Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12423.487ON31131116710.0
AFR305W3.487ON3093127641e-100
KLLA0E04687g3.487ON3063176616e-85
CAGL0I10582g3.487ON3193296002e-75
NDAI0G009703.487ON3323395647e-70
NCAS0E008403.487ON3363195648e-70
SAKL0F02882g3.487ON2983135564e-69
KAFR0C019303.487ON3133225574e-69
YGR127W3.487ON3123225313e-65
Smik_6.2233.487ON3133235288e-65
Skud_7.4383.487ON3133235281e-64
Kwal_55.212173.487ON3033115261e-64
Kpol_1017.93.487ON3103185252e-64
KNAG0B008403.487ON3133255141e-62
KLTH0F14718g3.487ON3003145095e-62
TPHA0D032603.487ON3143225105e-62
Suva_7.4153.487ON3133235052e-61
TDEL0D055503.487ON3103165052e-61
TBLA0D029903.487ON3183124392e-51
ZYRO0D10098g3.487ON2762563752e-42
YOR238W8.660ON30381702.4
TPHA0J026205.443ON122556684.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1242
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   648   0.0  
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   298   e-100
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   259   6e-85
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   235   2e-75
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   221   7e-70
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   221   8e-70
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   218   4e-69
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   219   4e-69
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   209   3e-65
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   207   8e-65
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   207   1e-64
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   207   1e-64
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   206   2e-64
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   202   1e-62
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   200   5e-62
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   201   5e-62
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   199   2e-61
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   199   2e-61
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   173   2e-51
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   149   2e-42
YOR238W Chr15 (783677..784588) [912 bp, 303 aa] {ON} Putative pr...    32   2.4  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    31   4.9  

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
           SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDEG 180
           KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDEG
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDEG 180

Query: 181 PRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKTIF 240
           PRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKTIF
Sbjct: 181 PRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKTIF 240

Query: 241 VPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNHVTMHEHVIHDSDKDIGLSSAMNP 300
           VPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNHVTMHEHVIHDSDKDIGLSSAMNP
Sbjct: 241 VPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNHVTMHEHVIHDSDKDIGLSSAMNP 300

Query: 301 KTKVAYEFDIQ 311
           KTKVAYEFDIQ
Sbjct: 301 KTKVAYEFDIQ 311

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  298 bits (764), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 204/312 (65%), Gaps = 6/312 (1%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL ATT HP YKL+LISNRDE++ R+TH TCW  +  ILAPYD++  +  +D      
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQD--ADGLDHGS 58

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
             GTW+GINR GHVSVLLNL       + G  +R SRG VT+ +L+D  + NWD WN YE
Sbjct: 59  PCGTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYE 118

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDEG 180
           KF  HF  L  T+ FT FYGD+    F +I+S  ++++PF S+ PY V+SN   +     
Sbjct: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGPSDGAKAL 177

Query: 181 PRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKTIF 240
            +W KVVEG QL K++++ +L+VS+E LLQ+CF LA  SQ+  N  I V D S+P++TIF
Sbjct: 178 GQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIF 237

Query: 241 VPTL-KAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNHVTMHEHVIHDSDKDIGLSSAMN 299
           VP L   +G +++  +   G YYGTR+TIV+LV    +V   EHVIHDSD+D+   S +N
Sbjct: 238 VPALYNLSGQANLSFA--AGMYYGTRSTIVMLVSEDGNVVTREHVIHDSDQDLDSYSILN 295

Query: 300 PKTKVAYEFDIQ 311
           PK +V + F +Q
Sbjct: 296 PKEQVTHRFSLQ 307

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  259 bits (661), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 142/317 (44%), Positives = 191/317 (60%), Gaps = 18/317 (5%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL AT  HPDYKLIL+SNRDEF+ER+TH TCW+ DG IL+PYD++         K   
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-------IEKKGQ 53

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGA---GNRKSRGNVTVAFLRDLSNGNWDKWN 117
            YGTWLGINR G ++V+LNLK  S   +      G  +SRG V + FL+   N  +D W+
Sbjct: 54  GYGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWD 113

