Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12393.490ON1931938321e-114
AFR308W3.490ON1921963164e-36
Kwal_55.212263.490ON1961932722e-29
SAKL0F02816g3.490ON1921942686e-29
KLTH0F14784g3.490ON1951942461e-25
TDEL0D055803.490ON1931922242e-22
KLLA0E04643g3.490ON2211762043e-19
Skud_7.4403.490ON2132132001e-18
ZYRO0D10032g3.490ON2092011861e-16
YGR129W (SYF2)3.490ON2151971843e-16
NCAS0E008203.490ON2021771772e-15
Suva_7.4173.490ON2122111607e-13
Smik_6.2253.490ON2132101581e-12
Kpol_480.153.490ON2071811562e-12
NDAI0G009503.490ON2131881553e-12
CAGL0I10538g3.490ON2001761237e-08
TBLA0C044703.490ON2221851202e-07
TPHA0D042403.490ON2091931123e-06
KNAG0B008203.490ON207153800.049
Suva_9.5singletonON47063701.3
ZYRO0G00704g1.352ON68144701.4
Ecym_27511.352ON67355682.5
KLTH0H13046g1.352ON67544655.7
KNAG0B055104.131ON44748655.7
NOTE: 1 genes in the same pillar as Ecym_1239 were not hit in these BLAST results
LIST: KAFR0C01950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1239
         (193 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...   325   e-114
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...   126   4e-36
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...   109   2e-29
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   107   6e-29
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    99   1e-25
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    91   2e-22
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    83   3e-19
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    82   1e-18
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    76   1e-16
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    75   3e-16
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    73   2e-15
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    66   7e-13
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    65   1e-12
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    65   2e-12
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    64   3e-12
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    52   7e-08
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    51   2e-07
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    48   3e-06
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    35   0.049
Suva_9.5 Chr9 complement(7435..8847) [1413 bp, 470 aa] {ON} YNR0...    32   1.3  
ZYRO0G00704g Chr7 complement(52966..55011) [2046 bp, 681 aa] {ON...    32   1.4  
Ecym_2751 Chr2 (1456935..1458956) [2022 bp, 673 aa] {ON} similar...    31   2.5  
KLTH0H13046g Chr8 (1115590..1117617) [2028 bp, 675 aa] {ON} high...    30   5.7  
KNAG0B05510 Chr2 (1074907..1076250) [1344 bp, 447 aa] {ON} Anc_4...    30   5.7  

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score =  325 bits (832), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 166/193 (86%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60
           MDIDDI           VDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60

Query: 61  NTERRKLLNYSLIDYEKWDEKEKQANFDGTYSGDIAYSTYKNEIKQXXXXXXXXXXXXXX 120
           NTERRKLLNYSLIDYEKWDEKEKQANFDGTYSGDIAYSTYKNEIKQ              
Sbjct: 61  NTERRKLLNYSLIDYEKWDEKEKQANFDGTYSGDIAYSTYKNEIKQLRKGGLTKGKITKG 120

Query: 121 XXSESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNRHF 180
             SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNRHF
Sbjct: 121 RISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNRHF 180

Query: 181 NEKLSRQFKELGP 193
           NEKLSRQFKELGP
Sbjct: 181 NEKLSRQFKELGP 193

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score =  126 bits (316), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 111/196 (56%), Gaps = 9/196 (4%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60
           M I+DI           VD SI+NRKE  SEE  ++   KP VYS+ +E A   E   T 
Sbjct: 1   MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDT- 59

Query: 61  NTERRKLLNYSLIDYEKWDEKEKQAN--FDGTYSGDIAYSTYKNEIKQXXXXXXXXXXXX 118
            +E+ KLLNY + DYEKWDEK+K+     DG   G++A STY++E+ Q            
Sbjct: 60  QSEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRAT 119

Query: 119 XXXXSESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRL--DGHKANTSELGNFVNEK 176
               S SGKV ++DE ELV KLA  +++T++ R    +K+   DG +A    L    N+K
Sbjct: 120 NGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGSL----NDK 175

