Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12383.491ON39339320020.0
SAKL0F02794g3.491ON3974099301e-123
AFR309C3.491ON3643899271e-123
KLTH0F14806g3.491ON3583899011e-119
Kwal_55.212273.491ON3763968781e-115
Skud_16.4433.491ON4204348261e-107
Suva_16.4773.491ON4234417614e-97
KLLA0E04621g3.491ON3894107472e-95
Smik_16.4013.491ON4274407467e-95
TDEL0D055903.491ON3443887371e-94
YPR148C3.491ON4354507451e-94
ZYRO0D10010g3.491ON3824077044e-89
TBLA0D029803.491ON4434456582e-81
Kpol_1017.73.491ON3784036332e-78
TPHA0D032703.491ON3884156159e-76
KAFR0G036803.491ON4154465882e-71
CAGL0L08492g3.491ON3853725723e-69
NCAS0F035403.491ON4442755302e-62
NDAI0B058503.491ON4732965148e-60
KNAG0A079303.491ON4523483782e-40
KLTH0A03894g7.221ON3233772123e-18
TDEL0H022407.221ON3383552028e-17
Kwal_47.181487.221ON3233771992e-16
NDAI0A026607.221ON3643691975e-16
ADL115W7.221ON3333641941e-15
SAKL0F08162g7.221ON3303681894e-15
KLLA0E04511g7.221ON3023861868e-15
KNAG0D017607.221ON3423271879e-15
ZYRO0D16522g7.221ON3583211851e-14
CAGL0L00891g7.221ON3413621762e-13
Ecym_43777.221ON3332181743e-13
KAFR0I019507.221ON3303211736e-13
Kpol_1070.197.221ON3113311682e-12
Suva_9.1597.221ON3252191647e-12
Kpol_478.227.221ON3503211612e-11
Smik_9.1507.221ON3263051593e-11
NCAS0A133807.221ON3293161584e-11
YIL041W (GVP36)7.221ON3263181575e-11
Skud_9.1287.221ON3293001566e-11
TPHA0B027507.221ON3633371541e-10
TBLA0B015807.221ON3863351533e-10
TBLA0D042007.221ON3313241471e-09
TPHA0C012307.221ON3052191414e-09
NDAI0C030505.161ON73064790.30
Suva_12.655.161ON72064780.45
TBLA0H034708.517ON1516103780.57
Kpol_1018.1572.440ON1214183770.58
Skud_10.2055.161ON72164760.80
YJL012C (VTC4)5.161ON72164750.91
Suva_16.2568.517ON1513103751.2
TPHA0G028802.440ON107061741.6
TPHA0G024302.440ON118161741.6
TDEL0E046905.161ON72264731.7
KLLA0F22627g5.161ON72964722.1
Smik_10.2575.161ON72164722.3
CAGL0G06952g5.161ON71764722.7
Ecym_51125.51ON98881713.7
TBLA0B090402.440ON124261704.3
YPL058C (PDR12)8.517ON1511116704.9
Kpol_1060.445.161ON72164695.9
NDAI0E029508.517ON1512102687.5
YOR320C (GNT1)8.798ON491132678.2
Smik_7.354singletonON10598639.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1238
         (393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   775   0.0  
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   362   e-123
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   361   e-123
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   351   e-119
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   342   e-115
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   322   e-107
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   297   4e-97
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   292   2e-95
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   291   7e-95
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   288   1e-94
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   291   1e-94
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   275   4e-89
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   258   2e-81
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   248   2e-78
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   241   9e-76
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   231   2e-71
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   224   3e-69
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   208   2e-62
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   202   8e-60
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   150   2e-40
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    86   3e-18
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    82   8e-17
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    81   2e-16
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     80   5e-16
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    79   1e-15
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    77   4e-15
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    76   8e-15
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    77   9e-15
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    76   1e-14
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    72   2e-13
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    72   3e-13
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    71   6e-13
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    69   2e-12
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    68   7e-12
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    67   2e-11
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    66   3e-11
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    65   4e-11
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    65   5e-11
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    65   6e-11
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    64   1e-10
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    64   3e-10
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    61   1e-09
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    59   4e-09
NDAI0C03050 Chr3 (693899..696091) [2193 bp, 730 aa] {ON} Anc_5.161     35   0.30 
Suva_12.65 Chr12 complement(93503..95665) [2163 bp, 720 aa] {ON}...    35   0.45 
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    35   0.57 
Kpol_1018.157 s1018 complement(403373..407017) [3645 bp, 1214 aa...    34   0.58 
Skud_10.205 Chr10 complement(378631..380796) [2166 bp, 721 aa] {...    34   0.80 
YJL012C Chr10 complement(411234..413399) [2166 bp, 721 aa] {ON} ...    33   0.91 
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    33   1.2  
TPHA0G02880 Chr7 complement(612962..616174) [3213 bp, 1070 aa] {...    33   1.6  
TPHA0G02430 Chr7 complement(493879..497424) [3546 bp, 1181 aa] {...    33   1.6  
TDEL0E04690 Chr5 complement(879084..881252) [2169 bp, 722 aa] {O...    33   1.7  
KLLA0F22627g Chr6 complement(2112336..2114525) [2190 bp, 729 aa]...    32   2.1  
Smik_10.257 Chr10 complement(407331..409496) [2166 bp, 721 aa] {...    32   2.3  
CAGL0G06952g Chr7 complement(663828..665981) [2154 bp, 717 aa] {...    32   2.7  
Ecym_5112 Chr5 complement(243053..246019) [2967 bp, 988 aa] {ON}...    32   3.7  
TBLA0B09040 Chr2 (2146155..2149883) [3729 bp, 1242 aa] {ON} Anc_...    32   4.3  
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    32   4.9  
Kpol_1060.44 s1060 (106337..108502) [2166 bp, 721 aa] {ON} (1063...    31   5.9  
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    31   7.5  
YOR320C Chr15 complement(913619..915094) [1476 bp, 491 aa] {ON} ...    30   8.2  
Smik_7.354 Chr7 complement(587094..587408) [315 bp, 105 aa] {ON}...    29   9.1  

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/393 (95%), Positives = 377/393 (95%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKE 180
           GSSSKKDGVFWGFGKKSKND                GYIPPSFAQAISKAADDSITILKE
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKE 180

Query: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240
           LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV
Sbjct: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240

Query: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDN 300
           NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDN
Sbjct: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDN 300

Query: 301 LKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLF 360
           LKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLF
Sbjct: 301 LKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLF 360

Query: 361 HNFQLIYHKKCVQELQASLNVINTLTVEEDGEE 393
           HNFQLIYHKKCVQELQASLNVINTLTVEEDGEE
Sbjct: 361 HNFQLIYHKKCVQELQASLNVINTLTVEEDGEE 393

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/409 (49%), Positives = 266/409 (65%), Gaps = 39/409 (9%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS YFS+FSLDK+ ++I++AAHKTQ KL       + AI +I LDDPQ  LSL+ RKH L
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKL-------STAIANIQLDDPQAKLSLKVRKHYL 53

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QETLG I DISKLPP+YQFLE+KCD+ EK+C R+LVV+KTFEV+GYDYPPNL+ESISDWW
Sbjct: 54  QETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWW 113

Query: 121 GSSSKKDGVF-WGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILK 179
           G++  + G+  +  GKK +                  G++P SFAQA+SKAA DS  +L+
Sbjct: 114 GAN--RSGLLSFMDGKKGEG-----SRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLR 166

Query: 180 ELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSL 239
            L +EQ   P +  E EDED++SL+ + EAW++ +  ID+ K +MD  M  EFNKKLD L
Sbjct: 167 TLKDEQKEPPQDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKL 226

Query: 240 VNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTK------ETFTTIESQQVNDK 293
           +N DF KV +LRKKVEESRLKFDTLRYEL +++    + K      E    +E     +K
Sbjct: 227 INEDFKKVHSLRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVEQNAPEEK 286

Query: 294 DKE--------NEDNLKPTIHNNTGIGSS---------SDEEDQKFRLLLEKAEDEFVSN 336
            K          E +LK     +    S           D ED + + LLEK EDEFVS+
Sbjct: 287 AKTEGQETSEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPEHK-LLEKLEDEFVSS 345