Query: 118 NYEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCE 177
           ++EKF+     L  T  FTLFYGD K+ ++ +ID  K S NPF  K  ++VISN   +C 
Sbjct: 114 SWEKFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPF-EKMEHMVISNDIFHCA 172

Query: 178 --DEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLP 235
             +   RW K   G  LL  L K    ++KE LLQKCFEL     F+    +    TS  
Sbjct: 173 VGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDVDSVTTS-- 230

Query: 236 EKTIFVPTLK-AAGNSSMGVSKIVGEYYGTRTTIVILVDNFNHVTMHEHVIHDSDKDIGL 294
             +I+VP L+   G  ++G S  +G+YYGTR+ IVILVD  N VT  EHVI++SD+D   
Sbjct: 231 --SIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCET 288

Query: 295 SSAMNPKTKVAYEFDIQ 311
            S M+PK  + ++F+++
Sbjct: 289 YSFMDPKEVIQFQFNME 305

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  235 bits (600), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 194/329 (58%), Gaps = 28/329 (8%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL AT +HPDY+LI+ISNRDEF ER+TH TCWH D  IL+PYD++       A ++  
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLAR----IGAGQSND 56

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
           ++GTW G+NR G V+ +LNL+   E         +SRG +   FL D   GN++ W+ Y 
Sbjct: 57  TFGTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLND-RQGNFEDWDTYA 115

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK-QPYVVISNS-----RV 174
           KF + +  +  T  F LFYGD K G + LIDS   +   FS   + Y+VISN+      +
Sbjct: 116 KFCKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHL 175

Query: 175 NCED--EGP-RWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTS--------QFDV 223
             +D   GP  W K+ +G+Q+++E VK N N+ KE +++ CF+LA T+        +FD+
Sbjct: 176 QSQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDL 235

Query: 224 NGVIQVTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHE 282
              + VT     ++TI+V  L    +  +G     G+YYGTR+ IV+LVD +    T  E
Sbjct: 236 VKSLGVT-----KETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIE 290

Query: 283 HVIHDSDKDIGLSSAMNPKTKVAYEFDIQ 311
            +I+ SD+DI L S  NPK ++ YE+DI+
Sbjct: 291 RIIYSSDQDISLYSTSNPKEELRYEYDIE 319

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  221 bits (564), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 189/339 (55%), Gaps = 38/339 (11%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCILLATT HPDY+LILISNRDEF +R+TH +CWH D  IL+PYD++     +D      
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKK---- 56

Query: 61  SYGTWLGINRVGHVSVLLNLK-----EVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDK 115
            +GTWLGIN+ G ++ +LNLK      + + V P     KSRG +   +L D++  ++ +
Sbjct: 57  VFGTWLGINKDGKIATVLNLKLNKSLSLKQLVAP-----KSRGMLPFVYLSDMTEDSFAE 111

Query: 116 WNNYEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVN 175
           W+ Y+ F++ +  L  T  F LFYGD+K   + ++DS   +++  +S   Y+V+SN    
Sbjct: 112 WDGYDNFTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFT 171

Query: 176 C-----------EDEGPR---------WKKVVEGEQLLKELVKGNL--NVSKEHLLQKCF 213
           C           + EG +         W KV  G  LL+ LV  ++     ++ ++ +CF
Sbjct: 172 CNGQLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECF 231

Query: 214 ELAGTSQFDVNGVIQV-TDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILV 272
           +L+ T    V    +   +++LP +TI VP L+      +G S  +GEYYGTR+ IVIL+
Sbjct: 232 KLSSTCSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILI 291

Query: 273 DNFNH-VTMHEHVIHDSDKDIGLSSAMNPKTKVAYEFDI 310
               + V   EHVI+ SD DI   S  NPK  V ++F +
Sbjct: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  221 bits (564), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 123/319 (38%), Positives = 185/319 (57%), Gaps = 17/319 (5%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCILLATT HP Y+LILISNRDEF+ER+THV+CWH D  IL+P+D++ S    +      
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKK---- 72

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
            +GTW+GINR   ++ +LNLK  S+         +SRG +   FL +  + +++KW+ YE
Sbjct: 73  IFGTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSE-HDSDFNKWDTYE 131

