Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12413.488ON30530516320.0
AFR306C3.488ON31930511141e-153
SAKL0F02860g3.488ON3053076312e-80
Kwal_55.212193.488ON3022826121e-77
KLTH0F14740g3.488ON3022985963e-75
TPHA0D042203.488ON3163085687e-71
TBLA0C044503.488ON3092885564e-69
NCAS0F035303.488ON3133175435e-67
ZYRO0D10076g3.488ON3052845346e-66
Smik_16.4003.488ON3043105278e-65
Skud_16.4423.488ON3043115279e-65
YPR147C3.488ON3043115224e-64
TDEL0D055603.488ON3112895112e-62
Suva_16.4763.488ON3043105095e-62
Kpol_480.173.488ON3132935061e-61
CAGL0L08514g3.488ON3122884895e-59
NDAI0B058303.488ON3293094392e-51
KLTH0E12188g8.524ON336153900.008
TDEL0B032508.524ON348139830.062
TBLA0H035408.524ON378135800.17
CAGL0I06358g1.127ON198163760.63
NDAI0G037003.3ON25197730.89
Ecym_26888.811ON1431226740.93
SAKL0F06402g3.442ON72155740.94
Kwal_27.119758.524ON336115730.98
TBLA0A104705.267ON199957712.5
NCAS0A093601.290ON121963703.1
Smik_4.7951.37ON48372693.5
NDAI0B021108.94ON84669694.1
TPHA0F008204.114ON79472694.4
NCAS0H003707.499ON42556684.7
KAFR0F033904.114ON80750685.0
TPHA0D010408.136ON797112685.7
KLTH0H10626g1.322ON40286675.8
TPHA0L016008.524ON372180659.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1241
         (305 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   633   0.0  
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   433   e-153
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   247   2e-80
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   240   1e-77
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   234   3e-75
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   223   7e-71
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   218   4e-69
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   213   5e-67
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   210   6e-66
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   207   8e-65
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   207   9e-65
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   205   4e-64
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   201   2e-62
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   200   5e-62
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   199   1e-61
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   192   5e-59
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   173   2e-51
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    39   0.008
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    37   0.062
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    35   0.17 
CAGL0I06358g Chr9 complement(608945..614890) [5946 bp, 1981 aa] ...    34   0.63 
NDAI0G03700 Chr7 complement(892922..893677) [756 bp, 251 aa] {ON...    33   0.89 
Ecym_2688 Chr2 complement(1329887..1334182) [4296 bp, 1431 aa] {...    33   0.93 
SAKL0F06402g Chr6 (487543..489708) [2166 bp, 721 aa] {ON} simila...    33   0.94 
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    33   0.98 
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    32   2.5  
NCAS0A09360 Chr1 (1853291..1856950) [3660 bp, 1219 aa] {ON} Anc_...    32   3.1  
Smik_4.795 Chr4 complement(1394372..1395823) [1452 bp, 483 aa] {...    31   3.5  
NDAI0B02110 Chr2 (525331..527871) [2541 bp, 846 aa] {ON} Anc_8.9...    31   4.1  
TPHA0F00820 Chr6 (185723..188107) [2385 bp, 794 aa] {ON} Anc_4.1...    31   4.4  
NCAS0H00370 Chr8 (66024..67301) [1278 bp, 425 aa] {ON} Anc_7.499...    31   4.7  
KAFR0F03390 Chr6 (671347..673770) [2424 bp, 807 aa] {ON} Anc_4.1...    31   5.0  
TPHA0D01040 Chr4 complement(210613..213006) [2394 bp, 797 aa] {O...    31   5.7  
KLTH0H10626g Chr8 complement(918216..919424) [1209 bp, 402 aa] {...    30   5.8  
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    30   9.1  

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/305 (100%), Positives = 305/305 (100%)

Query: 1   METYLREDIFADILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIG 60
           METYLREDIFADILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIG
Sbjct: 1   METYLREDIFADILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIG 60

Query: 61  HTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIAL 120
           HTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIAL
Sbjct: 61  HTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIAL 120

Query: 121 HKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSW 180
           HKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSW
Sbjct: 121 HKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSW 180

Query: 181 IEWIARKLIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQA 240
           IEWIARKLIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQA
Sbjct: 181 IEWIARKLIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQA 240

Query: 241 NKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKV 300
           NKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKV
Sbjct: 241 NKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKV 300

Query: 301 VNIYF 305
           VNIYF
Sbjct: 301 VNIYF 305

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  433 bits (1114), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 245/305 (80%), Gaps = 1/305 (0%)

Query: 1   METYLREDIFADILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIG 60
           +ET    DI AD+LHI+S+   P  +L+F+PGNPGLINFY EFL+ IHE+NPTWE+VGI 
Sbjct: 16  VETLCDPDIDADMLHIWSEWIQPECILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGIS 75

Query: 61  HTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIAL 120
           HTGMS+      L  RV+TL EQ+E KVK IN+FV+  G+  +KL+GHSIGAYM QK+ +
Sbjct: 76  HTGMSAKTGPEDLK-RVYTLVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVV 134