Query: 337 TTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385
           TT+AV  M +ITDS  + +LVKLFH FQLIYH++CVQEL+AS  +++ L
Sbjct: 346 TTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGL 394

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  361 bits (927), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 201/389 (51%), Positives = 254/389 (65%), Gaps = 33/389 (8%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS+YF   SLDK+A+T+N AA KTQQKL+ETQE LTHAI +I +DDP+T+LSL+TRK QL
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QETLG+ KDIS+LPP+Y FLERKCDA E+VC +ILVVSKTFEV+GYDYPPN  ESISDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 121 GSSSKKDGVFWGFGK----KSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSIT 176
            +S+ K+  F  FGK    K K D                   PPSFA A+ +AA  S  
Sbjct: 121 NTST-KETRFLKFGKGGTDKQKEDKQKQAAGSSD---------PPSFAHALHRAAKGSQG 170

Query: 177 ILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKL 236
           I++EL E+            DEDV+SL+ +   WA+AQ N+D AK++MDQFM+ EFN+KL
Sbjct: 171 IIQELKEQAEEE-QEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKL 229

Query: 237 DSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKE 296
             L+  +F K   LR+KVEESRL FDTL+YE   R +  ++                 K+
Sbjct: 230 KHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAK-----------------KQ 272

Query: 297 NEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTL 356
           +E         +TG+  SS   D  F   LE AEDEFVSNT +AV +MT I D+  L +L
Sbjct: 273 DEAKQAEGATPSTGVTQSST-ADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISL 331

Query: 357 VKLFHNFQLIYHKKCVQELQASLNVINTL 385
           VKLF NFQL+YH+KCVQEL+ SLN + +L
Sbjct: 332 VKLFQNFQLVYHRKCVQELEVSLNSLTSL 360

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  351 bits (901), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/389 (50%), Positives = 255/389 (65%), Gaps = 32/389 (8%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS+YF  FSL+K+ ++I   AHKTQ       + L+ AI +I LDDPQ  LSL+ RKH L
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQ-------DTLSTAIANIQLDDPQAKLSLKARKHYL 53

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QETLGTI+DISKLPP+YQFLE+KCD+ EKVC R+LVV+KT+EV+GYDYPPNL+ES+SDWW
Sbjct: 54  QETLGTIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWW 113

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKE 180
             SS K+G+F GF   SK +                  +P SFAQAISKAA DS  ++  
Sbjct: 114 --SSNKEGLF-GFVSSSKKE-----KKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTA 165

Query: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240
           L  E+    S   + EDED+ SL+ + EAW+  Q N+D++K +MD  M+ EFN KL + V
Sbjct: 166 LKTEE-QKASAEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFV 224

Query: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDN 300
              F   R LRKKVE+SRLKFDT+RYEL+M +    +T+E     ESQ+  + + E   +
Sbjct: 225 EEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQG-KTEEAAQQTESQKPQEDEAEASKD 283

Query: 301 LKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLF 360
                       S S +E QK   LLEK EDEFVSNTT+AV  M +ITDS  +  LVKLF
Sbjct: 284 ------------SDSSDEAQK---LLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLF 328

Query: 361 HNFQLIYHKKCVQELQASLNVINTLTVEE 389
           HNFQLIY+K+CVQ L+ S+N +N L  +E
Sbjct: 329 HNFQLIYYKQCVQNLETSINSLNELEGDE 357

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  342 bits (878), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 254/396 (64%), Gaps = 28/396 (7%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MSSYF  FS +K+  T+  AAHKTQ       + L+ AI +I LDDPQ +LSL+ RKH L
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQ-------DTLSTAIANIQLDDPQAILSLKARKHYL 53

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QETLGTI+DISKLPP+YQ LE+KCD+ EK C R+LVV+KTFEV+GYDYPPNL+ES+SDWW
Sbjct: 54  QETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWW 113

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKE 180
             SS K+G+F G    SK D                  +P SFAQAI+KAA DS  +L  
Sbjct: 114 --SSNKEGLF-GLMSSSKKDKGAESAAAAKSA-----LMPRSFAQAIAKAAKDSGDVLAA 165

Query: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240
           L +++    S   E EDED+  L+ +  AW+E Q  ID+ K +MD  M  EFN+KL++L+
Sbjct: 166 LKDQE-QQASADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALI 224

Query: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKD---KEN 297
              F     LR+KVE+SRLKFDT+RYE+++ +  + Q  E     E  Q  + D   KE 
Sbjct: 225 EEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMEN----EKAQFKESDLSSKEE 280

Query: 298 EDNLKPTIHNNTGIGSSSDEEDQ----KFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNL 353
             +   T  N  G   +  +E+Q      + LLEK EDEFVSNTT+AV  M +ITDS  L
Sbjct: 281 GADANET-SNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAEL 339

Query: 354 STLVKLFHNFQLIYHKKCVQELQASLNVINTLTVEE 389
             LVKLFHNFQL+YH++CVQ+L+ASL+ +N L  E+
Sbjct: 340 LNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGED 375

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  322 bits (826), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/434 (44%), Positives = 260/434 (59%), Gaps = 65/434 (14%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS YFS FSL+KI  +I TAAHKTQ  LN        A  ++NL+DP+T LS+++R   +
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNA-----LASANVNLNDPETRLSIKSRTRFV 55

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QE+LGT+ DISKLPP+YQFLE+K D+ EKVC RIL+VSKTFEV+GYDYPPNL ESISDWW
Sbjct: 56  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWW 115

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKE 180
             S  KDG  W   +KS+N                  ++P SFAQAISKAA D     + 
Sbjct: 116 --SVNKDG--WFGSRKSEN------ANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQS 165

Query: 181 LNEEQLVNPSNGAETED-----------------EDVDSLMPILEAWAEAQSNIDEAKQQ 223
           L +++       +E+ +                 ED+ +L+ + ++W+    NIDE K +
Sbjct: 166 LKQDEKAGLKKKSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAE 225

Query: 224 MDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSG-ASQTKETF 282
           MD  MI EFNKKL+ L+N DF KV  LRKKVE+SRLKFDT+RYE++ +++   +Q  ET 
Sbjct: 226 MDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETS 285

Query: 283 TTIESQQVNDKDKENEDNLKPTIHNNTGI-------------GSSSDE------------ 317
             ++ + V+     + D   PT  + + I             GS++D+            
Sbjct: 286 KEVDDKAVSANAPISPDE-NPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQ 344

Query: 318 ------EDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKC 371
                 ED +   LLEK EDEFVSNTT AV  M +ITDS ++  LVKLF NFQL+Y ++C
Sbjct: 345 GDEPTIEDLEENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQC 404

Query: 372 VQELQASLNVINTL 385
           VQE++A+L V+N+L
Sbjct: 405 VQEVEANLKVLNSL 418

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  297 bits (761), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 190/441 (43%), Positives = 256/441 (58%), Gaps = 76/441 (17%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS Y+     +KI  +I TAAHKTQ  LN     L +A  ++NL+DPQT LS+++R   +
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSA---LANA--NVNLNDPQTRLSIKSRTRFV 50

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QE+LGT+ DISKLPP+YQFLE+K D+ EKVC RIL+VSKTFEV+GYDYPPNL ESISDWW
Sbjct: 51  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 110

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKE 180
             S  KDG  W   KK+++                  ++P SFAQAISKAA D  +  K 
Sbjct: 111 --SLNKDG--WFGSKKTEH------ASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKN 160

Query: 181 L--NEEQLVNPSNGAE-------------------TEDEDVDSLMPILEAWAEAQSNIDE 219
           L  NE++ +     A+                    +DED+ +L+ + ++W+    NIDE
Sbjct: 161 LEQNEKEDLKQKKEAKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDE 220

Query: 220 AKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRY-----ELEMRKSG 274
            K +MD  M+ EFNKKL+ L+N DF KV  LR+KVEESRLKFDT+RY     E ++R   
Sbjct: 221 GKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQK 280

Query: 275 ASQTKET--------FTTIESQQVNDKDKENEDNLKPTIHN----NTGIGSSSDE----- 317
              +KE          T++E     +K  E ED+ K          T + +++D+     
Sbjct: 281 DETSKEADNNDNSANSTSLEEALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNE 340

