQLRKQYRQMALKYHPDKSTAPNAQEKFLKIKLAFDV 70

Query: 55 LNDPNKREVYDKY 67
          L+D + R+ Y+++
Sbjct: 71 LSDSDSRKRYNQW 83

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y LLGVSP+  D ++K  YRK ++K+HPDK + D          E + +IS+A+E L D 
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 59  NKREVYDKYG 68
             +  Y  YG
Sbjct: 185 ITKANYLTYG 194

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTG-DTEKFKEISEAFEILNDPNKREVYD 65
          YD+LG++ +    E+++ YR+  L+ HPDK  G D      I +A+ +L+DP +R  YD
Sbjct: 6  YDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGAVTRIQQAYRVLSDPTQRSAYD 64

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y+LLGV+ +  D E+K  YRK ++K+HPDK + D          E+F  I++A++ L D 
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDE 172

Query: 59  NKREVYDKYG 68
             +E Y KYG
Sbjct: 173 ITKENYRKYG 182

>KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92
          YGL128C
          Length = 277

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 1/49 (2%)

Query: 20 AELKKGYRKAALKYHPDKPTG-DTEKFKEISEAFEILNDPNKREVYDKY 67
          A+LK+ YRK +LKYHPDK T  + E+F  +S A +IL + + R VYDK+
Sbjct: 33 ADLKRQYRKLSLKYHPDKTTDQNAERFHAVSMAMQILGEDHLRSVYDKW 81

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 40/61 (65%), Gaps = 2/61 (3%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDPNKREVYD 65
          Y +LGV  + +  E+KK Y K A +YHPD  K  G  +KF ++  A+EIL+D +KR+ +D
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPDINKEAGAEKKFHDLQNAYEILSDESKRKQFD 96

Query: 66 K 66
          +
Sbjct: 97 Q 97

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 62/143 (43%), Gaps = 11/143 (7%)

Query: 210 KQIDIQLRPGWKAGTKITYKNEGDY-----NPSTGGRQTL---QFIIQEKMHD---FLKR 258
           K+I + L  G + G  I    +G Y     +PS  G   L     ++  ++ +   F  R
Sbjct: 283 KEITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKLTRGDVLVNVRVEEDPTFTIR 342

Query: 259 DGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQPSEESRYPGQGMPLSKNPS 318
           D +D+ YT+ +    + LG +  V T+DG  I +      Q  +    P  G+P S    
Sbjct: 343 DKSDIWYTMEIPITTAALGGTVQVPTVDGSHIRLKVAPGTQSGDVITVPNMGVPRSNLTR 402

Query: 319 ERGDLIVKYKIDYPITLSEQQKL 341
            RG + V+Y+I      SE +K 
Sbjct: 403 SRGAMKVQYRIVIKKPSSEVEKC 425

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 4  ETKLYDLLGVSPN---CNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILND 57
          +  LYD+LG   N       E+KK YR  ALKYHPDK   D    EKF +I+ A  IL +
Sbjct: 12 KVNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDLTLVEKFHKITIALNILTN 71

Query: 58 PNKREVYDKY 67
             +  YDK+
Sbjct: 72 NQLKTEYDKW 81

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y+LLG+S + ++ ++K  YRK ++K+HPDK + D          E + +I++A+E L D 
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 59  NKREVYDKYG 68
             RE + KYG
Sbjct: 191 AMRENFLKYG 200

>KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON}
          Anc_1.113 YJR097W
          Length = 163

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFK--EISEAFEILNDPNKREVYD 65
          Y++L V       ELKK YR   L  HPDK    T K+   +I EA+ IL+DP  R+ YD
Sbjct: 7  YEVLNVPAQVTPDELKKSYRVLLLSTHPDKSNVTTSKYSIDQIKEAYRILSDPVSRKTYD 66

Query: 66 KYGLE 70
           + LE
Sbjct: 67 AHLLE 71

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDP 58
          ++ ET  Y  LG+S N N+AE+ K Y   A + HPDK   +   E+FK IS A  +L D 
Sbjct: 8  ILDETTYYSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEASAEQFKLISHAHSVLMDE 67

Query: 59 NKREVYDK 66
           KR  YD+
Sbjct: 68 AKRLKYDE 75

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPT--GDTEKFKEISEAFEILNDPNKREVYD 65
          YD++GV    +  +LK  Y++   K HPDK +  G  E F  + +A++ L++  KR +YD
Sbjct: 25 YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEAFALVHKAYKTLSNKQKRAMYD 84