Query: 121 HKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSW 180
           H  LR  ++MV LLTPTIIDIHRS KGVQLTRIS+WFP+FYEY  +VDRVL +W+LP +W
Sbjct: 135 HPALRVNVEMVGLLTPTIIDIHRSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATW 194

Query: 181 IEWIARKLIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQA 240
           I W+ARK+IGGSDECVLQSA+KLV  P +V+QALG+AQ+EM+QVRNQWDFQ+EFI  CQ 
Sbjct: 195 ISWLARKIIGGSDECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQE 254

Query: 241 NKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKV 300
            +  +  LFSGHDHWVH DTMKDI+E YEAKY ++   LL ITID HI+HSFVVKDTTKV
Sbjct: 255 RRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKV 314

Query: 301 VNIYF 305
           VNIYF
Sbjct: 315 VNIYF 319

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  247 bits (631), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 192/307 (62%), Gaps = 8/307 (2%)

Query: 1   METYLREDIFADILHIY---SQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57
           ++ Y +   F+ + H+     +     PL +FIPGNPGLI FY+ FL  I +++  WE++
Sbjct: 3   IQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEIL 62

Query: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117
           GI H GM +  +      +V++L +Q++ K+ VIN+F  +  +R + + GHSIGAY+VQK
Sbjct: 63  GISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSS--NRPLIIAGHSIGAYIVQK 120

Query: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177
           IAL   L G +  +MLLTPT+IDIH S KG +L  I++W P F+ Y      ++F+ +LP
Sbjct: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180

Query: 178 TSWIEWIARKLIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISF 237
            +  E I    +G    CV ++A+ LV+  EFV+Q+LGLA+ EM +VR+ W+FQ  F+ F
Sbjct: 181 QTITEKILSLFVGSEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQF 240

Query: 238 CQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDT 297
           C++ +++++FLF+  DHWV+  T  D+ E Y + Y    KD L I  D  I+HSFV+ DT
Sbjct: 241 CKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYY---KDFLTIDEDEKISHSFVLNDT 297

Query: 298 TKVVNIY 304
             VV+ Y
Sbjct: 298 KSVVDRY 304

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  240 bits (612), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 124/282 (43%), Positives = 173/282 (61%), Gaps = 8/282 (2%)

Query: 24  GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSGRVHTLDEQ 83
            PL +FIPGNPGLI FYE FL  IHE+NP WE++GI H GM+S  E  S    V++L++Q
Sbjct: 29  APLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVS---PVYSLEQQ 85

Query: 84  IEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIIDIHR 143
           I+ K+++IN +   G  + I ++GHS+GA+MVQKI   + L+ K+  V LLTPT+IDIH+
Sbjct: 86  IDHKIEIINRYCLDG--KPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHK 143

Query: 144 SSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGSDECVLQSAQKL 203
           S KGV+LT I+ W P F+     ++  LF+ +LPT   + I   L+     C+  + + L
Sbjct: 144 SEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVDDPQSCLGATTELL 203

Query: 204 VSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWVHPDTMKD 263
           V+   FVKQALGLA  E+  +R+ W +Q EF+  CQ N  K+ +LFS  DHWV P T  D
Sbjct: 204 VTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRND 263

Query: 264 IIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305
           II+ Y    S     L  I +   I H+FV +    V+  YF
Sbjct: 264 IIDFYRQHSS---PALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  234 bits (596), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 186/298 (62%), Gaps = 11/298 (3%)

Query: 11  ADILHIYSQSTPPGP---LLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSL 67
           + ILH+ S  +  G    L +FIPGNPGLI +Y  FL+ +HE+NP WE++GI H GM+S 
Sbjct: 13  SSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSC 72

Query: 68  RENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGK 127
              N ++  V+TL EQI  KV VIN +  A G++ I ++GHS+GA++ QK+     L  +
Sbjct: 73  ---NDIACPVYTLQEQINHKVDVINSY--AQGNKKITIMGHSVGAFIAQKVVTSGLLNDE 127

Query: 128 IDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARK 187
           +  V LLTPT+IDIH+S KG++LT I++ FP+F++    +D + F+ + P     WI   
Sbjct: 128 VARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISH 187

Query: 188 LIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRF 247
                  C+  + + L++   FVKQALGLA  EM  +R+ W++Q +F+ +C+    K+ +
Sbjct: 188 FADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWW 247

Query: 248 LFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305
           LFS +DHWV  +T KD+I+ YE ++SS E  L++I +   I H+FV +    VV  YF
Sbjct: 248 LFSDNDHWVSSETRKDLIQFYE-RHSSPE--LVSIDVSTAIEHAFVRRHAQVVVQHYF 302

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  223 bits (568), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 117/308 (37%), Positives = 186/308 (60%), Gaps = 17/308 (5%)

Query: 3   TYLREDIFADILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHT 62
           TY+ +++  D+    +++    PL ++IPGNPGL+ +YEEFLK +H +NP W+++GI H 
Sbjct: 21  TYVADELSVDL----TKTDKLSPLFVWIPGNPGLLEYYEEFLKLLHVKNPEWDILGISHA 76