Query: 318 -------------EDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQ 364
                        ED +   LLEK EDEFVSNTT AV  M +ITDS  + +LVKLF NFQ
Sbjct: 341 NPKQQPTNNQPPVEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQ 400

Query: 365 LIYHKKCVQELQASLNVINTL 385
           L+Y ++C QE++A+L V+N +
Sbjct: 401 LVYFRQCAQEVEANLKVLNGM 421

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  292 bits (747), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 171/410 (41%), Positives = 239/410 (58%), Gaps = 48/410 (11%)

Query: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64
           FS  SL+ I  +I+ AA +TQ       EQ + AI  I+LDDP+T LS+  R+HQLQETL
Sbjct: 2   FSKLSLNNITDSISNAAQRTQ-------EQFSSAIEKIHLDDPETRLSILKRRHQLQETL 54

Query: 65  GTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSS 124
           GT+ DIS+LP +Y+FLE+K DA EK+C R+L+V+KTFEV+GYDYPPNL ES +DWW  S 
Sbjct: 55  GTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWW--SG 112

Query: 125 KKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKELN-E 183
            KD +F  F KK                    G +P SFAQA+SKAA DS  ILK+L  E
Sbjct: 113 NKDSIF-SFSKKK------AEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAE 165

Query: 184 EQLVNPSNGAETEDED------------------------VDSLMPILEAWAEAQSNIDE 219
           E   N     E  D+                         VD+L+   E+W + Q +ID+
Sbjct: 166 ETRTNQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQ 225

Query: 220 AKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTK 279
           +K +MD  M+ EFN KL  L+  DF K   LR KV+++RL FDTLR+E++++     Q K
Sbjct: 226 SKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK----LQEK 281

Query: 280 ETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTD 339
           E   + E  +     +  E   K T      +  + ++ D K   L E+ ED+FVS T++
Sbjct: 282 EVVASSEEAEKKVATETPETPEKKTNEEPVDMAKTEEDPDSK---LFERLEDQFVSATSE 338

Query: 340 AVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLTVEE 389
            V ++ ++TDS  + +LVKLFHNFQLI++K+CV+ L+  L V+N+L  E+
Sbjct: 339 TVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSED 388

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  291 bits (746), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 189/440 (42%), Positives = 248/440 (56%), Gaps = 70/440 (15%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS YFS+FSL+KI  +I TAAHKT   LN         ++     DPQT LS+++R   +
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLN-----DPQTRLSIKSRTRFV 55

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QE+LGTI DISKLPP+YQFLE+K D+ EKVC RIL+VSKTFEV+GYDYPPNL ESISDWW
Sbjct: 56  QESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 115

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAA--------- 171
             S  KDG  W   KKS+                   ++P SFAQAISKAA         
Sbjct: 116 --SLNKDG--WFGSKKSE------ITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQN 165

Query: 172 --DDSITILKELNEEQLVNPSNGAE------------TEDEDVDSLMPILEAWAEAQSNI 217
             +D    LK+  E      + GA+             EDED+ +L+ + ++W+    NI
Sbjct: 166 LENDEKAELKKKRESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNI 225

Query: 218 DEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYE-------LEM 270
           DE K +MD  M+ EFNKKL+ L+N DF +V  LRKKVE SRLKFDT+RYE       L+ 
Sbjct: 226 DEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDA 285

Query: 271 RKSG--------------ASQTKETFTTIESQQVNDKDKENE-----------DNLKPTI 305
           +K G              A+   E  +T++ +Q ++ + E E           D +    
Sbjct: 286 QKPGVTEEAHTKDVSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMKE 345

Query: 306 HNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQL 365
                    +  E+ +   LLEK EDEFVSNTT AV  M +I DS  +  L+KLF NFQL
Sbjct: 346 DPKDDKKDDTPLEESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQL 405

Query: 366 IYHKKCVQELQASLNVINTL 385
           +Y ++CVQE++A+L V+N L
Sbjct: 406 VYFRQCVQEVEANLKVLNGL 425

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  288 bits (737), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 231/388 (59%), Gaps = 52/388 (13%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS Y SNFSL+KI  T+  AAHKTQ  LN        AI   N+ DPQ  LSL+ R   L
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLN-------SAI--ANVSDPQAKLSLKARTRYL 51

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QETLGTI D SKLPP+YQ LE+K DA EK C RIL+V++TFEV+GYDYPPNL ESISDWW
Sbjct: 52  QETLGTIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWW 111

Query: 121 GSSSKKDGVFWGFGK--KSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITIL 178
             S  KDG F G  K  K+KND                 ++P SF+QAISKAA+D  ++ 
Sbjct: 112 --SLNKDGWF-GTKKPEKTKND----------SSDGSDAFLPRSFSQAISKAANDCNSVF 158

Query: 179 KELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDS 238
             L E          + EDEDV ++  + ++W++   NIDE K +MD  +  EFN KL+ 
Sbjct: 159 TNLQEH------GDEDEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEK 212

Query: 239 LVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKS-GASQTKETFTTIESQQVNDKDKEN 297
           ++N DF KV A RKKVEESRLKFDT+RYE++++++  A ++ ET      +   D+ K  
Sbjct: 213 IINEDFKKVHASRKKVEESRLKFDTVRYEIKLKETENAKKSTET-----DEASKDETKTE 267

Query: 298 EDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLV 357
           E+  K +  +                        EFVSNTT AV  M ++T+S  +  L 
Sbjct: 268 EEPPKTSEEDKLLEELED----------------EFVSNTTAAVEIMGEVTESAEILGLA 311

Query: 358 KLFHNFQLIYHKKCVQELQASLNVINTL 385
           KLF NFQL+Y ++CVQE++ASL ++  L
Sbjct: 312 KLFQNFQLVYFRQCVQEVEASLKILGAL 339

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  291 bits (745), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 187/450 (41%), Positives = 246/450 (54%), Gaps = 78/450 (17%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS YFS FSL+KI  +I TAAHKTQ  LN         ++     DPQT LS+++R   +
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLN-----DPQTRLSIKSRTRFV 55

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QE+LGT+ DISKLPP+YQFLE+K D+ EKVC RIL+VSKTFEV+GYDYPPNL ESISDWW
Sbjct: 56  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 115

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKE 180
             S  KDG  W FG K                     ++P SFAQAISKAA D     + 
Sbjct: 116 --SLNKDG--W-FGSKKSE-----SSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQN 165

Query: 181 LNEEQL---------VNPSNGAETEDED-----------------VDSLMPILEAWAEAQ 214
           L   +          +  +   E +  D                 + +L+ + ++W+   
Sbjct: 166 LEHNEKAELKKKKESIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCY 225

Query: 215 SNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRY-------E 267
            NIDE K +MD  M+ EFNKKL++L+N DF KV  LRKKVEESRLKFDT+RY       E
Sbjct: 226 KNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAE 285

Query: 268 LEMRKS---GASQTKE---------TFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSSS 315
           LE +K+   G + +K+         T T+ +     + +K   +  +          +  
Sbjct: 286 LEAKKAEATGEAHSKDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVD 345

Query: 316 DEEDQKFRL------------------LLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLV 357
           D  D+K  L                  LLEK EDEFVSNTT AV  M +ITDS  +  L+
Sbjct: 346 DVADRKEDLKSNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLI 405

Query: 358 KLFHNFQLIYHKKCVQELQASLNVINTLTV 387
           KLF NFQL+Y ++CVQE++A+L V+N L +
Sbjct: 406 KLFQNFQLVYFRQCVQEVEANLKVLNGLEI 435

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  275 bits (704), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 168/407 (41%), Positives = 240/407 (58%), Gaps = 49/407 (12%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS YFS+FS   +  +I  AAH+TQ KL       ++A+ ++NL+DPQT LS++TR   L
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKL-------SNAVANVNLNDPQTRLSIKTRTRYL 53

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           +ETLG + +ISKLPP+Y  LERK DA EK C R+L+V++TFEV+GYDYPPNL ES SDWW
Sbjct: 54  KETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWW 113

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILK- 179
             S  K+G  W FG   +++                  +P SFAQAI+KA+ +     + 
Sbjct: 114 SGS--KEG--W-FGSTKQDEDGESKIQTDGSSKDP--LMPRSFAQAIAKASHECGEAYQN 166