Query: 66 KYG 68
          KYG
Sbjct: 85 KYG 87

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT----EKFKEISEAFEILNDPNKREV 63
          Y++LGV+ +  + ELKK YRK  L+ HPDK    T    EKF +I  AFE+L+    +E 
Sbjct: 16 YEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWTPEAKEKFHKIQFAFEVLD--KFKET 73

Query: 64 YDKYG 68
          YDK G
Sbjct: 74 YDKTG 78

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa]
          {ON} Anc_8.730 YMR214W
          Length = 384

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 8  YDLLGVSPNCN-DAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILNDPNKREV 63
          Y +LG++ N   + E+K  YRK + KYHPDK   D    + F ++ EA+++L DP+K+  
Sbjct: 26 YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQNFIKVGEAYDVLGDPDKKRQ 85

Query: 64 YDKYG 68
          YD+ G
Sbjct: 86 YDQMG 90

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 257 KRDGNDLTYTLPLSFKESLLG-FSKTVHTIDGRQIFISKTQP---VQPSEESRYPGQGMP 312
           +R GN+L  T  +S  E+L G + +T+  +D ++    K  P   +   E     G GMP
Sbjct: 295 RRRGNNLFRTEYISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMP 354

Query: 313 LSKNPSERGDLIVKYKIDYP 332
           +    ++ GDL + YK+  P
Sbjct: 355 IPNKKNKFGDLYIDYKVIIP 374

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 38/67 (56%), Gaps = 9/67 (13%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK---------PTGDTEKFKEISEAFEILNDP 58
           Y +LG+ P  +D E++K Y     KYHPDK            + EK  EI+EA+E+LND 
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 59  NKREVYD 65
            KR+ YD
Sbjct: 603 EKRKEYD 609

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK---------PTGDTEKFKEISEAFEILNDP 58
           YD+LG+S + ++ E+K  YRK ++K+HPDK          T   E + +I++A+E L D 
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 59  NKREVYDKYG 68
             R+ + KYG
Sbjct: 181 LTRQNFLKYG 190

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y++LGV+ +  + E+KK YR  +LK+HPDK   +          E F +IS+A+E L +P
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALTNP 182

Query: 59  NKREVYDKYG 68
             +E Y  YG
Sbjct: 183 ATKENYLLYG 192

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
          similar to uniprot|Q12014 Saccharomyces cerevisiae
          YLR090w
          Length = 452

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56
          Y LLGV  + +  E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 57 DPNKREVYDK 66
          D + R  YD+
Sbjct: 64 DASLRAEYDQ 73

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 64/140 (45%), Gaps = 14/140 (10%)

Query: 206 IPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEK---MHDFLKRDGND 262
           + E K + I ++ G   G KI  K E D +  +     L   IQE     +D + R+G D
Sbjct: 233 VEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIV-RNGYD 291

Query: 263 LTYTLPLSFKESLLGFSK--TVHTIDGRQIFIS--KTQPVQPSEESRYPGQGMPLSKNPS 318
           L     +   +++ GF +   + T DGR +  S  + + ++P++  R   +G P  ++ +
Sbjct: 292 LIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAN 351

Query: 319 E------RGDLIVKYKIDYP 332
           +       GDL V   I +P
Sbjct: 352 DNNTLLKNGDLYVIVDIVFP 371

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y LL VS +  D E++  YRK ++K+HPDK + D          E++  I++A++ L D 
Sbjct: 119 YALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

Query: 59  NKREVYDKYG 68
             RE Y KYG
Sbjct: 179 VTRENYLKYG 188

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDPNKREVYD 65
           Y  LGVS + + +++K+ Y K A KYHPD  K  G  + F  +  A+EIL+D  K+  YD
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKTFHNLQNAYEILSDEKKKLQYD 109

Query: 66  KYG 68
           +YG
Sbjct: 110 QYG 112

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 11/134 (8%)

Query: 206 IPEKKQIDIQLRPGWKAGTKITYKNEGDY-NPSTG--------GRQTLQFIIQEKMH-DF 255
           I  KK +++    G   G  I    EG Y N + G         R  L   I+ K    F
Sbjct: 280 INSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVKSDPKF 339