Query: 63  GMSS----LRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKI 118
           GMSS    L+EN      V+TLDEQI  K+++IN+F   G  R + ++GHS+GA+M QK+
Sbjct: 77  GMSSGNSNLKENEC---SVYTLDEQIHHKIEIINKFAAYG--RELIVMGHSVGAFMAQKV 131

Query: 119 ALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPT 178
            +   L GK+  + LL PT+IDIH S KG Q++ I +W P   + A  V   +F   LP 
Sbjct: 132 VMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPI 191

Query: 179 SWIEWIARKLIGGSDEC-VLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISF 237
           + +++I    +  ++E     +    +    FV+Q+LGLA+ EM  +R+ W+FQ E +  
Sbjct: 192 TLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKM 251

Query: 238 CQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDT 297
           C  N+I++  LF+  DHWV   T  ++IELY    +S   D  + +I   + H+FV+K++
Sbjct: 252 CNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNS---DYYSYSITDQVPHAFVIKNS 308

Query: 298 TKVVNIYF 305
             VV+ YF
Sbjct: 309 CHVVDNYF 316

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  218 bits (556), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 171/288 (59%), Gaps = 8/288 (2%)

Query: 21  TPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRE-NNSLSGRVHT 79
           T   PL ++IPGNPGL+ +Y + L+ +H++ PTWE++G+ H GMS+  +  N LS +V+T
Sbjct: 27  TEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYT 86

Query: 80  LDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTII 139
           LDEQ+  KV+VIN F  +   R I ++GHS+GAYM Q++ +   L G +  + L+TPT++
Sbjct: 87  LDEQVSHKVEVINNF--SSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVV 144

Query: 140 DIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIG--GSDECVL 197
           DIHRS KG+++TR  + F +   +  ++  + F  + P  +  W+   ++G   +D    
Sbjct: 145 DIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKLFPAIFTRWLLTIIMGCKNNDNHAA 204

Query: 198 QSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWVH 257
            ++   ++   FVKQ LGLA  EM  +R+ W+FQ   I +C    +   FLFS  DHWV 
Sbjct: 205 DASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVS 264

Query: 258 PDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305
            DT  ++I  Y     S   D+L++++   I HSFV+  +   VN YF
Sbjct: 265 DDTRNELINFYRTNCKS---DILDVSVSNIIPHSFVINFSDFTVNSYF 309

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  213 bits (543), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 182/317 (57%), Gaps = 18/317 (5%)

Query: 1   METYLREDIFADILHIYSQSTPP-GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGI 59
           +E Y  ++    ++HI    T    P+ ++IPGNPG++ +Y+E L  +HE++PTWE++ I
Sbjct: 3   VEAYDDDEFPTCVVHILPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEILAI 62

Query: 60  GHTGMSS-----LRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYM 114
            H GM++      + ++  + RV TL EQI+ K+K+IN FV    +  I + GHS+GAYM
Sbjct: 63  SHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVK-DSNVPIYISGHSVGAYM 121

Query: 115 VQKIALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDW----FPKFYEY-AYVVDR 169
           VQKI     L G++  + L+TPTIIDIH S KG  +TR + W     P    +  Y+V  
Sbjct: 122 VQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIV-- 179

Query: 170 VLFKWILPTSWIEWIARKLIGGS-DECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQW 228
             F W++P     +I   ++G   D     S +  ++ P FV+Q+LGLAQ EM  + + W
Sbjct: 180 --FGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237

Query: 229 DFQDEFISFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHI 288
            FQ E I +C  N IK++FLFS  DHWV   T K+II+ Y+ +     K LL I +    
Sbjct: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQER-CKGAKALLKIDVSDQF 296

Query: 289 NHSFVVKDTTKVVNIYF 305
            HSFVV+ +  VV  YF
Sbjct: 297 PHSFVVRRSKYVVEHYF 313

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  210 bits (534), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 174/284 (61%), Gaps = 11/284 (3%)

Query: 26  LLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSGR---VHTLDE 82
           L ++IPGNPG++ +YEEFL  +HE+  ++E++ I H GM++  E+  L  R   ++TLD+
Sbjct: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMAT--EDPDLQKRKATIYTLDD 86

Query: 83  QIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIIDIH 142
           QI+ KV++IN+F  +  DR + ++GHS+GAYM Q + L + L G++  + L+TPT++DIH
Sbjct: 87  QIQHKVEIINQF--SAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIH 144

Query: 143 RSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGSDECV-LQSAQ 201
           RS KG QLTR   W     + A  V  +LF  +    + + +    +G   E V + +++
Sbjct: 145 RSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSK 204

Query: 202 KLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWVHPDTM 261
            LV  PE ++QALGLA +EM Q+R  W FQ + I  C +N+I+ +F+FS +D WV   T 
Sbjct: 205 SLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATR 264

Query: 262 KDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305
           + ++  Y   Y       L I++   + HSF+VK +  +V+ YF
Sbjct: 265 EALMVFYRENYRDRN---LEISVSQDLAHSFIVKHSKYIVDEYF 305