Query: 177 NRHFNEKLSRQFKELG 192
           NRHFNEKL R+F++ G
Sbjct: 176 NRHFNEKLDREFRKRG 191

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score =  109 bits (272), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 106/193 (54%), Gaps = 7/193 (3%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60
           MD+              +D+S+KN+ E++ EE +     KP VYS+N EGA   E  +  
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAE--EEIAKD 58

Query: 61  NTERRKLLNYSLIDYEKWDEKEKQANF---DGTYSGDIAYSTYKNEIKQXXXXXXXXXXX 117
            TE  KLL YS+++YE+W +K K+ +     G    D+A STY  E++Q           
Sbjct: 59  VTEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNK 118

Query: 118 XXX-XXSESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEK 176
                 +  GK+ +ED+++LV  L +TL KT+ ER+ R +K++ G + N +  G ++NEK
Sbjct: 119 NTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKI-GRQMNNTTSGGYINEK 177

Query: 177 NRHFNEKLSRQFK 189
           N+ FN+KL RQ K
Sbjct: 178 NKQFNDKLERQTK 190

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  107 bits (268), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 106/194 (54%), Gaps = 8/194 (4%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60
           MD+ D+           VD+S+KNRKE   EE       KP+VYS+N++    ++ +  +
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKDQKEEDT 60

Query: 61  NTERRKLLNYSLIDYEKWDEKE--KQANFDGTYSGDIAYSTYKNEIKQXXXXXXXXXXXX 118
              R KLLNYS+ DYEKW  K   K  N DG+   D+A  TY  EI++            
Sbjct: 61  ---RGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKV 117

Query: 119 XXXX-SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKN 177
                +  G++ I D+K+ + +LA  L K+++ R++  KK+    K ++S  G F+N+KN
Sbjct: 118 TKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQ--AEKLDSSTTGGFINDKN 175

Query: 178 RHFNEKLSRQFKEL 191
           + FNEKLSRQFK+ 
Sbjct: 176 KQFNEKLSRQFKQF 189

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 99.4 bits (246), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/194 (33%), Positives = 106/194 (54%), Gaps = 9/194 (4%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60
           MD++             V +S+KN+++I+ EE     R+KP VYS+  E A  +E  +T 
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSE--TTE 58

Query: 61  NTERRKLLNYSLIDYEKWDEKEK---QANFDGTYSGDIAYSTYKNEIKQXXXXXXXXXXX 117
            ++  KLL YS+ D+E+W +KE+   Q + D     D+A  TY  E++Q           
Sbjct: 59  ESKEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEK 118

Query: 118 XXXXX-SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSEL-GNFVNE 175
                 ++ GK+ ++D+  LV  LA +L KT+ ER+ R +K++  H+   S+  G F+NE
Sbjct: 119 PKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKI--HRQMVSDTPGGFINE 176

Query: 176 KNRHFNEKLSRQFK 189
           KN+ FN+K+ RQ K
Sbjct: 177 KNKQFNDKIERQTK 190

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 90.9 bits (224), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 103/192 (53%), Gaps = 4/192 (2%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60
           MD++ I           VD++I+ RK    E   +    KP++YS+ D          +S
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 61  NTERRKLLNYSLIDYEKWDEKE--KQANFDGTYSGDIAYSTYKNEIKQXXXXXXXXXXXX 118
              R KL+NYS+ +YE+WD+K+  K+    G    ++A  +Y+ ++ +            
Sbjct: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSR-SKQNNGNRVVK 119

Query: 119 XXXXSESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNR 178
               +++ ++ ++D+++LVNKLA  L+KT+RERFL  KK ++   A  +  G ++NEKN+
Sbjct: 120 ISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATP-GGYINEKNK 178

Query: 179 HFNEKLSRQFKE 190
            FN KL RQ KE
Sbjct: 179 QFNLKLDRQMKE 190

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 83.2 bits (204), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 96/176 (54%), Gaps = 12/176 (6%)

Query: 18  VDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTSNTERRKLLNYSLIDYEK 77
           V++SI+N+K I++EE     R    VYS+ D+G        +   +  KL NYS+ +YEK
Sbjct: 54  VEVSIRNKKAIIAEEKKNSER---RVYSMADDGEDKARSNKSEPEDPIKLANYSIREYEK 110