Query: 256 LKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQPSEESRYPGQGMPLSK 315
             ++  D+     +    + LG +  + T+DG+ I +      Q  + +  P  G+P  +
Sbjct: 340 FVKNKYDIWTIKEIPITTAALGGTVEIETVDGKNIRLKVISGTQHDQVTSIPNMGIPY-R 398

Query: 316 NPSERGDLIVKYKI 329
           N + RG++ V+YKI
Sbjct: 399 NGTGRGNMNVQYKI 412

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (60%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSPNCNDAELKKGYRKAALKYHPDKP----TGD-----TEKFKEISEAF 52
           TKL+D   +LG+S + +D ++K  YRK ++K+HPDK     T D      E + +I++A+
Sbjct: 121 TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAY 180

Query: 53  EILNDPNKREVYDKYG 68
           E L D   R+ Y KYG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDPN 59
          + +T  Y +LG++ +  +A++KK YRK A+  HPD  K     E FK +S A  +L D  
Sbjct: 8  IDQTTHYSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAELFKLVSHAQSVLIDKE 67

Query: 60 KREVYDK 66
          +R+ Y++
Sbjct: 68 QRQSYNR 74

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK-PTGDTE--------KFKEISEAFEILNDP 58
           Y+LLG+S + +D ++K  YRK +LK+HPDK P G +E        ++ +I++A+E L D 
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 59  NKREVYDKYG 68
             R  Y  YG
Sbjct: 183 LIRFNYLTYG 192

>NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185
          Length = 594

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDPN 59
          + ET  Y +LG+ P   D E++K Y K A K HPDK   DT  E FK +  A  IL D  
Sbjct: 14 LDETTYYSILGLHPQATDNEIRKSYMKFARKLHPDKSKSDTCAELFKLVVHAHSILTDKE 73

Query: 60 KREVYDK 66
           +  YD+
Sbjct: 74 LKLEYDR 80

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 15/136 (11%)

Query: 207 PEKKQIDIQLRPGWKAGTKITYKNEGDY-NPSTGGRQTLQFII------------QEKMH 253
           P ++ + ++L PG   G  I    +G Y N +    Q  Q  +            Q+K+ 
Sbjct: 292 PVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQRDQVKVTRGDLLVRIRVKQDKV- 350

Query: 254 DFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQPVQPSEESRYPGQGMPL 313
            F  R+GN+L  T  +    ++LG +  + T+DG Q+ +      +  E    PGQG+P 
Sbjct: 351 -FSIRNGNELWQTREIPVTTAVLGGNVVIPTLDGNQLRLRVRSGTRDGETVSVPGQGVPR 409

Query: 314 SKNPSERGDLIVKYKI 329
            +    RGD+ V++++
Sbjct: 410 GRGGLSRGDMKVQWRV 425

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDPNKREVYD 65
           Y +LG++ +   +E+KK Y K A KYHPD  K  G  +KF +I+ A+EIL+D  K+  YD
Sbjct: 49  YKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKGSDKKFHDITNAYEILSDEKKKMQYD 108

Query: 66  KYG 68
           ++G
Sbjct: 109 QFG 111

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDPNKRE 62
          T  Y +LG++PN  D E++K Y   A K HPDK   +   E FK +  A  IL D  K+ 
Sbjct: 12 TTHYSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGELFKLVVHAHSILTDVEKKR 71

Query: 63 VYD 65
           YD
Sbjct: 72 AYD 74

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILND 57
          MV+    Y++LGV      AE+KK Y++  L  HPDK           +EI EA+++L +
Sbjct: 1  MVQVRSYYEILGVDTKSTVAEIKKAYKEKLLCTHPDKNRTVEAQNVSIEEIKEAYQVLVN 60

Query: 58 PNKREVYDK 66
          P+ +E YDK
Sbjct: 61 PSGKENYDK 69

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDPN 59
          + ET  Y +LG++P   D E++K Y K A + HPDK   D+  E FK +  A  IL D  
Sbjct: 3  LDETTYYSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAELFKLVVHAHSILTDEE 62

Query: 60 KREVYD 65
           +  YD
Sbjct: 63 TKRKYD 68

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSPNCNDAELKKGYRKAALKYHPDK-PTGDT--------EKFKEISEAF 52
           TKL+D   +LGVS + +D ++K  YRK ++K+HPDK   G T        E + +I++A+
Sbjct: 121 TKLFDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAY 180