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  207 bits (527), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 182/310 (58%), Gaps = 13/310 (4%)

Query: 1   METYLREDIFADILHI---YSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57
           ++ Y +      IL+I    ++S     LL++IPGNPGL+ +Y+E L+ +H ++P WE++
Sbjct: 3   IQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWEIL 62

Query: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117
           GI H GM+    +N+    V++L +Q++ +V+VIN F  +  +R I ++GHS+GAY++QK
Sbjct: 63  GISHAGMTLNAHSNT---PVYSLQDQVDHQVEVINNF--SHENRKIIIMGHSVGAYILQK 117

Query: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177
           + L   L G +  V L+TPT++DIH S  GV+LT    + P       +   + F WIL 
Sbjct: 118 VCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILS 177

Query: 178 TSWIEWIARKLIG-GSDEC-VLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFI 235
             +  +I  K +G GS  C  + S +  ++  +FV+Q+LGLA  EM ++   W+FQD+FI
Sbjct: 178 EGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFI 237

Query: 236 SFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVK 295
           ++C+ N   + FLFS +DHWV   T   +   Y+ K    +++ L I +   I HSFVVK
Sbjct: 238 NYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKV---DQNRLEIDVTDKIPHSFVVK 294

Query: 296 DTTKVVNIYF 305
                +N +F
Sbjct: 295 HAKYAINTFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  207 bits (527), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 114/311 (36%), Positives = 185/311 (59%), Gaps = 15/311 (4%)

Query: 1   METYLREDIFADILHI---YSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57
           ++ Y +  +   IL+I    +      PLL++IPGNPGL+ +Y+E L+ +H ++P WE++
Sbjct: 3   VQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEIL 62

Query: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117
           G+ H GM+    +N+    + +L +Q++ +V+VIN F  +  +R I ++GHS+GAY++QK
Sbjct: 63  GVSHAGMTLNAHSNT---PIFSLQDQVDHQVEVINNF--SHENRKIIIMGHSVGAYILQK 117

Query: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177
           + L   L G +  + L+TPT++DIH S  GV++T +  + P       ++  V F WIL 
Sbjct: 118 VCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILS 177

Query: 178 TSWIEWIARKLIG-GSD--ECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEF 234
                ++  K +G GS   + VL S + L++  +FV+Q+LGLA  EM ++   W+FQDEF
Sbjct: 178 EGLSRFVIDKFMGCGSTGYQAVL-STRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEF 236

Query: 235 ISFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVV 294
           I++CQ N+I + FLFS  DHWV   T   +   Y+ K    +++ L I +   I HSFVV
Sbjct: 237 INYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKI---KQERLKIDVTDKIPHSFVV 293

Query: 295 KDTTKVVNIYF 305
           K     VN +F
Sbjct: 294 KHAEYAVNTFF 304

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  205 bits (522), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 114/311 (36%), Positives = 183/311 (58%), Gaps = 15/311 (4%)

Query: 1   METYLREDIFADILHIYSQSTPPG---PLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57
           ++ Y +  +   IL+I    T  G   PLL++IPGNPGL+ +Y+E L  +H ++P WE++
Sbjct: 3   VKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEIL 62

Query: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117
           GI H GM+    +N+    + +L +Q++ +V+VIN F  +  +R I ++GHS+GAY+VQK
Sbjct: 63  GISHAGMTLNAHSNT---PIFSLQDQVDHQVEVINNF--SCKNRKIIIMGHSVGAYIVQK 117

Query: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177
           + L   L G +  V L+TPT++DIH S  G+++T    + P       +   + F WIL 
Sbjct: 118 VCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILS 177

Query: 178 TSWIEWIARKLIG-GSD--ECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEF 234
             +  +I  K +G GS   + VL S +  ++  +FV+Q+LGLA  EM ++   W+FQD F
Sbjct: 178 EGFSRFIIDKFMGCGSTGYQAVL-STRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRF 236

Query: 235 ISFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVV 294
           I++C+ N I + FLFS +DHWV   T   + + Y+ K    +++ L I +   I HSFVV
Sbjct: 237 INYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKV---KQERLKIDVTDKIPHSFVV 293

Query: 295 KDTTKVVNIYF 305
           K     +N +F
Sbjct: 294 KHAEYAINAFF 304

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  201 bits (511), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 166/289 (57%), Gaps = 18/289 (6%)

Query: 25  PLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSL---RENNSLSGRVHTLD 81
           PL ++IPGNPGLI +YEEFL  IH ++P WEV+GI H GMS+    +   S    V++L 
Sbjct: 30  PLFVWIPGNPGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERNDVYSLK 89

Query: 82  EQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIIDI 141
           +QI+ K+++I +F  +  +R + ++GHS+GAYMVQ I L   L GK+  + LLTPTI+DI
Sbjct: 90  QQIDHKLEIIKDF--SSTNRPLIIMGHSVGAYMVQHIVLSDKLVGKVAKMGLLTPTILDI 147