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNC---- 176
           KF   +  L  T  F  FYGD    ++ +IDS   +    S   PY+ +SN         
Sbjct: 132 KFDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG-DPYLTVSNDMFATGGIT 190

Query: 177 -----EDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVT- 230
                 +    W+K+  G+ LL++LV+ + ++ ++ L++KCF+LA T         +   
Sbjct: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQ 250

Query: 231 DTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSD 289
           +++LP +TIFVP L+   N  +G S  VG+YYGTR+ IVIL+  N   V + EH+++ SD
Sbjct: 251 NSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSD 310

Query: 290 KDIGLSSAMNPKTKVAYEF 308
            DI   S+ NPK   ++EF
Sbjct: 311 NDIQHYSSTNPKEVKSFEF 329

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  218 bits (556), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 183/313 (58%), Gaps = 18/313 (5%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCILL TT HP Y LILISNRDEF+ER TH TC H D  I++P+D+S +    +      
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN------ 54

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFL--RDLSNGNWDKWNN 118
            +GTW G+N+ G V+V+LNL+  S          +SRG V + FL  +D+   NWD   +
Sbjct: 55  -FGTWCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWD---S 110

Query: 119 YEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCED 178
           YEKFS H+  ++ T +F LFYGD   G++ LI S   + + F +   Y+V+SN  ++ + 
Sbjct: 111 YEKFSHHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKK 170

Query: 179 EGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKT 238
              +W K+   + LL+ LV+ +++ +K+ +L KCF+LA  S    +  I V   S+  +T
Sbjct: 171 ---KWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHST--CSEKIVVKHESVTNET 225

Query: 239 IFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSDKDIGLSSA 297
           I+VP L       + VS   G+YYGTR+ IVILV  +   +T  E V++  D+D+     
Sbjct: 226 IYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGP 285

Query: 298 MNPKTKVAYEFDI 310
            NPK ++ +EFDI
Sbjct: 286 KNPKEQIEFEFDI 298

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  219 bits (557), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/322 (38%), Positives = 183/322 (56%), Gaps = 22/322 (6%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL AT  H +Y+LILISNRDE+  R+TH TCWH D  IL+PYD+S  EN  +      
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNK----- 55

Query: 61  SYGTWLGINRVGHVSVLLNLKEVS-----EAVNPGAGNRKSRGNVTVAFL-RDLSNGN-W 113
            +GTWLG+N+ G ++ +LNL+  S     E V P     +SRG +   FL  D +N + +
Sbjct: 56  IFGTWLGMNKKGKIATILNLRRFSSIDLKELVKP-----RSRGLIPFTFLYSDWTNEDSF 110

Query: 114 DKWNNYEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSR 173
           ++W  +EKF   +  L  +  F  FYGDIK G++ +IDS   +     +    ++ISN  
Sbjct: 111 EEWETFEKFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDL 170

Query: 174 VNCEDE---GPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVT 230
              +DE    P W K+  G + L + +K     +++ +L KCFELA     D +   +  
Sbjct: 171 YQHKDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREEN 230

Query: 231 -DTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILV-DNFNHVTMHEHVIHDS 288
            +  L  +TI+VP LK   +  +G++K  G+YYGTRT IV+LV  +  HVT+ EH IH+S
Sbjct: 231 PNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNS 290

Query: 289 DKDIGLSSAMNPKTKVAYEFDI 310
           D++I   S +NPK     +F I
Sbjct: 291 DEEIYKYSGLNPKEVQRLDFTI 312

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  209 bits (531), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 180/322 (55%), Gaps = 22/322 (6%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL+AT  HPDY+LILISNRDEF  R+TH TCWH +  IL+PYD++ +      S  + 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKT------SAEKQ 54

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
            +GTW GIN+ G ++ +LNLK  +E  N  +   +SRG +   FL  +   +++ W+NY+
Sbjct: 55  IFGTWSGINKEGKLATILNLKLDNEQNNTKS---RSRGLLPFIFL-SIHKADFEDWDNYK 110

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK-----QPYVVISNSRV- 174
           KF  H+  L  T  F  FYGD+    + +IDS  R+ +  SS        Y+V+SN +  
Sbjct: 111 KFEGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFY 170