Query: 180 -ELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDS 238
            + +E++ ++       EDED  +L+ +    +    NIDE K +MD+ +  EFN KL+ 
Sbjct: 167 SQKSEKKQID-------EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQ 219

Query: 239 LVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSG--------ASQTKETFTTIESQQV 290
           L+N DF K+  LR KVE SRLKFDT+RYE+ +++          A+  +      + +  
Sbjct: 220 LLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLKEKEEKEENENTANADEGPSNKNQQEPT 279

Query: 291 NDKDKENEDNLKPT------IHNNTGIGSSSDE------EDQKFRLLLEKAEDEFVSNTT 338
           N+  KE E   KPT        + T   +S+ E      ED K   LLE+ EDEFVSNT+
Sbjct: 280 NEPAKEEE---KPTPAEPAEAQHTTKTENSNKEPMVEKPEDNK---LLEQLEDEFVSNTS 333

Query: 339 DAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385
           +AV  MT I +   +  L+KLF N QL+Y+++CVQE++ASL  +N L
Sbjct: 334 EAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDL 380

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  258 bits (658), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 170/445 (38%), Positives = 251/445 (56%), Gaps = 84/445 (18%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLD--DPQTMLSLRTRKH 58
           MS YFSNFSLDK+A ++ +AA KTQ       + L++AI ++N+D  DPQT L+L +++H
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQ-------DTLSNAIQNVNIDWNDPQTRLTLLSKQH 78

Query: 59  QLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISD 118
            LQE++G I +ISKLP +Y  LERK DA EK+  RIL+V+ TFE++GYDYPPNL+ESIS+
Sbjct: 79  YLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISE 138

Query: 119 WWGSSSKKDGVFW-----GFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADD 173
           WW +    D + +         K+K++                 ++P SF  AISKA+ D
Sbjct: 139 WWLN----DPLAFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSD 194

Query: 174 SITILKEL-NEEQL----VNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFM 228
           S  IL  L N E+L        +    +DED+  L+ + ++W+    NID++K Q DQ +
Sbjct: 195 SSAILTNLNNNEKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLI 254

Query: 229 INEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYEL-----------------EM- 270
           I +FNKKL SL++ +F  V+ALR KV+++RLKFDT+RYE+                 EM 
Sbjct: 255 IKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEAKVRAEENDKPVEME 314

Query: 271 ---------------------------RKSGASQTKETFTTIESQQVNDKDKENEDNLKP 303
                                        +  S TK+   TIESQ+ +  + E E N   
Sbjct: 315 KGEGEDEGEGEGKGKGKGKGETASTSTETASTSTTKDAAATIESQKKDSPNPEFEKN--- 371

Query: 304 TIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNF 363
                      S  ED+K   LLE  EDEFVS+T+ AV  M +IT+S  +  L+KLF NF
Sbjct: 372 ----------DSQNEDEK---LLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNF 418

Query: 364 QLIYHKKCVQELQASLNVINTLTVE 388
           QL+++++C++E++ ++ ++  LT E
Sbjct: 419 QLLHYQQCIKEVETNMKLLTDLTHE 443

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  248 bits (633), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/403 (38%), Positives = 225/403 (55%), Gaps = 50/403 (12%)

Query: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSIN------LDDPQTMLSLRTRKH 58
           FS FS+DK+  +I+  A KTQ       E LT+A+ ++N      L+DP T LS++++  
Sbjct: 2   FSGFSIDKLTDSISNVALKTQ-------ENLTNALSNVNENLENYLNDPNTKLSIKSKAR 54

Query: 59  QLQETLGTIKD-ISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESIS 117
            +QE LGTI D  SKLPP Y  LE K DA EK   R+L V+KT+E +GYDYPPNL ES+S
Sbjct: 55  FIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLS 114

Query: 118 DWWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITI 177
           DWW                + +D                 ++P SFAQAIS A+ D+ + 
Sbjct: 115 DWW----------------TNDDNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAASN 158

Query: 178 LKELNEEQLVNPSNGAETEDEDV--DSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKK 235
           +  +     +N  +  E E++D     L  I E+      NID  K +MD+ ++NEFN K
Sbjct: 159 VNSVTNTIKLNHKDDEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNK 218

Query: 236 LDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVND--- 292
           L  L+N +F  V  LRK VE SRLKFDT+RYEL+++     + K T   +E++  +D   
Sbjct: 219 LKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIK-----EWKRTXXXMEAEDKSDVSK 273

Query: 293 ----------KDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVA 342
                     K+   ++  K  I+    I +  + E+     LLEK EDEFVSNT +AV 
Sbjct: 274 KGTSKKETPKKEASKKETPKKEINKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVE 333

Query: 343 YMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385
            M ++TD+  +  LVKL+ NFQL+Y+K+C+QE++++L ++N L
Sbjct: 334 KMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGL 376

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  241 bits (615), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 160/415 (38%), Positives = 232/415 (55%), Gaps = 62/415 (14%)

Query: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64
           FSNFSLDK+  +I+  A KTQ+        L + I +I L+DP T LS+R R   +QE L
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETI-LNDPNTKLSIRARSRYIQEQL 60

Query: 65  GTIKD-ISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSS 123
           GT+ D ISKLP +Y  LE K D+ EK+  R+L+V+ TF  +GYDYPPNL ESISDWW   
Sbjct: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120

Query: 124 SKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDS--ITILKEL 181
              +                              ++P SFAQA++KA  DS  IT   E 
Sbjct: 121 ETTEN---------------------------KNFLPRSFAQALAKAYSDSKLITDKAER 153

Query: 182 NEEQLVNPSNGAETEDED-------------------VDSLMPILEAWAEAQSNIDEAKQ 222
           N +   +P N   T+DE+                   + +L    +A + + +NID  K 
Sbjct: 154 NIKLQTSPKNTG-TKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKN 212

Query: 223 QMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQ--TKE 280
           +MD  ++NEFNKKL+ L+  +F +V  LR+ VE SRLKFDT+RY+++++++ A Q   KE
Sbjct: 213 EMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKE 272

Query: 281 TFT--TIESQQVNDKD------KENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDE 332
             T   IE ++   K+      +E E   K T   +    +  + ED+ ++ LLE+ EDE
Sbjct: 273 VSTDKEIEKKESETKEPETKGTEEKEPETKDTEEKDPVKENEGENEDEDYK-LLEQLEDE 331

Query: 333 FVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLTV 387
           FVSNT+ AV  M ++TDS  +  LVKLF NFQL+Y+++CVQE++ +L  I+ L +
Sbjct: 332 FVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLEI 386

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  231 bits (588), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 166/446 (37%), Positives = 240/446 (53%), Gaps = 98/446 (21%)

Query: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64
           FSNF+ DKI ++I+TAA   QQK+N+T          I   D QT L  +      QE +
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDT----------ILTPDVQTKLHFKKTARFWQEKV 51

Query: 65  GTI--KDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGS 122
           G I  K+ISKLP  Y  LE K DA EK+  R+L+V+KT+E++GYDYPPNL+ES++DWW  
Sbjct: 52  GQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW-- 109

Query: 123 SSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKELN 182
                   W   KKSK                   ++  SF  AISKAA DS +IL +L 
Sbjct: 110 --------WSDLKKSK------------KHQEKSSFMNNSFPMAISKAAFDSKSILDDLK 149

Query: 183 EEQLVNPSNGAETEDEDVD-------SLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKK 235
           E+Q   P  G E E+E  +       +L+ +  + +    NID++K +MD  ++ EFN K
Sbjct: 150 EKQQDLPKEGEEPEEEVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFK 209

Query: 236 LDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMR-------KSGASQTKETFT----- 283
           L+ L+NNDF KV  LR KV++SRL+FDTLR+E++++       +   SQ  + F      
Sbjct: 210 LEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTK 269

Query: 284 -------TIESQQVND-------------KDKENEDNL-KPTIHNNTGI---------GS 313
                  + + +QVN+             +DK  ED + K T+               GS
Sbjct: 270 EVPPKEESTKEEQVNEESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAKETEKPAKEGS 329

Query: 314 --------------SSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKL 359
                         SS+EE ++++ LLEK EDEFVSNT  AV  MT++T++  +  LVKL
Sbjct: 330 SKEEAPKEDVKHNGSSEEETEEYK-LLEKLEDEFVSNTGAAVELMTELTETSEVINLVKL 388