Query: 142 HRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGSDECVLQSAQ 201
           H S KGV LT++  W     + A     +LF + LP+    +I R L+     C   S+ 
Sbjct: 148 HTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGFFLPS----FILRILLSFFMGCHRNSSG 203

Query: 202 KLVST-----PEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWV 256
            L +T      EFVKQALGL+  EM ++R+ W FQ   I  C    I    LFS  DHWV
Sbjct: 204 VLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCNERGISTWLLFSDSDHWV 263

Query: 257 HPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305
              T +D+I+ Y   Y +D+  +    I     HSFV+  +  +++ YF
Sbjct: 264 ADTTREDLIKFYRDHYRADKIKIHTCKIP----HSFVLNHSKYLISEYF 308

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  200 bits (509), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 178/310 (57%), Gaps = 13/310 (4%)

Query: 1   METYLREDIFADILHIYSQSTPP---GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57
           ++ Y +  +   IL+I    T      PLL++IPGNPGL+++Y+E +  +H ++P WE++
Sbjct: 3   IQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEIL 62

Query: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117
           GI H GMSS   +N+    + +L +Q++ +VKVIN F  +  +R I ++GHS+GAY+VQK
Sbjct: 63  GISHAGMSSNARSNT---PIFSLQDQVDHQVKVINNF--SHDNRKIIIMGHSVGAYIVQK 117

Query: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177
           + L   L G +  V L+TPT++DIH S  GV++T    + P        +  V F W+L 
Sbjct: 118 VCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLS 177

Query: 178 TSWIEWIARKLI--GGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFI 235
               + I  K +  G +    + S +  ++  +FV+Q+LGLA  E+ ++   W+FQD+FI
Sbjct: 178 EGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFI 237

Query: 236 SFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVK 295
           + C+   I   FLFS  DHWV+ +T K +   Y  K    +++ L I +   + HSFVVK
Sbjct: 238 NHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKV---KQEHLRIDVTDKMPHSFVVK 294

Query: 296 DTTKVVNIYF 305
                +N +F
Sbjct: 295 HAEYAINAFF 304

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  199 bits (506), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 175/293 (59%), Gaps = 13/293 (4%)

Query: 20  STPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMS------SLRENNSL 73
           S    PL ++IPGNPGL+ +Y +FL  +H++NPTWEV+GI H GMS        + +++ 
Sbjct: 27  SPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYDGNEKKKKTSSND 86

Query: 74  SGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVML 133
             +V  L+EQ++ KV +IN+F  +  +R + ++GHS+GAY+ Q++ +   L GK+  V  
Sbjct: 87  KFKVFDLEEQVQHKVDIINKF--SSKNRPLIIMGHSVGAYLTQRVIMTNKLNGKLIKVGY 144

Query: 134 LTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGS- 192
           LTPT++DIH S KG+++T++ +W      +   + + +F  +LP  ++++   K+I  S 
Sbjct: 145 LTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFVKFFISKMIKCSE 204

Query: 193 DECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGH 252
           D   + ++  L+     ++QALGLA  EM  + + W F  + I +C    +K  FLF+  
Sbjct: 205 DSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNETGVKTWFLFAED 264

Query: 253 DHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305
           DHWV   T K++I+ Y+     ++ + + I ID  I H+FV+K +  +V+ YF
Sbjct: 265 DHWVAHSTRKEVIDFYQY---HNKPENIRIDIDT-IPHAFVIKKSKYIVDQYF 313

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  192 bits (489), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 169/288 (58%), Gaps = 10/288 (3%)

Query: 24  GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGM----SSLRENNSLSGRVHT 79
            PL ++IPGNPGL+ +Y+EFL  +H++NPTWE++GI H G     S L++       ++ 
Sbjct: 29  SPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEILGISHAGTVIESSQLKKFRKNPLPIYD 88

Query: 80  LDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTII 139
           L +Q + K+ +IN+ ++   +R + ++GHS+GAY+ Q +     L G++  + L+TPTI 
Sbjct: 89  LKQQTQHKIDIINK-INNDPNRELVIMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIR 147

Query: 140 DIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGS-DEC-VL 197
           DIH+SS G+  TR+ ++     EY   +   +F  ++P  W + +    +G S DE  ++
Sbjct: 148 DIHKSSHGLIFTRVFNYISNVNEYLSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHII 207

Query: 198 QSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWVH 257
                L++  E ++Q LGLA  EM ++R+ W FQ+  ++ C+ N  K+  LFS +DHWV 
Sbjct: 208 LGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVS 267

Query: 258 PDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305
             T  ++I+  + +Y    + LL + +D  I HSFVVKD   V   YF
Sbjct: 268 QHTQAELIKFLKDRYP---ELLLRVDVDKDIKHSFVVKDVDLVTRRYF 312

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  173 bits (439), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 166/309 (53%), Gaps = 37/309 (11%)

Query: 24  GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGM-SSLRENNSLSGRVHTLDE 82
            PL ++IPGNPG++ +Y++FL  +H+++P WE++ I H GM +SL      + R++ L+E
Sbjct: 31  NPLFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGMDTSLPVYRHPNDRIYHLNE 90