Query: 175 -NCEDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVN----GVIQV 229
            +    G  W+KV      L+ LV  N+   +E ++  CF+LA  S          V+Q+
Sbjct: 171 DSSSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQM 230

Query: 230 TDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDS 288
            D ++   TI+VP L+      +G S   G+YYGTR+ IV+LV  +   VT  E V++ S
Sbjct: 231 VDPNVTMNTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSS 290

Query: 289 DKDIGLSSAMNPKTKVAYEFDI 310
           D+D+   S  +PK +  ++F +
Sbjct: 291 DEDVRKYSVTSPKEEKRFKFKL 312

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  207 bits (528), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 176/323 (54%), Gaps = 23/323 (7%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL+AT  HPDY+LILISNRDEF  R+TH TCWH D  IL+PYD++ +      SK   
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLART------SKEGQ 54

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
            +GTW GIN+ G ++ +LNLK  SE         KSRG +   FL +    N+  W++Y 
Sbjct: 55  EFGTWSGINKEGKLATILNLKLGSER---STIKSKSRGLLPYIFLSN-HEANFKDWDSYS 110

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK-----QPYVVISNSRVN 175
           KF  H+  L  T  F  FYGD+    + +IDS  R+ +  SS        Y+VISN R  
Sbjct: 111 KFGNHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFY 170

Query: 176 CEDEGPR--WKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQF----DVNGVIQ- 228
                P   W+KV      L++LV  N+ + +E ++  CF+LA  S          V+Q 
Sbjct: 171 NTSSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQM 230

Query: 229 VTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHD 287
           + D ++   TI+VP L+      +G S   G++YGTR+ IV+L+  +    T  E +I+ 
Sbjct: 231 LVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYS 290

Query: 288 SDKDIGLSSAMNPKTKVAYEFDI 310
           SD+D+   S   PK +  +EF++
Sbjct: 291 SDEDVRQYSVSAPKEEKRFEFEL 313

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  207 bits (528), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 176/323 (54%), Gaps = 23/323 (7%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL+AT  HPDY+LILISNRDEF  R+TH TCWH D  IL+PYD++ +      SK + 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKT------SKEKQ 54

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
            +GTW GINR G ++ +LNLK   +         KSRG +   FL      ++  W+NY+
Sbjct: 55  IFGTWSGINREGKLATILNLKLDGQR---DTIKSKSRGLLPFTFL-STHKADFQNWDNYD 110

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK-----QPYVVISNSRV- 174
           KF  ++  L+ T  F  FYGD+    + LIDS  R+ N   S        Y+ +SN    
Sbjct: 111 KFEMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFY 170

Query: 175 -NCEDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQF-----DVNGVIQ 228
            +       WKKV      L++LV GN++  +E ++  CF+LA  S         N +  
Sbjct: 171 NSPSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQM 230

Query: 229 VTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHD 287
           + D ++   TI+VP L+   +  +G S   G+YYGTR+ IV+LV  N + VT  E +++ 
Sbjct: 231 LADPNVIMNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYS 290

Query: 288 SDKDIGLSSAMNPKTKVAYEFDI 310
           SD+D+   S   PK +  +EF +
Sbjct: 291 SDEDVNHYSVATPKEEKRFEFKL 313

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  207 bits (526), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/311 (38%), Positives = 178/311 (57%), Gaps = 18/311 (5%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCILLA++ HP Y LILISNRDEF ER+T  TC + D  +++P D++  +N       E 
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDN------NEP 54

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNR-KSRGNVTVAFLRDLSNGNWDKWNNY 119
           + GTW G NR G ++V+LNL+  +   N     R  SRGNVT+ +L D    +   WN+Y
Sbjct: 55  NLGTWCGANRNGRIAVILNLR--TGNTNQTKTKRIVSRGNVTMRYLTDKQPAS--DWNSY 110

Query: 120 EKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDE 179
            KF+     +   + F +FYGD K+GD+  IDS   S     S+ PY+VISN  +   + 
Sbjct: 111 AKFASKCPDIKSCE-FNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSI---ES 166