Query: 360 FHNFQLIYHKKCVQELQASLNVINTL 385
           F NFQLI++K+CVQE++ ++  ++ L
Sbjct: 389 FQNFQLIHYKQCVQEIENNMKFLDQL 414

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  224 bits (572), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 141/372 (37%), Positives = 206/372 (55%), Gaps = 42/372 (11%)

Query: 44  LDDPQTMLSLRTRKHQLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEV 103
            +DP+T LS++ +   LQE +G  +DISKLPP+Y  LE+KCD+ EKV  RIL+V+KT+E+
Sbjct: 24  FNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEI 83

Query: 104 DGYDYPPNLAESISDWWGS------SSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXG 157
           +GYDYPPN++ES+S WW +      S     V    G   K                   
Sbjct: 84  EGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG- 142

Query: 158 YIPPSFAQAISKAADDSITILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNI 217
             PPSFA AI++A  DS  I + +            E E ED+D L+ I + W++    I
Sbjct: 143 --PPSFASAIARAGKDSQLIFESIE--------TKDEDEKEDIDELVKIFKIWSDCFYEI 192

Query: 218 DEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQ 277
            ++K +MDQ MI EFN KL+  +  +F K+  LR KVEESRL FDT+RYE+  + S  + 
Sbjct: 193 SDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEV-AQTSKQTD 251

Query: 278 TKETF-------TTIESQQVNDKDKENEDN---LKPTIHNNTGIGSSSDE---------- 317
           +KE         +++++ + N ++KE  ++    K     N  I   + E          
Sbjct: 252 SKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDL 311

Query: 318 -EDQKFRL---LLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQ 373
            ED K      LLE+ EDEFVSNTT+AV  MT+++++  L +L+KLF  FQL YH+ CV+
Sbjct: 312 KEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVK 371

Query: 374 ELQASLNVINTL 385
            L+ SL  +N +
Sbjct: 372 SLEQSLKDLNAI 383

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  208 bits (530), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 166/275 (60%), Gaps = 38/275 (13%)

Query: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64
           FSNFSLDKI +++ TAA KT        + L++AI +    DP T LSLR++K   QE++
Sbjct: 2   FSNFSLDKITNSLATAAQKTS-------DTLSNAITTAT--DPATKLSLRSQKRLFQESI 52

Query: 65  GTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSS 124
           GT+ DIS LP +Y  LE + DA EK   RIL+VSKTFE++GYDYPPNL+ES SDWW  SS
Sbjct: 53  GTVHDISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSS 112

Query: 125 KKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKELNE- 183
           KK                              G++P SFAQAIS +A+D + I + +N+ 
Sbjct: 113 KK--------------------KKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDG 152

Query: 184 --------EQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKK 235
                         +   + EDEDV +L+   ++WA+   NID+ K +MD  M+ EFN K
Sbjct: 153 DDEDKEENANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAK 212

Query: 236 LDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEM 270
           L+ L+N +F KV  LRK+V++SRLKFDT+RYEL++
Sbjct: 213 LEKLLNEEFKKVHTLRKRVKDSRLKFDTVRYELKV 247

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 51/71 (71%)

Query: 317 EEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQ 376
           E+D +   LLE+ ED FVS+T  AV  M +ITDS  +  LVKLF NFQL+Y+++CVQE++
Sbjct: 374 EDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIE 433

Query: 377 ASLNVINTLTV 387
           A+L  +N L +
Sbjct: 434 ANLKTLNELEI 444

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  202 bits (514), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 167/296 (56%), Gaps = 38/296 (12%)

Query: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64
           FS+FSLDKI ++I  AA K    LN       +AI++    DPQT LS++++    QE L
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLN-------NAINTAT--DPQTKLSIKSQTRLFQEQL 52

Query: 65  GTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWG--- 121
           GTI DISKLP +Y+ LE K D+ EK   RIL+VSKTFE++GYDYPPNL ES SDWW    
Sbjct: 53  GTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITK 112

Query: 122 -SSS---KKDGVFWGFGKKSKNDXXXXXXXX-XXXXXXXXGYIPPSFAQAISKAADDSIT 176
            SSS   K+  V       + ND                  ++P SFAQAISK+A D   
Sbjct: 113 KSSSHRKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTD 172

Query: 177 ILKELNEEQLVNPSNGAETEDE---------------------DVDSLMPILEAWAEAQS 215
           I ++L+ ++        + E+E                     D+ +L+   E+W+    
Sbjct: 173 IYQQLSIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYK 232

Query: 216 NIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMR 271
           NID+ K +MD  M  EFN KL+ L+NN+F KV  LRKKV +SRLKFDT+R+E++++
Sbjct: 233 NIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIK 288

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 54/70 (77%)

Query: 316 DEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQEL 375
           +++D +   LLE+ EDEFVS+T  AV  MT+IT+S ++  L+KLF NFQL+Y+++CVQE+
Sbjct: 401 EQDDSEEHKLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEI 460

Query: 376 QASLNVINTL 385
           +A+L  +N L
Sbjct: 461 EANLKTLNEL 470

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  150 bits (378), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/348 (32%), Positives = 163/348 (46%), Gaps = 62/348 (17%)

Query: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64
           FSNFSLDK+ STI  AA   Q  ++ T          I   D QT L         QE +
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNT----------ILSPDAQTKLQFLKTTRYFQEKV 51

Query: 65  GTIKD--ISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGS 122
           GTI +  I+KLP  YQ L+ K +A EKV  R+LVV+KTFE++GYDYPPN+ ES++ WW  
Sbjct: 52  GTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNE 111

Query: 123 SSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKELN 182
              K      FG  S                     +  SFA AI KA  DS  IL +L 
Sbjct: 112 DENKKKKTQDFGDSS--------------------ILNRSFAIAIGKAVLDSQYILSDLK 151

Query: 183 EEQLVNPS-----------------------------NGAETEDEDVDSLMPILEAWAEA 213
           E+Q    +                                E ED D+++++     W+  
Sbjct: 152 EQQKTRGTEEKKVKREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNC 211

Query: 214 QSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKS 273
             NID++K +MD  ++ EFN+KL  ++  DF  V  L  +V++SRL+FDTLR++L++++ 
Sbjct: 212 YKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRHKLKLKEL 271

Query: 274 GASQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSSSDEEDQK 321
                ++    +  QQ  +   E     K   H   G   S+ EE +K
Sbjct: 272 EKEARRQVMEEVAEQQA-EASGEPVRKRKSRAHGAQGGRKSTTEEAEK 318

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (75%)

Query: 331 DEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLTVE 388
           DEFVSN T AV  MT++TDS  L +LVKLF N QL+++++CVQEL+AS+  ++ L  E
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 86.3 bits (212), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 93/377 (24%), Positives = 148/377 (39%), Gaps = 82/377 (21%)

Query: 16  TINTAAHKTQQKLNETQEQLTHAIHSINLD----DPQTMLSLRTR-------------KH 58
           + N  A    +KL E   Q++       LD    D  + +S RT+             + 
Sbjct: 2   SFNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQRTQDLTTQLPSFAQSTQR 61

Query: 59  QLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISD 118
            +QE LG + DIS+LP  Y  LE K D    V    L V++ +E + YDYP N+ +S+++
Sbjct: 62  LVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVNE 121

Query: 119 WWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITIL 178
           +   SS   G      + +  +                   P +   A+SK A       
Sbjct: 122 F---SSVVAGKLHDLSRATSTNEAQSVLIAPGPHKD-----PKTLNYALSKVA------- 166

Query: 179 KELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDS 238
             L   + +N S G   +D +V +    L  +++ Q+ + +A+ Q D  +   FNKKL  
Sbjct: 167 --LTSSEYLNKSVGG--DDSEVSN---ALLKYSDVQAKVAQARLQQDTLIQTRFNKKLRD 219

Query: 239 LVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENE 298
           ++ ND  + +  RK VE  RL++D  R  L                              
Sbjct: 220 ILANDLNEAQKARKNVEHKRLQYDIARSNLA----------------------------- 250