Query: 83  QIEDKVKVINEFVDAGGD-------RCIKLIGHSIGAYMVQKIALHKGLRGKI------- 128
           QIE K++VI  F+            R + ++GHS+G YM+Q++ L K  +  I       
Sbjct: 91  QIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYL 150

Query: 129 DMVMLLTPTIIDIHRSSKGV------QLTRISDWFPKFYEY-AYVVDRVLFKWILPTSWI 181
             +  +TPTIIDI+ SSKG+      QLT    + P    Y +Y V  ++ K+       
Sbjct: 151 KKIGFITPTIIDINLSSKGILISHGLQLTH--GYLPYILSYLSYFVFSLILKYF------ 202

Query: 182 EWIARKLIGGSDECVLQ-----SAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFIS 236
           + I R+LI     C +        + L++    VKQ+LGLA IEM ++R  WD Q +F+ 
Sbjct: 203 DNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLASIEMQEIRKNWDVQKQFVE 262

Query: 237 FCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKD 296
            C  N I++  LF   DHWV+  T  D+I+ Y++ Y    +  L I +     HSFVV  
Sbjct: 263 NCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKDISR--LQIEVSSEFPHSFVVNH 320

Query: 297 TTKVVNIYF 305
           +  VV  +F
Sbjct: 321 SDWVVERFF 329

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 68/153 (44%), Gaps = 25/153 (16%)

Query: 24  GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSL---SGRVHTL 80
           GP+ LF  G  G +  +E  L+ + E N  +  + +   G+S  ++   +   +  +H  
Sbjct: 78  GPIYLFFHGLGGNLTQFEPLLRLLGELNEGFVAMDLPGFGLSEEQDGYQMLQVTQVIHDA 137

Query: 81  DEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLT---PT 137
             QI D  K+I             L+GHS+G ++V   A+  GL   I   + L+   PT
Sbjct: 138 FLQITDHKKII-------------LVGHSMGCHLVLHFAILFGLEFDIKDSVFLSPPAPT 184

Query: 138 IIDIHRSSKGVQLTRIS------DWFPKFYEYA 164
           +  + + S  + L+ +       DW+  +++ +
Sbjct: 185 LPQLQKVSTRLALSVLCRLPFLFDWYRSYFDQS 217

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 59/139 (42%), Gaps = 7/139 (5%)

Query: 15  HIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLS 74
           H   QS   G L LFI G  G +  +E  L+ + +RN ++    +   G S   +   + 
Sbjct: 69  HNLRQSKGGGELFLFIHGLGGTLEQFEPVLRELDQRNKSFLAFDLPGFGKSDEWDQYPML 128

Query: 75  GRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLL 134
             V ++D        +I++  +      + LIGHS+G Y+     L       I  ++LL
Sbjct: 129 DVVKSIDW-------LIHQLTNNLKFEKLNLIGHSMGCYLAVHFYLLFHESWCISRLVLL 181

Query: 135 TPTIIDIHRSSKGVQLTRI 153
            P   ++ + SK   L + 
Sbjct: 182 APPKPNVDQLSKSKYLIQF 200

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 58/135 (42%), Gaps = 12/135 (8%)

Query: 25  PLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSGR-----VHT 79
           P+ +F+PG  G ++ YE  L+ +   N  +  +G    G     E+ S  G       H 
Sbjct: 95  PIYVFLPGLGGSLDQYEPLLRLMDILNEKF--IGFDLPGFGGSEEDTSEGGYNMIKVCHI 152

Query: 80  LDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKI--ALHKGLRGKIDMVMLLTPT 137
           ++E ++    +I +         ++L+GHS+G Y+V     +       KI  ++L +P 
Sbjct: 153 INEALQ---SIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLILTSPP 209

Query: 138 IIDIHRSSKGVQLTR 152
              I    K  +L +
Sbjct: 210 KKKIEPLDKNNRLNQ 224

>CAGL0I06358g Chr9 complement(608945..614890) [5946 bp, 1981 aa] {ON}
            similar to uniprot|P39526 Saccharomyces cerevisiae
            YJL207c
          Length = 1981

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 26   LLLFIPGNPGLINFYEEFLKCIHERNPTW--EVVGIGHTGMSSLRENNSLSGRVHTLDEQ 83
            +L   P N  +I+++EE+L       P W  ++V I +T    L E+++++ R   LD+ 
Sbjct: 1214 ILNLFPSNEIVISYFEEYLLNTMSEIPNWLAKLVKIFNTSADRLFEDSNIAKRAQKLDKD 1273

Query: 84   IED 86
             E+
Sbjct: 1274 SEN 1276

>NDAI0G03700 Chr7 complement(892922..893677) [756 bp, 251 aa] {ON}
           Anc_3.3 YOL147C
          Length = 251

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 2/97 (2%)

Query: 152 RISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGSDECVLQSAQKLVSTPEFVK 211
           ++  W   F+ +A V   V+    + T+ I+         S++   Q A K V +P F K
Sbjct: 128 KVPRWANFFWLFALVSGIVMDLRKIQTTEIQLRNELFAKKSEQSTTQVAGKTVPSPSFDK 187