Query: 53  EILNDPNKREVYDKYG 68
           E L D   R+ Y KYG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILNDPN 59
           Y +LGVSP+ +  E++K Y     KYHPDK   +         E   +I+EA+E L+D +
Sbjct: 540 YKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDD 599

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 600 KRKEYD 605

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILNDPN 59
           Y +L V  N N  +++K Y +   KYHPDK           + EK   I+EA+EIL+D +
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSDES 568

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 569 KRKEYD 574

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y LL +S +  D E++  YRK ++K+HPDK + D          E++  I++A++ L D 
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 59  NKREVYDKYG 68
             RE Y +YG
Sbjct: 177 ITRENYLRYG 186

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILNDPN 59
           Y  LGV+P+    E++K Y     KYHPDK   +         E   +I+EA+E L+D N
Sbjct: 540 YKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSDDN 599

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 600 KRKEYD 605

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (60%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSPNCNDAELKKGYRKAALKYHPDK-PTGDT--------EKFKEISEAF 52
           TKL+D   +LG+S + +D ++K  YRK ++K+HPDK   G T        E + +I++A+
Sbjct: 121 TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAY 180

Query: 53  EILNDPNKREVYDKYG 68
           E L D   R+ Y KYG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK----PTGD-----TEKFKEISEAFEILNDP 58
           Y++LG+S + +D ++K  YRK ++K+HPDK     T D      E + +I++A+E L D 
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 59  NKREVYDKYG 68
             R+ Y KYG
Sbjct: 187 LVRQNYLKYG 196

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (64%), Gaps = 4/62 (6%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILNDPNKREVY 64
          Y+ LG++ +C+  E+KK Y++  L  HPDK  GD   + +  +I EA+++L D N RE Y
Sbjct: 6  YETLGLNSDCSLEEIKKAYKEKLLSSHPDK-IGDESSSVEVNKIQEAYKVLCDVNLREKY 64

Query: 65 DK 66
          D+
Sbjct: 65 DE 66

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YGL128C (CWC23)
          Length = 273

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 10/71 (14%)

Query: 7  LYDLLGVSPN-------CNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILN 56
          LY LL VS +        + A+L+  +R+ AL+YHPDK   DT+   KF  + +A++IL+
Sbjct: 16 LYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAYDILS 75

Query: 57 DPNKREVYDKY 67
          + + R  Y+++
Sbjct: 76 NSSLRATYNRW 86

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 8/67 (11%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDPNKR 61
          Y  L +S +  D+++KK YR+  L+YHPDK + D       ++F ++  ++E+L     R
Sbjct: 14 YATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVL--TKFR 71

Query: 62 EVYDKYG 68
          E+YDK G
Sbjct: 72 EIYDKSG 78

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILNDPN 59
           Y +L V+P     +++K Y     KYHPDK           + E+  EI+EA+EIL+D  
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 565 KRKEYD 570

>TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa]
           {ON} Anc_5.4 YGR285C
          Length = 433

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 3   KETKLYDLLGVSP---NCNDAELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S       ++++ K +RK  LKYHPDK +           FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRYRATESQIIKAHRKQVLKYHPDKKSASGASLDQDGFFKIIQKAFE 153

Query: 54  ILNDPNKREVYDKYGLE 70
            L DP KR  YD    E
Sbjct: 154 TLTDPTKRSQYDSCDFE 170

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y LLGV+ +  D E++  YRK ++K+HPDK   D          E++  I++A++ L D 
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 59  NKREVYDKYG 68
             +E Y K+G
Sbjct: 178 ITKENYLKFG 187

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILNDPN 59
          V ET  Y +LG+  + +++++KK YR+ A+  HPD  K     E FK +S A  +L D  
Sbjct: 8  VDETTHYSVLGLKSDASESQIKKAYRRIAMAIHPDKNKSASAAEMFKLVSHAQSVLIDKE 67

Query: 60 KREVYDK 66
           R  Y++
Sbjct: 68 LRRTYNR 74

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILNDPN 59
           Y +LGV+ N +   ++K Y     KYHPDK           + EK  EI+EA+EIL D +
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGDES 615

Query: 60  KREVYD 65
           K++ YD
Sbjct: 616 KKKEYD 621

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           Y+LLG+  +  + E++  YRK ++K+HPDK + D          E++  I++A++ L + 
Sbjct: 117 YELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