Query: 299 DNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVK 358
            N KP             E++   R+ +E  EDEF   T DAV  M ++  S  L   ++
Sbjct: 251 -NAKP-------------EKEASLRVQMESLEDEFAQATDDAVVVMQKVAGSSELLKELR 296

Query: 359 LFHNFQLIYHKKCVQEL 375
                Q  YHK+  + L
Sbjct: 297 ELVAAQADYHKQSYELL 313

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 80/355 (22%), Positives = 140/355 (39%), Gaps = 68/355 (19%)

Query: 15  STINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKDISKLP 74
           ST N   +   QK  E    ++     I+ + P   L+  T++  +QE LG + DIS+LP
Sbjct: 2   STFNNFTNSLNQKFQELSTAVSQRTQEISTNLPS--LTQSTQR-LVQERLGQVTDISQLP 58

Query: 75  PRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSSKKDGVFWGFG 134
             Y  LERK D  + +    L V+  +E + YDYP  + ES++D+    + K        
Sbjct: 59  REYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKVQELSHAS 118

Query: 135 KKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKELNEEQLVNPSNGAE 194
             S+                    I P+        A +  T+   L++  L++      
Sbjct: 119 SASEAQNI---------------LITPT-------PAKEPRTLNYALSKVSLISSEYLNH 156

Query: 195 TEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKV 254
             D D   +  +L  +++ Q+ + +A+ Q D  +   FNK+L   + ++F K +  RK V
Sbjct: 157 IGDHDEAQVASVLLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDV 216

Query: 255 EESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSS 314
           E  RL++D  R                                           + +  +
Sbjct: 217 EYKRLQYDVAR-------------------------------------------SNLAQA 233

Query: 315 SDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHK 369
             E++   R+ +E  ED+F   T DA   M ++  +   +  +K   N QL YH+
Sbjct: 234 KPEKEASLRVQMETLEDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQ 288

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 90/377 (23%), Positives = 149/377 (39%), Gaps = 82/377 (21%)

Query: 16  TINTAAHKTQQKLNETQEQLTHAIHSINLD----DPQTMLSLRTR-------------KH 58
           + N+ A    +K  E   Q++       LD    D  T +S +T+             + 
Sbjct: 2   SFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQR 61

Query: 59  QLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISD 118
            +QE LG + DIS+LP  Y  LE K D  + V    L V++ +E + YDYP N+ +S+++
Sbjct: 62  LMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNE 121

Query: 119 WWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITIL 178
           +      K        + +  +                   P +   A+SK A       
Sbjct: 122 FSSIVGTK---LHELSRATSTNEAQSVLISPGPHKD-----PKTLNYALSKVA------- 166

Query: 179 KELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDS 238
             L   + +N S GA  ED +V S    L  +++ Q+ I +A+   D  +  +FNKKL +
Sbjct: 167 --LTSSEYLNKSPGA--EDSEVSS---SLLKYSDVQAKIAQARLHQDTLIQTKFNKKLRA 219

Query: 239 LVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENE 298
            + +D  + +  RK VE  RL++D  R  L                              
Sbjct: 220 ALADDLNRAQKARKNVENKRLQYDIARANLA----------------------------- 250

Query: 299 DNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVK 358
            N +P             E++   R+ +E  EDEF   T DAV  M ++ +S  L   ++
Sbjct: 251 -NARP-------------EKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLR 296

Query: 359 LFHNFQLIYHKKCVQEL 375
                Q  Y+K+  + L
Sbjct: 297 ELVAAQAEYYKQSAELL 313

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 88/369 (23%), Positives = 149/369 (40%), Gaps = 63/369 (17%)

Query: 15  STINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKDISKLP 74
           ST N+  +   ++L E    ++      + + P      ++ +  +QE LG + DIS+LP
Sbjct: 2   STFNSFTNSFNKRLQELSTTVSQKTQEFSTNMPDINSLAQSTQRMVQERLGQVTDISQLP 61

Query: 75  PRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSSKKDGVFWGFG 134
             Y  LERK D  + V    L V+ TFE   YDYP    ES+ ++  S+  K        
Sbjct: 62  EEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESVIEFSKSAVSKVEELSHAT 121

Query: 135 KKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKELNEEQLVNPSNGAE 194
             S+                     P +   A+SKA   S+   ++LN++   +  N + 
Sbjct: 122 SASEAQQILTNNSNQIKE-------PKTLNYALSKA---SLISSEQLNKQFSTDDDNNSN 171

Query: 195 TEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKV 254
           ++ + V S   IL  +++ Q+ I +A+ Q D  +  +FN  L + +N  F + + +RK V
Sbjct: 172 SDFKLVSS---ILLKFSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDV 228

Query: 255 EESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSS 314
           +  RL++D  R  L                               N KP           
Sbjct: 229 QNKRLQYDVARTNLL------------------------------NAKP----------- 247

Query: 315 SDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQE 374
             E++   R+ +E  ED+F   T  A   M +I ++ N    +      QL Y+      
Sbjct: 248 --EKEASLRVQMELLEDQFAQATEHATLVMNEIIENSNFMEYLNELARAQLAYY------ 299

Query: 375 LQASLNVIN 383
            Q S N++N
Sbjct: 300 -QLSSNIMN 307

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/364 (22%), Positives = 149/364 (40%), Gaps = 69/364 (18%)

Query: 13  IASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSL-RTRKHQLQETLGTIKDIS 71
           I+ST+   A + Q  L++  + L+ ++     D    + SL +T + ++QE LG + DIS
Sbjct: 17  ISSTVQQKAQEAQ--LDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQRRVQERLGQVTDIS 74

Query: 72  KLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSSKKDGVFW 131
           ++P  Y  LE++ D  + +    L VS+ +E + YDYP ++++S++D+  + +   G   
Sbjct: 75  QMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDFSKTVT---GKVQ 131

Query: 132 GFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKELNEEQLVNPSN 191
              K +  +                   P +   A+SK A  S   L +   + +V    
Sbjct: 132 ELTKATTTEEAQSILISPGPARN-----PKTLNYALSKVALTSSEYLSKSGSDDVV---- 182

Query: 192 GAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALR 251
              T D        IL  +++ Q+ I +A+ Q D  +   FN++L   +N  F +    R
Sbjct: 183 ---TAD--------ILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSR 231

Query: 252 KKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGI 311
           K+V++ RL++D  R                                              
Sbjct: 232 KQVDQKRLQYDIAR-------------------------------------------ANF 248

Query: 312 GSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKC 371
            ++  E+    R+ +E  ED+F  +T DAVA M  + D        +     QL +HK  
Sbjct: 249 TAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTAQLGFHKAA 308

Query: 372 VQEL 375
            + L
Sbjct: 309 AELL 312

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 92/368 (25%), Positives = 149/368 (40%), Gaps = 77/368 (20%)

Query: 7   NFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL-QETLG 65
           N    +++++++  A + Q  L++  + L+ A+     D   ++ SL     +L QE LG
Sbjct: 11  NKKFQELSTSVSQKAQEAQ--LDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQRLVQERLG 68

Query: 66  TIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSSK 125
            + DIS+LP  Y  LE + D    V    L V++ +E + YDYP N+ +S++++  + S 
Sbjct: 69  QVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTVSS 128

Query: 126 KDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKELNEEQ 185
           K          S  D                   P +   A+SK A  S   L +     
Sbjct: 129 K---LHELSHASSTDEAQNILISPGPAKD-----PKTLNYALSKVALTSSEYLSK----- 175

Query: 186 LVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLVNNDFL 245
                +G E E     ++   L  +++ Q+ I +A+ Q D  +  +FNKKL   + +D  
Sbjct: 176 -----SGHEDE-----TIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLN 225

Query: 246 KVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDNLKPTI 305
           K    RK+VE  RL++D  R  L                               N KP  
Sbjct: 226 KAVKARKEVENKRLQYDIARANLA------------------------------NAKP-- 253

Query: 306 HNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSV----NLSTLVKLFH 361
                      E++   R+ +E  EDEF   T DA   M  +  S     +LS LV    
Sbjct: 254 -----------EKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELV---- 298

Query: 362 NFQLIYHK 369
           + QL Y+K
Sbjct: 299 SAQLAYYK 306

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 88/386 (22%)