Query: 212 QALGLAQIEMYQV--RNQWDFQDEFISFCQANKIKVR 246
             L +   E Y    R  WD  D FI     N +K R
Sbjct: 188 TKLKIITKEKYAAVRRLVWDCADSFIVLNNLNYLKSR 224

>Ecym_2688 Chr2 complement(1329887..1334182) [4296 bp, 1431 aa] {ON}
            similar to Ashbya gossypii AER273C
          Length = 1431

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 90/226 (39%), Gaps = 40/226 (17%)

Query: 31   PGNPGLINFYEEFLKCIHERN-----------------PTWEVVGIGHTGMSSLRENNSL 73
            PG  GL  F  E LKC+  RN                 P  + + +      S+R  N L
Sbjct: 912  PGYDGLDAFKLEILKCLENRNWKIREMAARALPALIEEPYQQSLSLLDNRKCSVRHQNRL 971

Query: 74   SGRVHTLDEQIEDKVKVINEFVDAGGDRCIKL-----IGHSIGAYMVQKIALHKGLRGKI 128
             GR+  + + +  ++      VDA   R I L     I  S   Y+ +K   +   +  +
Sbjct: 972  HGRLLAVKQLVTLELSK----VDA---RPIPLKLSNFILRSYNYYIGKKNPCNVTAKAYV 1024

Query: 129  DMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVL-------FKWILPTSWI 181
            D+V ++    ID+  S K   +    ++F +  E  Y+VD  L        K IL     
Sbjct: 1025 DVVRIILENSIDVLESDKLNLVRHFGNYFAEANE-RYIVDGSLQLLLAEVVKVILQNEKR 1083

Query: 182  EWIARKLIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQ 227
            E I   ++ G      +     ++T E+++ ++ +A     +V+N+
Sbjct: 1084 EHITDIVLLGIYSPFFEVQ---LATLEYIQSSINIASASFAEVQNK 1126

>SAKL0F06402g Chr6 (487543..489708) [2166 bp, 721 aa] {ON} similar
          to uniprot|P53038 Saccharomyces cerevisiae YGR099W TEL2
          Essential DNA-binding protein specific to
          single-stranded yeast telomeric DNA repeats required
          for telomere length regulation and telomere position
          effect
          Length = 721

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 29 FIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHT------GMSSLRENNSLSGRV 77
          FIPG+ G +  +EE L  IHE   TW V  I +T       + +L+ N   SGRV
Sbjct: 15 FIPGH-GNLELFEEVLFHIHEFKKTWSVNSINYTMGKITANLEALKRNP--SGRV 66

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 22/115 (19%)

Query: 13  ILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNP---TWEVVGIGHTGMSSLRE 69
           I H  +     GP+ +FI G  G +  +E  L+ +   N    T ++ G GH+      E
Sbjct: 67  ICHNVAHQHGTGPVYVFIHGLGGTLTQFEPLLRVLDVLNEGFLTIDLPGFGHSD-----E 121

Query: 70  NNSLSGRVHTLDEQIEDKVKVINE-FVDAGGDRCIKLIGHSIGAYMVQKIALHKG 123
            +S S         + D  K+I E  V+   ++ + ++GHS+G +    IALH G
Sbjct: 122 LDSYS---------MLDIAKIIREVLVETTKNKKVIVVGHSMGCH----IALHFG 163

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 44   LKCIHERNPTWEVVGIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGD 100
            LK ++E N + E   +     S + EN  LSG V  L+  +EDK K++NE      D
Sbjct: 1734 LKQLYE-NVSTEASTLSDNMKSLINENTMLSGEVERLENLLEDKNKLLNEIKYENND 1789

>NCAS0A09360 Chr1 (1853291..1856950) [3660 bp, 1219 aa] {ON}
           Anc_1.290 YJL080C
          Length = 1219

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 29  FIPGNPGLINFY----EEFLKCIHERNPTWEVVGIGHTGMSSLREN-NSLSGRVHTLDEQ 83
           + PGN  ++ FY    E+F     E N   E V   +  +  LR   N ++ +V+TLD +
Sbjct: 511 YFPGNDSIVLFYSSPEEDFKPSAEEINAELEKV---NASLEPLRAKLNKMTNKVYTLDAK 567

Query: 84  IED 86
           I+D
Sbjct: 568 IQD 570

>Smik_4.795 Chr4 complement(1394372..1395823) [1452 bp, 483 aa] {ON}
           YDR514C (REAL)
          Length = 483

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 6/72 (8%)

Query: 35  GLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEF 94
            LINFY   +KC  E++ TWE   +GH+    +R    +   +  LD ++    K  +  
Sbjct: 282 SLINFY---MKCETEQDLTWERAFVGHSIAGDIRWLKKIGVHIPELDNEL---TKAADPV 335