Query: 59  NKREVYDKYG 68
             RE Y KYG
Sbjct: 177 VTRENYLKYG 186

>KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285C ZUO1 Cytosolic ribosome-associated chaperone
           contains a DnaJ domain together with Ssz1p acts as a
           chaperone for nascent polypeptide chains
          Length = 428

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 3   KETKLYDLLGVSP---NCNDAELKKGYRKAALKYHPDK--PTGDTEK---FKEISEAFEI 54
           K   LY  +G+S       DA++ K +RK  LK+HPDK   +G  E+   FK I +A+E 
Sbjct: 93  KTADLYAAMGLSKLRHKATDAQVIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYET 152

Query: 55  LNDPNKREVYD 65
           L DP KR+ YD
Sbjct: 153 LTDPTKRKQYD 163

>Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON}
          (110867..111739) [873 nt, 291 aa]
          Length = 290

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 6/67 (8%)

Query: 9  DLLGVSPNCND---AELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNKRE 62
          DL+G     N+    E++K YR+ ALKYHPDK   + +    F +IS A +IL D + RE
Sbjct: 23 DLVGNRRQPNEITLTEIRKEYRRLALKYHPDKNISNVDIDSIFHDISLANQILCDSSLRE 82

Query: 63 VYDKYGL 69
           YDK+ +
Sbjct: 83 QYDKWYI 89

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILNDPN 59
           Y +LGV+P     E++K Y     KYHPDK   +         E   +I+EA+E L+D +
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSDDD 596

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 597 KRKEYD 602

>SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 432

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 3   KETKLYDLLGVSP---NCNDAELKKGYRKAALKYHPDK--PTGDTEK---FKEISEAFEI 54
           K   LY  +G+S       DA++ K +RK  LK+HPDK   +G  E+   FK I +A+E 
Sbjct: 94  KTADLYAAMGISKLRYKATDAQIIKAHRKQVLKHHPDKKSASGGLEEDGFFKIIQKAYET 153

Query: 55  LNDPNKREVYD 65
           L D NKR  YD
Sbjct: 154 LTDSNKRAQYD 164

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK--------FKEISEAFEILNDPN 59
          Y++L V    + +++K+ YR+  L  HPDK  G   +         ++I +A+ +L DP 
Sbjct: 6  YEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVLADPT 65

Query: 60 KREVYD 65
          +RE YD
Sbjct: 66 RREQYD 71

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILNDP 58
           YD+LG+S + +D ++K  YRK ++K+HPDK + D          EK+ +I++A+E L D 
Sbjct: 124 YDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEALTDE 183

Query: 59  NKREVYDKYG 68
             RE Y KYG
Sbjct: 184 TVRENYLKYG 193

>TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa]
           {ON} Anc_5.4 YGR285C
          Length = 430

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 9/72 (12%)

Query: 3   KETKLYDLLGVSP---NCNDAELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S      ND ++ K +RK  LKYHPDK + +         FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRYRANDTQVIKAHRKQVLKYHPDKTSAEGGSLDQDGIFKIIQKAFE 153

Query: 54  ILNDPNKREVYD 65
            L D  KR  YD
Sbjct: 154 TLTDSTKRAQYD 165

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 2  VKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDPN 59
          + +T  Y +LG++P  +  ++KK Y+K A + HPDK   +  +E FK + +A+ IL+D  
Sbjct: 3  IDKTTHYSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSELFKIVVDAYSILSDVK 62

Query: 60 KREVYD 65
          +RE Y+
Sbjct: 63 EREEYN 68

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILNDPN 59
           Y +LGV       +++K Y     KYHPDK           + EK  EI+EA+EIL+D  
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 567 KRKEYD 572

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 11/72 (15%)

Query: 7   LYDLLGVSPNCNDA----ELKKGYRKAALKYHPDKPTGDTE-------KFKEISEAFEIL 55
           LYD+LG+     D     E+K+ Y+K  L+YHPDK     E       +F  +  AF+IL
Sbjct: 83  LYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQIL 142

Query: 56  NDPNKREVYDKY 67
            D + R  YD++
Sbjct: 143 CDSSLRTQYDQW 154

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILNDPNKREVYD 65
          Y +LGV  N +  E++K Y K A K HPDK   +   E FK + +A  ILN+   R  YD
Sbjct: 14 YSILGVPTNASTNEIRKSYMKLAKKLHPDKTKSEHTAELFKLVVDAHSILNNDQLRAEYD 73