Query: 180 GPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKTI 239
             +W K+   E+L+++LV+ ++N S++ LL +CF LA   Q D N V  +    +    I
Sbjct: 167 ATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQ-DYN-VDHMDKEKVTSSNI 224

Query: 240 FVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNH-VTMHEHVIHDSDKDIGLSSAM 298
           FVP L+   +  +G S   G +YGTR+ IV+LV   +  +   EHV++DSD +     A 
Sbjct: 225 FVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAA 284

Query: 299 NPKTKVAYEFD 309
           NPK  V+Y+ +
Sbjct: 285 NPKKCVSYKIN 295

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  206 bits (525), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/318 (37%), Positives = 175/318 (55%), Gaps = 16/318 (5%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQD--GVILAPYDISNSENASDASKA 58
           MCILLA+ DHP+Y LILISNRDEF +RRTH TCW+Q     IL PYD+S S N  + +K 
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKS-NEKNVNKI 59

Query: 59  ELSYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNN 118
               GTW GIN  G VS +LNLK      +     +KSRG + + FL +    +   W++
Sbjct: 60  ----GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDS 115

Query: 119 YEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCED 178
           YEKF + +  + +T  F  FYGD++ G + +IDS   +    +   PY+VISN +    +
Sbjct: 116 YEKFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSN 175

Query: 179 --EGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPE 236
                 W+K+   + LLK L    L  +++ L+ KCF++A T+  + + +  V    L  
Sbjct: 176 GKSTKEWEKITLAKNLLKHLP---LCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMT 232

Query: 237 KTIFVPTLKAAG---NSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSDKDI 292
           +TI VP L          +G S  +G+YYGTR+ IVILV+ N   V   E ++++SD D+
Sbjct: 233 ETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDV 292

Query: 293 GLSSAMNPKTKVAYEFDI 310
                 +P   + Y F I
Sbjct: 293 TTQKLSSPIQDLTYNFTI 310

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  202 bits (514), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/325 (39%), Positives = 179/325 (55%), Gaps = 29/325 (8%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCILL T +HPDY L+LISNRDEF+ER TH+T WH    IL+PYD+  ++   D  K   
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDM--TKGLYDPGKC-- 56

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGN---RKSRGNVTVAFLRDLSNGNWDKWN 117
             GTW+G+NR G VS +LNLK   EA+   + N   R+SRG +   FL D   G  D+W+
Sbjct: 57  VRGTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSD--RGFIDQWD 114

Query: 118 NYEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFS----SKQPYVVISNSR 173
           ++EKF + +  L+ +  F LF GDI+  D+ ++DS   S N FS    +    +V+SN  
Sbjct: 115 SFEKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDS---SGNTFSVLNETTGMNMVVSNDT 171

Query: 174 VN--CEDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAG-----TSQFDVNGV 226
                E++   W KV  G+  L ELV   +N+ K   + KCF  A       S  D++  
Sbjct: 172 YKEFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKT 231

Query: 227 IQVTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVI 285
            +V        TIFVP LK      +G++K  G Y+GTR+ +V LV  +   VT+ E ++
Sbjct: 232 PEVI-----SNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERIL 286

Query: 286 HDSDKDIGLSSAMNPKTKVAYEFDI 310
           H SD D   +S  NPK    + FD+
Sbjct: 287 HTSDLDRDFNSPHNPKEVKQFTFDL 311

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  200 bits (509), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 115/314 (36%), Positives = 174/314 (55%), Gaps = 21/314 (6%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL+A+  HP Y LI ISNRDEF+ER+T  TC + D  IL+P D +   N   A     
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPA----- 55

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
             GTW G+NR G V+V+LNL+    A      +  SRG+V + +L D   G    WN++E
Sbjct: 56  -LGTWCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMD--RGPSTDWNSFE 112

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDEG 180
           KF   +  + + + F +FYGD   G++  IDS   S    ++ +P +V+SN  +   D  
Sbjct: 113 KFVSKYPQITECE-FNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHI---DSS 168

Query: 181 PRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAG---TSQFDVNGVIQVTDTSLPEK 237
            RW KV + + LL+ELV+ + + S+E L++KCF LA     ++ D +   + T +S    
Sbjct: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSS---- 224