Query: 78  WDEKEKQANFDGTYSGD---IAYSTYKNEIKQXXXXXXXXXXXXXXXXSESGKVAIEDEK 134
           W+ K + +  + +  GD   IA ++YK E+                  +E GKV +ED  
Sbjct: 111 WEAKTQNSRHNKSVMGDFQTIAKNSYKKEV---DALPKDISHPLKGGITEDGKVQVEDNP 167

Query: 135 ELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGN-FVNEKNRHFNEKLSRQFK 189
           ELV K+   L + S++R++  K++LD  K N   L + F+N+KN+ FN KL+ +FK
Sbjct: 168 ELVEKMVNDLNERSKKRYMVRKQKLD--KQNKINLDDGFINDKNKRFNAKLNSEFK 221

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 81.6 bits (200), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 108/213 (50%), Gaps = 25/213 (11%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVG-RSKPEVYSINDEGAAVNEVQST 59
           M++D +           V++SIKNRK +   E+ + G   KP+VYS+ D       V+  
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRK-LADREIQEAGLNRKPKVYSMEDVNDGAEPVEDA 59

Query: 60  SNTERRKLLNYSLIDYEKWDEKEKQ-ANFDGTYSGD-------IAY-STYKNEIKQXXXX 110
             +++ K  +Y++ +Y  W +K+ Q  N  G  SG+       ++Y  T +N + Q    
Sbjct: 60  ETSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNK 119

Query: 111 XXXXXXXXXXXXS-------------ESGKVAIEDEKELVNKLAQTLEKTSRERFLREKK 157
                       S             ++GK+ I D+ +LVNKLA TLE  S++R+   +K
Sbjct: 120 NENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRK 179

Query: 158 RLDGHKANTSELGNFVNEKNRHFNEKLSRQFKE 190
           +++  K  +S + +F+N+KN+ FNEKLSR+ K+
Sbjct: 180 QMENAKTPSS-VESFINDKNKQFNEKLSREPKD 211

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 76.3 bits (186), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 101/201 (50%), Gaps = 15/201 (7%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSE-EVLQVGRSKPEVYSINDEGAAVNEVQST 59
           MD+D              +IS++NRK + +E + L  GR KP VY +    A    + + 
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGR-KPRVYQLE---APEPSLPTQ 66

Query: 60  SNTERRKLLNYSLIDYEKWDEKEK-QAN-FDGTYSGDIAYSTYKNEIKQXXXXXXXXXX- 116
            +    +L+NY++  YE+W+ +++ Q N  D     D+A  TY  E+ +           
Sbjct: 67  DDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRY 126

Query: 117 ------XXXXXXSESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLD-GHKANTSEL 169
                        ++GK+ I+D+ +LV KLA+ ++KT+ ER+   ++ ++  +  N S  
Sbjct: 127 TNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSG 186

Query: 170 GNFVNEKNRHFNEKLSRQFKE 190
           G ++NEKN+ FNEKL RQ  +
Sbjct: 187 GGYINEKNKQFNEKLDRQMPQ 207

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 75.5 bits (184), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 27/197 (13%)

Query: 18  VDISIKNRKEIVSEEVLQV-GRSKPEVYSINDEGAAVNEVQSTSNTERRKLLNYSLIDYE 76
           VD+SIK+RK +   E+ +V    KP VYS+ D   A   V  T + E+ K  +Y++ +Y+
Sbjct: 18  VDVSIKSRK-LADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYD 76

Query: 77  KWDEKEKQANFDGTYSGDIAYS---------TYKNEIKQXXXXXXXXXXX---------- 117
            W+ +  Q     +  G I+Y          T +N   Q                     
Sbjct: 77  AWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPK 136

Query: 118 -----XXXXXSESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNF 172
                     +++GK+ I D+ +LVNKLA +L+  S++R+   K+++   K     + +F
Sbjct: 137 KGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYG-VESF 195

Query: 173 VNEKNRHFNEKLSRQFK 189
           +N+KN+ FNEKLSR+ K
Sbjct: 196 INDKNKQFNEKLSRESK 212

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 72.8 bits (177), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 95/177 (53%), Gaps = 10/177 (5%)