Query: 66 K 66
          K
Sbjct: 74 K 74

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKP--------TGDTEKFKEISEAFEILNDPN 59
           Y  LGVS N N+ ++++ Y +   KYHPDK             EK   I+EA+E L D +
Sbjct: 506 YKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQEERLKVDEKMSAINEAYETLRDDS 565

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 566 KRKEYD 571

>Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig
          244] FULL
          Length = 284

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 6/63 (9%)

Query: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT----EKFKEISEAFEILNDPNKREV 63
          Y+ L V  + ++A+L+K YRK  L YHPDK    T    EKF +I  AFEIL     R++
Sbjct: 14 YEELQVETSVSEAQLRKSYRKRMLLYHPDKTKDWTPEAKEKFHKIQFAFEILT--KFRDI 71

Query: 64 YDK 66
          +D+
Sbjct: 72 FDR 74

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 4  ETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDPNKR 61
          +T  Y +LG+  +  DA+++K Y K A + HPDK   +   E FK ++ A  IL D  KR
Sbjct: 10 QTTYYSVLGLPFDATDAQIRKSYMKLARELHPDKSKSEVAAELFKVVAHAHSILTDREKR 69

Query: 62 EVYDK 66
            YD+
Sbjct: 70 LKYDR 74

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON}
          Anc_2.218
          Length = 494

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (62%), Gaps = 3/72 (4%)

Query: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILND 57
          MV++TKLY+ L V       ++KK Y+K ALKYHPDK     +   KF+ + +A+EILND
Sbjct: 1  MVRDTKLYETLNVPITATTLDIKKAYKKLALKYHPDKNNHSEDSKTKFQAVCQAYEILND 60

Query: 58 PNKREVYDKYGL 69
             R +YD  G+
Sbjct: 61 KQSRAIYDALGI 72

>ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR061C
          Length = 305

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 10/71 (14%)

Query: 8   YDLLGVSPNCNDA-ELKKGYRKAALKYHPDKP------TGDTEK---FKEISEAFEILND 57
           Y++LG+     DA +LKK Y + A  YHPD         G+ E+   FK ++EA+ +L+D
Sbjct: 93  YEVLGLVKTGVDARQLKKRYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLSD 152

Query: 58  PNKREVYDKYG 68
            ++R +YD Y 
Sbjct: 153 ASRRRMYDMYA 163

>Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa]
          {ON} YJL162C (REAL)
          Length = 560

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 5  TKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILNDPNKRE 62
          T  Y +LG++ N   +E+ K Y K A   HPDK   D   E FK +  A  IL D N++ 
Sbjct: 12 TTYYSILGLASNATSSEVHKSYLKLARLLHPDKTKSDKCEELFKAVVHAHSILTDENQKL 71

Query: 63 VYDK 66
           YD+
Sbjct: 72 RYDR 75

>Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..5743)
           [1299 nt, 433 aa]
          Length = 432

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 3   KETKLYDLLGVSP---NCNDAELKKGYRKAALKYHPDK--PTGDTEK---FKEISEAFEI 54
           K   LY  +G+S      +DA++ K +RK  LK+HPDK   +G   +   FK I +AFE 
Sbjct: 94  KSADLYAAMGLSKLRFKASDAQIIKAHRKQVLKHHPDKISASGGLNQDGFFKIIQKAFET 153

Query: 55  LNDPNKREVYDKYGLE 70
           L D  KR  YD    E
Sbjct: 154 LTDSTKRSQYDSCDFE 169

>Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR285C
           (ZUO1) - Zuotin, putative Z-DNA binding protein [contig
           73] FULL
          Length = 428

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 3   KETKLYDLLGVSP---NCNDAELKKGYRKAALKYHPDK--PTGDTEK---FKEISEAFEI 54
           K   LY  +G+S       +A++ K +RK  LK+HPDK   +G  E+   FK I +A+E 
Sbjct: 93  KTADLYAAMGLSKLRYRATEAQIIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYET 152

Query: 55  LNDPNKREVYD 65
           L D NKR  YD
Sbjct: 153 LTDSNKRAQYD 163

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,880,222
Number of extensions: 1365124
Number of successful extensions: 3633
Number of sequences better than 10.0: 371
Number of HSP's gapped: 3349
Number of HSP's successfully gapped: 467
Length of query: 347
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 237
Effective length of database: 40,868,139
Effective search space: 9685748943
Effective search space used: 9685748943
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)