Query: 238 TIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNH-VTMHEHVIHDSDKDIGLSS 296
            IF+P ++      +G S   G +YGTR+ IVILV      ++  E V+HDSD ++ L S
Sbjct: 225 -IFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHS 283

Query: 297 AMNPKTKVAYEFDI 310
             +PK K+ +   +
Sbjct: 284 EKHPKEKLQFNLHV 297

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  201 bits (510), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 183/322 (56%), Gaps = 21/322 (6%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQ--DGVILAPYDISNSENASDASKA 58
           MCIL  T  HPDY+LILISNRDEF +R+T  +CW++  +  +L PYD+S   N +D SK 
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLS--RNETDPSK- 57

Query: 59  ELSYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNN 118
              +GTW GIN  G VS +LNLK     V      +KSRG + V FL +    +++ WN+
Sbjct: 58  ---FGTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNS 114

Query: 119 YEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK----QPYVVISNSRV 174
           Y KF + +  L+ T SF LF GD+K  ++ LIDS+ ++      K    +  VVISNS  
Sbjct: 115 YSKFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEF 174

Query: 175 NCEDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTD--T 232
              D+  RW K+  GE+L+ E +  ++   +  +++ CF++A TS+   N  +   D   
Sbjct: 175 ISNDK-ERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSEL-TNEYLHSHDDIL 231

Query: 233 SLPEKTIFVPTLK---AAGNSSMGVSKIVGEYYGTRTTIVILVDN-FNHVTMHEHVIHDS 288
            L  +T+FVP +K        ++G S  VG++YGTR+ IVILV+     V   E V+++ 
Sbjct: 232 DLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYEC 291

Query: 289 DKDIGLSSAMNPKTKVAYEFDI 310
           D D+  +    P  ++ +E++I
Sbjct: 292 DDDVSKAGIEKPINELNFEYNI 313

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  199 bits (505), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/323 (36%), Positives = 174/323 (53%), Gaps = 23/323 (7%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL+AT  HP Y+LILISNRDEF ER+TH TCWH D  IL+PYD++ +      S  + 
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKT------SMEKQ 54

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
            +GTW GIN+ G ++ +LNLK   +         KSRG +   FL       +  W++Y 
Sbjct: 55  IFGTWSGINKEGKLATILNLKMDDQR---SCTKSKSRGMLPFTFLTS-HKARFQDWDDYN 110

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSS---KQP--YVVISNSRVN 175
           KF +H+  L  T  F  FYGD+    + +IDS   + +   S   + P  Y+VISN + +
Sbjct: 111 KFEKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYH 170

Query: 176 CED--EGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNG-----VIQ 228
                    W+KV      L+ L+  N+   +E L+  CF+LA  S     G     +  
Sbjct: 171 NSSSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQM 230

Query: 229 VTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHD 287
           + D ++   TI+VP L+      +G S   G+YYGTR+ IV+LV  + + VT  E V++ 
Sbjct: 231 LVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYS 290

Query: 288 SDKDIGLSSAMNPKTKVAYEFDI 310
           SD+D+   SA  PK +  +EF++
Sbjct: 291 SDEDVSHYSASAPKEEKRFEFEL 313

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  199 bits (505), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 172/316 (54%), Gaps = 14/316 (4%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60
           MCIL+AT+DHP Y L+L+SNRDE++ R+     W +D  +L P D        D+S  +L
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLD-----KGLDSSGEDL 55

Query: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120
             GTW+G NR G +  +LNLK  S+     A   +SRG + V+FL      N+  W+ Y+
Sbjct: 56  --GTWIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSS-RGANFKDWDTYD 112

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFS-SKQPYVVISNSRVNCEDE 179
           KF   F  L+ T+ F  FYGD   GD+ +IDS   +      + + Y+V+SN     E  
Sbjct: 113 KFCHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESN 172

Query: 180 GPR-WKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDV---NGVIQVTDTSLP 235
             R W K+   +Q L  LV+   +  ++  +Q+CF +A  + F     +G   +    L 
Sbjct: 173 KNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELS 232