Query: 19  DISIKNRKEIVSEEVLQVGRS-KPEVYSINDEGAAVNEVQSTSNTER-RKLLNYSLIDYE 76
           D +I+NR  +V  E   +  S KP VY++ D+     E Q     ++  KL+NY+L  YE
Sbjct: 20  DATIENRL-LVDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKLMNYTLRQYE 78

Query: 77  KWDEKEKQANFDGTYSG--DIAYSTYKNEIKQ----XXXXXXXXXXXXXXXXSESGKVAI 130
           +W++K+K        S    +A  +Y   +                      S++GKV I
Sbjct: 79  EWEKKQKDKKIKDDSSDMKQLAMFSYDKGVSNLNRFRTDKTTTEREVQIQVNSKTGKVNI 138

Query: 131 EDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNRHFNEKLSRQ 187
           +DEK+LVN LA+ L KT+ +R++  KK+LD    ++S  G ++NE+N+HFNEKL R+
Sbjct: 139 QDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEG-YINERNKHFNEKLDRE 194

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 66.2 bits (160), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 101/211 (47%), Gaps = 28/211 (13%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVGRS-KPEVYSINDEGAAVNE-VQS 58
           MD++++           VD S+K RK +   E+ +   + KP VYS+ D  A+ +E V+ 
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRK-LADREIQEASSNRKPRVYSMED--ASDDELVRE 57

Query: 59  TSNTERRKLLNYSLIDYEKWDEKEKQANFDGTYSGDIAYS---------TYKNEIKQXXX 109
           T + ++ +  +Y++ +Y  W++K+KQ     T     +Y          T +N   Q   
Sbjct: 58  TKSDDKDRAFHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYG 117

Query: 110 XXXXXXXXXXXXXSE-------------SGKVAIEDEKELVNKLAQTLEKTSRERFLREK 156
                        S              +GK+ I D+ ELVNKLA TLE  S++R    K
Sbjct: 118 KHESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARK 177

Query: 157 KRLDGHKANTSELGNFVNEKNRHFNEKLSRQ 187
           ++++  K   S + +F+N+KN+ FNEKL R+
Sbjct: 178 RQMENVKT-PSGVESFINDKNKQFNEKLGRE 207

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 98/210 (46%), Gaps = 25/210 (11%)

Query: 1   MDIDDIXXXXXXXXXXXVDISIKNRKEIVSEEVLQVG-RSKPEVYSINDEGAAVNEVQST 59
           M++D +           V++SIKNRK +   E+ +     KP VY++ D       V  T
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRK-LADREIQEANVNRKPRVYNMEDINDVDESVGYT 59

Query: 60  SNTERRKLLNYSLIDYEKWDEKEKQANFDGTYSGDIAY--------------------ST 99
            ++++ +  +Y+  +Y  W+++  Q     +    I+Y                    S 
Sbjct: 60  ESSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSE 119

Query: 100 YKNEI--KQXXXXXXXXXXXXXXXXSESGKVAIEDEKELVNKLAQTLEKTSRERFLREKK 157
           Y N +  K                 +++GK+ I D+ +LVNKLA +LE  S++R+   K+
Sbjct: 120 YDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKR 179

Query: 158 RLDGHKANTSELGNFVNEKNRHFNEKLSRQ 187
           +++      S + +F+N+KN+ FNEKLSR+
Sbjct: 180 QMES-AVIPSGVESFINDKNKQFNEKLSRE 208

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 99/181 (54%), Gaps = 13/181 (7%)

Query: 18  VDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTSNTERRKLLNYSLIDYEK 77
           VDI I+NRK + +        SKP+ YS+ +E A  + V + +  E  +LLNYS+ +YE+
Sbjct: 20  VDILIENRKLLDANTRELKKNSKPKTYSM-EELAEDDTVNTGTVDEADRLLNYSIREYEE 78

Query: 78  WDEKE--KQANFDGTYS-----GDIAYSTYKNEIKQXXXXXXXXXX----XXXXXXSESG 126
           W++K+   + N   T S       IA  TY  +IK+                     ++G
Sbjct: 79  WEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTNDNRGKISKIRKDPKTG 138

Query: 127 KVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNRHFNEKLSR 186
           K+ + D K+L+ +LA+ L +T++ER+ R  ++   + ++ +E  +++NEKN+ FN+KL R
Sbjct: 139 KIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKN-SDQNENYSYINEKNKEFNDKLER 197