Query: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60
           MS YF +FS  K+     + + K Q+       QL      +  + P  +L+  T++  L
Sbjct: 1   MSQYFDSFS-KKVQELSTSVSQKAQEA------QLDQKFKDLKTNLP--LLANSTQR-ML 50

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QE LG + DIS+LP  Y  LE + +  + +    L V+K +E + YDYP N+ ES+ ++ 
Sbjct: 51  QEKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEF- 109

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKE 180
             S    G      K +  +                   P +   A+SK A         
Sbjct: 110 --SKLVGGKLHDLSKVTNREQAQNVLLSSPQMKE-----PKTLNYALSKVA--------- 153

Query: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240
                    ++    EDE   SL   L  ++++Q+ I + + Q D  +  +FNK +   +
Sbjct: 154 --------LTSSEHVEDE---SLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKL 202

Query: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDN 300
             D       RK VE+ RL++D +R         +++ K                    N
Sbjct: 203 EQDIETSTKARKLVEQKRLQYDVVR---------SNRLK--------------------N 233

Query: 301 LKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITD----SVNLSTL 356
            KP       +  S+ EE             EF   T DA+  M+++ +    S NL  L
Sbjct: 234 TKPEKQAALQVEESTHEE-------------EFAKATDDAIIAMSKVVELADFSANLHEL 280

Query: 357 VKLFHNFQLIYHKKCVQELQASLNVI 382
           V      QL YHK   + L+  +N +
Sbjct: 281 VAA----QLAYHKSSAEILEELVNEV 302

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 74/327 (22%), Positives = 129/327 (39%), Gaps = 62/327 (18%)

Query: 54  RTRKHQLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLA 113
           +T +  +QE LG + DIS+LP  Y  LE++ DA + V    L V+  +E + YDYP  + 
Sbjct: 38  QTTQRLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVR 97

Query: 114 ESISDWWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADD 173
           +S+++W  + + +          ++                     P +   A+SK A  
Sbjct: 98  DSVNEWSRTVATRVSELRHVSSAAEAQHVIAAPTQETE--------PKTLHYALSKVA-- 147

Query: 174 SITILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFN 233
                  LN  QLV+  +   T  E    L   L  ++  ++ + +A+ + D  +  +FN
Sbjct: 148 -------LNGSQLVDNLDAPRTPRE--TQLSSGLLEFSGVEAELAQARLEQDAAVKAQFN 198

Query: 234 KKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDK 293
           +KL   ++ +  +  A RK+V + RL++D  R  L                         
Sbjct: 199 EKLRGQLSGEIARAAAARKEVFQKRLQYDVARTNLL------------------------ 234

Query: 294 DKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNL 353
                 N KP             E++   R+ +E  EDEF   T  A   M ++    +L
Sbjct: 235 ------NAKP-------------EKEASLRVQMETLEDEFAQCTEHATIVMQEVLSQADL 275

Query: 354 STLVKLFHNFQLIYHKKCVQELQASLN 380
              V+     Q  YH++    L+  L 
Sbjct: 276 LGAVRRLAAAQHAYHERSAAILEGFLG 302

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 121/321 (37%), Gaps = 65/321 (20%)

Query: 60  LQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDW 119
           +QE LG   DIS++P  Y  L  K DA + + +  L V++ ++ + YDYP  + ESI+++
Sbjct: 39  MQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESINEF 98

Query: 120 WGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILK 179
             +           G K +                  G   PS          D  T+  
Sbjct: 99  SRT----------VGSKIQELSHASSAHEAHSILSAPG---PS---------KDPKTLNY 136

Query: 180 ELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSL 239
            L+   LV+          D   L   L  +++ QS + +A+   D  +   FN KL   
Sbjct: 137 ALSRVSLVSSECMEHLSTHDDALLASYLMKYSDIQSRVAQARLHQDSLVQTHFNAKLREE 196

Query: 240 VNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENED 299
           ++ +  +   +R+ VE  RL +D  R  LE  K                           
Sbjct: 197 IDGNLKRAHRVRRDVENKRLTYDASRTHLEKAKP-------------------------- 230

Query: 300 NLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKL 359
                            E++ + R+ +E AE+EF   T +A+  M ++    N   L++ 
Sbjct: 231 -----------------EKEAQLRVQMETAEEEFAQATENAIVVMQEVIAGANFMPLLRE 273

Query: 360 FHNFQLIYHKKCVQELQASLN 380
               Q  YH+   Q +QA L+
Sbjct: 274 LAAAQWSYHETAAQRMQAFLS 294

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/362 (22%), Positives = 144/362 (39%), Gaps = 73/362 (20%)

Query: 15  STINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKDISKLP 74
           S  N+ A+  ++ L      ++   H ++ + P   L+  T++  +QE LG + DIS+LP
Sbjct: 2   SNFNSFANSLRENLQSFSNTVSQKTHELSTNIP--TLAQSTQR-MVQEKLGQVTDISQLP 58

Query: 75  PRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSSKKDGVFWGFG 134
             Y  LE K D  + V    L V+  +E + YDYP  ++ES++++               
Sbjct: 59  QEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSK----------NMA 108

Query: 135 KKSKNDXXXXXXXXXXXXXXXXGYI--PPSFAQAISKAADDSITILKELNEEQLVNPSNG 192
            K +                  G +  P +   A+SK A         LN  + +N S  
Sbjct: 109 AKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVA---------LNASEYLNHSF- 158

Query: 193 AETEDEDVDS-LMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALR 251
               D+ +D+ L  +L  +++ Q+ + +A+ Q D  +  +FNK +   +     +    R
Sbjct: 159 ----DDPMDAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKAR 214

Query: 252 KKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGI 311
           K V+  RL++D  R  L+                              N KP        
Sbjct: 215 KDVQSKRLQYDVARTNLQ------------------------------NAKP-------- 236

Query: 312 GSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKC 371
                E++   R+ +E  ED+F   T DA   M ++  S N    +K     QL Y+++ 
Sbjct: 237 -----EKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQS 291

Query: 372 VQ 373
            +
Sbjct: 292 AK 293

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 99/218 (45%), Gaps = 24/218 (11%)

Query: 49  TMLSLRTRKHQL-QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYD 107
           T+ S+    H++ QE LG I DIS++P  Y  +E++ D    +    L V++ +E + YD
Sbjct: 51  TLPSIAQTTHRMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYD 110

Query: 108 YPPNLAESISDWWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAI 167
           YP +++ES+++   + +   G      K +  +                   P +   A+
Sbjct: 111 YPQHVSESVNEISKTVT---GKIQELTKATSTEEAQNILISPGPAKD-----PKTLNYAL 162

Query: 168 SKAADDSITILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQF 227
           SK +         L   + ++ S        D +    IL  +++ Q+ I +A+ Q D  
Sbjct: 163 SKVS---------LTSSEYLSKSGS------DSNVTADILLKYSDIQAQIAQARLQQDML 207

Query: 228 MINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLR 265
           +   FNK+L   +NN+F      RK+V+  RL++D  R
Sbjct: 208 IRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 125/321 (38%), Gaps = 72/321 (22%)

Query: 60  LQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDW 119
           +QE LG + DIS+LP  Y  LE+K D+ + +    L V+  +E + YDYP  + +S++D+
Sbjct: 44  VQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVNDF 103

Query: 120 WGSSSKK--DGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYI--PPSFAQAISKAADDSI 175
             + + K  D        +++N                 G I  P +   A+SK +    
Sbjct: 104 SKTMAAKITDLSHASSASEAQN------------ILISPGPIRDPKTLNYALSKVS---- 147

Query: 176 TILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKK 235
                L   +++N       E     +L   L  ++  QS I +A+ Q D  +  +FNK 
Sbjct: 148 -----LTASEVINQVGSTPNE----SALSSKLLEFSNVQSKIAQARLQQDTLIQTKFNKA 198

Query: 236 LDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDK 295
           L   ++    K    RK+V+  RL++D  R  L                           
Sbjct: 199 LRDDLSTSLAKANKFRKEVQNKRLQYDVARTNLM-------------------------- 232

Query: 296 ENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLST 355
               N KP             E++   R+ +E  EDEF   T +A   M ++    +  T
Sbjct: 233 ----NAKP-------------EKEASLRVKMESLEDEFAQATENATLVMQEVIAGSDFLT 275