Query: 236 EKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSDKDIGL 294
            +T+FVP LK + +  +G S  +GEYYGTR+  VILV  + +H+T  E +IHDSD D   
Sbjct: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292

Query: 295 SSAMNPKTKVAYEFDI 310
            S  + K +  Y+FD+
Sbjct: 293 YSRDHYKEQKRYDFDL 308

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  173 bits (439), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 169/312 (54%), Gaps = 24/312 (7%)

Query: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISN--SENASDASKA 58
           MCILL TT HP YKLILISNRDE +ER TH TCW+ +  IL PYD+S     +     + 
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 59  ELSYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNR--KSRGNVTVAFLRDLSNGNWDKW 116
           +  +GTW G+N+ G +  +LNL +  EA   G  N   +SRG + + +L D  +G  D W
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQD-W 119

Query: 117 NNYEKFSEHFAALDDTQS-FTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVN 175
           N Y+KF E   ++D     F LF GD+K+ ++ +I+S  +S      + PY+V+SN    
Sbjct: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINWG 179

Query: 176 CEDEGPRWKKVVEGEQLLKELVKGNLNVSKE---HLLQKCFELAGT---SQFDVNGVIQV 229
              +   W K+  G +LL+ L+   L+ S +    +L+ CF+++ T   S   ++G I+ 
Sbjct: 180 DPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIER 239

Query: 230 TDTSLPEKTIFVPTLKAAGNSSMGVSKIVG---------EYYGTRTTIVILVD-NFNHVT 279
            + +  +  IFVP LK +     G +             +YYGTR+ IV+L +   N VT
Sbjct: 240 LEQT--KDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNKVT 297

Query: 280 MHEHVIHDSDKD 291
             E ++H  ++D
Sbjct: 298 FVERILHCKNED 309

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  149 bits (375), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 146/256 (57%), Gaps = 10/256 (3%)

Query: 62  YGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYEK 121
           +GTW GIN+ G V  +LNLK    A      +  SRG V  AFL    + +W++WN+Y K
Sbjct: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQ-HDLDWEQWNSYNK 81

Query: 122 FSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQ-----PYVVISNSRVNC 176
           F+  F+ LD+T  F  FYGD K G + +IDS +++ +  ++ +      Y+V+SN     
Sbjct: 82  FANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRY 141

Query: 177 EDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQ-FDVNGVIQVTDTSLP 235
           + E   W KV   ++ L++L++ N+N  ++  + KCF++A TS   D      +  + + 
Sbjct: 142 QGE-ETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSSDVT 200

Query: 236 EKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSDKDIGL 294
           +++IFVP LK   + ++G +   G +YGTR+ IV+LV  +   VT  E V+H+SD+ +  
Sbjct: 201 KQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQVSQ 259

Query: 295 SSAMNPKTKVAYEFDI 310
            S  +P  ++ ++FD+
Sbjct: 260 RSPDHPAEQLKFQFDL 275

>YOR238W Chr15 (783677..784588) [912 bp, 303 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 303

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCEDEG 180
           K+ +    ++D  + +LF  D       L+ + KRS NPF+   PY       + C++ G
Sbjct: 221 KYYDDLVQMEDKNALSLFSSDWYATKDRLL-TKKRSRNPFNRTAPYA----QNIFCKENG 275

Query: 181 PRWKKVVEGEQLLKELVKGNL 201
            R + + + E+  +  +K  +
Sbjct: 276 KRIEGIEDDEEYFETKIKCKM 296

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 6/56 (10%)

Query: 103  AFLRDLSNGNWDKWNNYEKFSEHFAALDDTQSFTLFYGDIKTGDF-GLIDSYKRSM 157
             ++RD  NG W K+N+++    H     + + F    GDI T  F   +DS K+S+
Sbjct: 1163 VYIRDFENGIWRKYNDHQVTGAH-----EDEIFKCVDGDISTPYFLAYVDSSKKSI 1213

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,162,245
Number of extensions: 1462554
Number of successful extensions: 4104
Number of sequences better than 10.0: 29
Number of HSP's gapped: 4134
Number of HSP's successfully gapped: 29
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)