Query: 187 Q 187
           Q
Sbjct: 198 Q 198

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 64.3 bits (155), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 101/188 (53%), Gaps = 16/188 (8%)

Query: 18  VDISIKNRKEIVSEEVLQVGRSKPEVYSI------NDEGAAVNEVQSTSNTERR---KLL 68
           +DI  +NRK    E   +   SKP+VY I      ++     + +   SN E +   KL+
Sbjct: 21  LDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLM 80

Query: 69  NYSLIDYEKWDEKEK---QANFDGTYSGDIAYSTYKNEIKQXXXXXXXXXXXXXXX---X 122
           NY++ +YE+WD+++K   +   DG+   ++A  TY+ E+ +                   
Sbjct: 81  NYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSKLNSKLENISHEQKHQIGVN 140

Query: 123 SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNRHFNE 182
           + +GK+ ++DE+ L+N L   L +T+++R++  KK+L   KA++   GN+  +KN+ FNE
Sbjct: 141 TRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQS-KASSDIAGNYFKDKNKQFNE 199

Query: 183 KLSRQFKE 190
           KL R+ KE
Sbjct: 200 KLERELKE 207

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 52.0 bits (123), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 87/176 (49%), Gaps = 12/176 (6%)

Query: 19  DISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTSNTE--RRKLLNYSLIDYE 76
           DI I+NR  +  E   +    KP VYS++D+    +E +S+      R  L  Y++ D+ 
Sbjct: 19  DIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQSDMRTNLFQYTVQDFI 78

Query: 77  KWDEKEKQANFD------GTYSGDIAYSTYKNEIKQXXXX--XXXXXXXXXXXXSESGKV 128
            W++++++          G     +A +TY  E++                    +SGKV
Sbjct: 79  DWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEFKMKAKETQFRINKDSGKV 138

Query: 129 AIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNRHFNEKL 184
            I+D KELV +L+Q L++T+++R+   +K +   K +TS L   +N KN  FN+ L
Sbjct: 139 NIKDNKELVQRLSQNLKETAKQRYDSNRK-IANDKEHTS-LSGSINAKNLQFNKSL 192

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 86/185 (46%), Gaps = 39/185 (21%)

Query: 39  SKPEVYS-----------INDEGAAVNEVQSTSNTER-RKLLNYSLIDYEKWDEKEKQAN 86
           +KP+VYS           INDE A  N     S  ER  KL+NY+L +Y+ W+ K+ +  
Sbjct: 40  NKPKVYSMTDEFDKDELPINDENARKNH----SEEERISKLMNYTLREYKDWELKQNEYT 95

Query: 87  FDG-TYSGD--------IAYSTYKNEIKQXXXXXXXXXXXXXXXX---------SESGKV 128
            +  T S D        +A  TY  +I++                         +ES K+
Sbjct: 96  TESQTNSKDDQIESLDSLAKRTYDKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKI 155

Query: 129 AIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKAN-TSELGNFVNEKNRHFNEKLSRQ 187
            I+D+K LV +L   L KT  +R     K L   + N ++ L   VN KN+ FNEKL+R+
Sbjct: 156 VIKDDKFLVEELVNNL-KTKSDRLY---KHLGERRKNYSTTLSGHVNTKNQEFNEKLTRE 211

Query: 188 FKELG 192
           +K+L 
Sbjct: 212 WKKLS 216

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 85/193 (44%), Gaps = 29/193 (15%)

Query: 18  VDISIKNRKEIVSEEVLQVGRSKPEVYSIN--DEGAAVNEVQSTSNTERRKLLNYSLIDY 75
           +D  I++RK + ++E  +    KP+VYSIN  D+G         +N   R LL Y++ DY
Sbjct: 18  LDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDLLTNNSERALLTYTIRDY 77

Query: 76  EKWDEKEKQANFDGT-------YSGDIAYSTYKNEIKQXXXXXXXXXXXXXXXXSES--- 125
           E+W+E  K+ + + T            A  TY  EI +                  +   
Sbjct: 78  EEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQGKFATDEEITRGSAMKE 137

Query: 126 ----GKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFV-------- 173
               GK+ I+D+K LVN     + K S +R++   KR+  +  N    G+ V        
Sbjct: 138 VLDDGKLLIKDDKHLVNGFISDINKVSNDRYI---KRMKLNAVNNDATGSKVSHDKGKTS 194

Query: 174 --NEKNRHFNEKL 184
             N KN+ FN+KL
Sbjct: 195 YNNAKNKDFNDKL 207

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 64/153 (41%), Gaps = 23/153 (15%)

Query: 40  KPEVYSINDEGAAVNEVQSTSNTE--RRKLLNYSLIDYEKWDEKEKQANFDGT--YSGD- 94
           KP+VYS+     +V+ +      +    KLLN  L   E  + +  +   D      GD 
Sbjct: 67  KPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDR 126

Query: 95  IAYSTYKNEIKQXXXXXXXXXXXXXXXXSESGKVAIEDEKELVNKLAQTLEKTSRERFLR 154
           +A  TYK E+                   +S +    D    V +L   L   S++R+L 
Sbjct: 127 VAKDTYKKEL--------------ALLGRKSTRGTYRDN---VERLVTHLNDVSKKRYLV 169

Query: 155 EKKRLDGHKA-NTSELGNFVNEKNRHFNEKLSR 186
            K ++    A   S L  ++NEKN+ FN+KL R
Sbjct: 170 RKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>Suva_9.5 Chr9 complement(7435..8847) [1413 bp, 470 aa] {ON} YNR058W
           (REAL)
          Length = 470

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 33/63 (52%)

Query: 123 SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNRHFNE 182
           ++SG ++++   ++  K   +L  TS++RFL  KK   G       + + VN ++  +N 
Sbjct: 147 ADSGSISVDIAMKMALKYYHSLGNTSKKRFLTIKKGYHGDAFGAVSVCDPVNSRHSTYNG 206

Query: 183 KLS 185
            L+
Sbjct: 207 FLA 209

>ZYRO0G00704g Chr7 complement(52966..55011) [2046 bp, 681 aa] {ON}
           highly similar to uniprot|P38708 Saccharomyces
           cerevisiae YHR020W Protein required for cell viability
          Length = 681

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 135 ELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNR 178
           EL  ++ + LE+  R+ +LR K+  D H+   +E  +FV+  N+
Sbjct: 561 ELETRIPELLEELQRDLYLRAKELFDSHRVVVNEWKDFVSNLNK 604

>Ecym_2751 Chr2 (1456935..1458956) [2022 bp, 673 aa] {ON} similar to
           Ashbya gossypii AEL021C
          Length = 673

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 126 GKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFV---NEKN 177
           G+  I    EL  ++ Q LE      +L+ KK  D H+   +E  +FV   NEKN
Sbjct: 544 GQKYIVSLAELEMRIPQILEDMQETLYLKAKKSFDSHRVIVNEWKDFVPVLNEKN 598

>KLTH0H13046g Chr8 (1115590..1117617) [2028 bp, 675 aa] {ON} highly
           similar to uniprot|P38708 Saccharomyces cerevisiae
           YHR020W Protein required for cell viability
          Length = 675

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 135 ELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKNR 178
           +L  ++ + LE+  ++ FLR K   D H+    E  +FV   N+
Sbjct: 555 DLETRIPEILEEMQKDMFLRAKDLFDTHRVIVEEWKDFVPALNK 598

>KNAG0B05510 Chr2 (1074907..1076250) [1344 bp, 447 aa] {ON}
          Anc_4.131 YLR321C
          Length = 447

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 51 AAVNEVQSTSNTERRKLLNYSLIDYEKWDEKEKQANFDGTY--SGDIA 96
          A +   Q     +R K++NY+  D + +D+ ++  +FDG Y   GD+A
Sbjct: 30 ALLAASQQARAHKRAKVVNYAEFDTDLFDDLQRAGDFDGEYGDGGDLA 77

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.127    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,332,726
Number of extensions: 728055
Number of successful extensions: 2962
Number of sequences better than 10.0: 53
Number of HSP's gapped: 2914
Number of HSP's successfully gapped: 56
Length of query: 193
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 89
Effective length of database: 41,556,135
Effective search space: 3698496015
Effective search space used: 3698496015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 62 (28.5 bits)