Query: 95  VDAGGDRCIKLI 106
              G +R  K++
Sbjct: 336 ESKGDERHAKML 347

>NDAI0B02110 Chr2 (525331..527871) [2541 bp, 846 aa] {ON} Anc_8.94
           YFR002W
          Length = 846

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 28  LFIPGNPGLINFYEEFLKCIHERNPTWEVVGIG--HTGMSSLRENNSLSGRVHTLDEQIE 85
           +F+PG     +F  + L  +   +PTW   GIG  + G S L  N++L  R     E+ E
Sbjct: 162 IFVPGKSENNSFVNKPLSPLDRVSPTWGNSGIGILNGGDSRLNVNSNLITR-----EKFE 216

Query: 86  DKVKVINEF 94
              K+I++F
Sbjct: 217 TYAKIIHQF 225

>TPHA0F00820 Chr6 (185723..188107) [2385 bp, 794 aa] {ON} Anc_4.114
           YGL014W
          Length = 794

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 100 DRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQ-LTRISDWFP 158
           + CI+L+  S G Y++QK+     L  ++ ++ +  P  IDI  +  G + L ++ +   
Sbjct: 509 NHCIELMTDSFGNYLIQKLLERITLEQRLIIINISAPYFIDIALNPHGTRALQKLVECIK 568

Query: 159 KFYEYAYVVDRV 170
              E   +VD +
Sbjct: 569 TDEEAKIIVDSL 580

>NCAS0H00370 Chr8 (66024..67301) [1278 bp, 425 aa] {ON} Anc_7.499
           YJR105W
          Length = 425

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 225 RNQWDFQDEFISFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLL 280
           R    F DE  S      ++VRFL+    H++  D + DI  + E K ++++  L+
Sbjct: 37  RRVSRFFDEPSSIVMNKPLRVRFLYYSDKHFIPLDRLPDIQSILELKMATEQPKLV 92

>KAFR0F03390 Chr6 (671347..673770) [2424 bp, 807 aa] {ON} Anc_4.114
           YGL014W
          Length = 807

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%)

Query: 100 DRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQ 149
           D  I+L+  S G Y++QK+        +I++  + +P  +DI  +S G +
Sbjct: 521 DHTIELMTDSFGNYLIQKLIERVTTEQRIEIAKIASPEFVDIALNSHGTR 570

>TPHA0D01040 Chr4 complement(210613..213006) [2394 bp, 797 aa] {ON}
           Anc_8.136 YGL178W
          Length = 797

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 46/112 (41%), Gaps = 1/112 (0%)

Query: 81  DEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIID 140
           D+ I D  KV +   D   D  + LI    G Y+VQK+  +     K  ++  +   +  
Sbjct: 256 DKNINDSNKVRDLLFDQTRDHFLDLILDPFGNYLVQKLCYYLTTDQKTILIQAIYTNMYQ 315

Query: 141 IHRSSKGVQ-LTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGG 191
           I  +  G + L +I D   + Y+   ++D    +  + T  +  I   L G 
Sbjct: 316 ISINQYGTRSLQKIIDVAEEDYQIDMIIDGFSNREYISTDQVVKIINDLNGN 367

>KLTH0H10626g Chr8 complement(918216..919424) [1209 bp, 402 aa] {ON}
           similar to uniprot|P47040 Saccharomyces cerevisiae
           YJL059W YHC3 Homolog of human CLN3 vacuolar/lysosomal
           membrane protein
          Length = 402

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 6/86 (6%)

Query: 19  QSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSGRVH 78
            S  P  LL+F  G  G  ++   F+  IH+ NP+     +G   MS     +S  G + 
Sbjct: 322 HSVYPVMLLIFFEGLLGGASYVHTFMNIIHDVNPSEREFTLGAVSMS-----DSF-GTLL 375

Query: 79  TLDEQIEDKVKVINEFVDAGGDRCIK 104
                I  + K+ +  VD G D C+K
Sbjct: 376 AAFIGIALEPKLCSHQVDTGRDWCLK 401

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 62/180 (34%), Gaps = 30/180 (16%)

Query: 13  ILHIYSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRE--- 69
           I H   + +    + +FI G  G +  +   LK     N ++  V +   G S   +   
Sbjct: 78  ICHNLKEQSSIDEIYIFIHGLGGSLEQFLPLLKLTDLSNKSFIAVDLPGFGQSEFNDEYN 137

Query: 70  --NNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGK 127
             N S+S  +  L  Q+  +    N          I L GHS+G Y+            +
Sbjct: 138 IANYSMSSIIGFLKSQVFSRYLTTN--------TKIILTGHSMGCYLALHFYQQYKTEYQ 189

Query: 128 IDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARK 187
           I  ++LL P      R  K    TR              + R +F W    SWI    RK
Sbjct: 190 IQKIVLLAPPNPHETRLDKSNYSTRF-------------IIRTMFSW----SWIFDFYRK 232

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,154,856
Number of extensions: 1475683
Number of successful extensions: 4013
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4063
Number of HSP's successfully gapped: 42
Length of query: 305
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 196
Effective length of database: 40,982,805
Effective search space: 8032629780
Effective search space used: 8032629780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)