Query: 356 LVKLFHNFQLIYHKKCVQELQ 376
            +      QL Y +   Q LQ
Sbjct: 276 SLNQMVAAQLEYFQTSAQLLQ 296

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 131/331 (39%), Gaps = 77/331 (23%)

Query: 60  LQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDW 119
           +QE LG + DIS+LP  Y  LER+ D  + V    L ++  +E + YDYP  +++S++D+
Sbjct: 43  VQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDF 102

Query: 120 WGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYI--PPSFAQAISKAADDSITI 177
                        F  K                    G    P +   A+SK A +S   
Sbjct: 103 SK----------VFANKVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNSSES 152

Query: 178 LKELNEEQLVNPSNGAETEDEDVDSLMPILEA---WAEAQSNIDEAKQQMDQFMINEFNK 234
           L      QL +P+ G            P+ +A   +++ Q+ I + +   D  +  +FNK
Sbjct: 153 LA-----QLADPNEG------------PVADALLKFSDVQAKIAQTRLHQDTLIQTKFNK 195

Query: 235 KLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKD 294
           +L   +  D  K    RK V+  RL++D  R +L   K                      
Sbjct: 196 QLREKLELDIGKASKARKDVQYKRLQYDVARSKLTQAKP--------------------- 234

Query: 295 KENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQ-ITDSVNL 353
                                 E++   R+ +E  E++F  +T DA   M + I DS  L
Sbjct: 235 ----------------------EKEASLRVEMESLEEQFAQSTEDATIIMQEVIADSKFL 272

Query: 354 STLVKLFHNFQLIYHKKCVQELQASLNVINT 384
           S+L +L    QL Y +   Q L+  + V+++
Sbjct: 273 SSLKELAEA-QLSYFETSAQLLKEFMPVLDS 302

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 97/219 (44%), Gaps = 30/219 (13%)

Query: 54  RTRKHQLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLA 113
           ++ +  +QE LG + DIS+LP  Y  LE K D  + + +  L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 114 ESISDWWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYI--PPSFAQAISKAA 171
           ES++++  S + K          S+                  G I  P +   A+SK A
Sbjct: 93  ESVNEFSSSLASKLTELTHATSASQ----------AQNILVAPGPIKEPKTLNYALSKVA 142

Query: 172 DDSITILKEL--NEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMI 229
            +S   L ++   EEQ +  S                L  +++ Q+ I +A+ Q D  + 
Sbjct: 143 LNSSECLNKMFPTEEQPLASS----------------LLQFSDVQAKIAQARIQQDTLIQ 186

Query: 230 NEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYEL 268
            +FNKKL   V+ +  K    RK+V   RL++D  R  L
Sbjct: 187 TKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVARTNL 225

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/321 (22%), Positives = 125/321 (38%), Gaps = 75/321 (23%)

Query: 60  LQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDW 119
           ++E LG + DIS LP  Y  LE K D ++ V    L ++  +E + YDYP   +ES++++
Sbjct: 39  VKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVNEF 98

Query: 120 WGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILK 179
             S   K    + F      +                G  P +   A+SK +  +    +
Sbjct: 99  TDSIGNK---MYEFSNGVSTE-------------GSSGKTPRTLNYAVSKVSMGASEQFQ 142

Query: 180 ELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSL 239
           +L+           +T+D+ + +L   L     A+++I EA+   D  +  +FN +L   
Sbjct: 143 KLH-----------DTDDKRIANL---LTNVGNAEASIAEARLLQDHSIQAKFNFQLREE 188

Query: 240 VNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENED 299
           +     +    RK+V   RLK+D  R +                                
Sbjct: 189 IAQSIERASKYRKEVYHKRLKYDIAREKY------------------------------- 217

Query: 300 NLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKL 359
                         S  E++   ++ LE  EDEF   T DA+  M +I  +      +K 
Sbjct: 218 --------------SKHEKNGTVKVELEILEDEFNHATKDAIMVMQEIISNNRFEQNLKD 263

Query: 360 FHNFQLIYHKKCVQELQASLN 380
           F   +L YH+K V  L+  L+
Sbjct: 264 FAAAKLAYHEKSVDALRNLLD 284

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 117/305 (38%), Gaps = 72/305 (23%)

Query: 54  RTRKHQLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLA 113
           ++ +  +QE LG + DIS+LP  Y  LE K D  + + +  L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 114 ESISDWWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYI--PPSFAQAISKAA 171
           ES++++  S + K          S+                  G I  P +   A+SK A
Sbjct: 93  ESVNEFSRSVASKLTELTHATSASE----------AQNILVAPGPIKEPKTLNYALSKVA 142

Query: 172 DDSITILKEL--NEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMI 229
            +S   L ++   EEQ                 L   L  +++ Q+ I +A+ Q D  + 
Sbjct: 143 LNSSECLNKMLPTEEQ----------------PLASALLQFSDVQAKIAQARIQQDTLIQ 186

Query: 230 NEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQ 289
            +FNK L   ++ +  K    RK V   RL++D  R  L                     
Sbjct: 187 TKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVARTNL--------------------- 225

Query: 290 VNDKDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITD 349
            N+K  E E +L                     R+ +E  ED+F   T DA   + ++  
Sbjct: 226 ANNKKPEKEASL---------------------RVQMETLEDQFAQVTEDATVCLQEVIS 264

Query: 350 SVNLS 354
             N S
Sbjct: 265 HANFS 269

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 121/316 (38%), Gaps = 67/316 (21%)

Query: 54  RTRKHQLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLA 113
           ++ +  +QE LG + DIS+LP  Y  LE K D+ +++    L VS  +E   YDYP    
Sbjct: 38  QSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAK 97

Query: 114 ESISDWWGSSSKK--DGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAA 171
           ES+ ++  +++ K  +        +++N                    P +   A+SK A
Sbjct: 98  ESLIEFSKTAASKVEELSHASSAHEAQNILTTSSTQIKE---------PKTLNFALSKVA 148

Query: 172 DDSITILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINE 231
             S   L + N+ +    S  A             L  ++  Q+ I +A+ Q D  +  +
Sbjct: 149 LKSSEHLNQFNDNEAFKSSASA-------------LLNFSNIQAKIAQARLQQDLLIKQK 195

Query: 232 FNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVN 291
           FN  L   +  +  K   +RK+V+  RL++D  R  L                       
Sbjct: 196 FNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLM---------------------- 233

Query: 292 DKDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSV 351
                   N KP             E++   R+ +E  ED+F   T  A   M  + D+ 
Sbjct: 234 --------NAKP-------------EKEASLRVQMETLEDDFAQATEHATIVMQDVIDNS 272

Query: 352 NLSTLVKLFHNFQLIY 367
           ++ + V      QL Y
Sbjct: 273 DIVSRVNELARAQLAY 288

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 121/318 (38%), Gaps = 72/318 (22%)

Query: 54  RTRKHQLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLA 113
           ++ +  +QE LG + DIS+LP  Y  LE K D  + + +  L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 114 ESISDWWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYI--PPSFAQAISKAA 171
           ES++++  S + K          S+                  G I  P +   A+SK A
Sbjct: 93  ESVNEFSRSVASKLTELTHATSASE----------AQNILVAPGPIKEPKTLNYALSKVA 142

Query: 172 DDSITILKEL--NEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMI 229
            +S   L ++   EEQ                 L   L  +++ Q+ I +A+ Q D  + 
Sbjct: 143 LNSSECLNKMFPTEEQ----------------PLASALLQFSDVQAKIAQARIQQDTLIQ 186

Query: 230 NEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQ 289
            +FNK L   ++ +  K    RK V   RL++D  R  L                     
Sbjct: 187 TKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNL--------------------- 225

Query: 290 VNDKDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITD 349
            N+K  E E +L                     R+ +E  ED+F   T DA   + ++  
Sbjct: 226 ANNKKPEKEASL---------------------RVQMETLEDQFAQVTEDATVCLQEVIS 264

Query: 350 SVNLSTLVKLFHNFQLIY 367
             N S  +K     Q  Y
Sbjct: 265 HANFSEDLKELAKAQAEY 282

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 115/300 (38%), Gaps = 68/300 (22%)

Query: 57  KHQLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESI 116
           +  +QE LG + DIS+LP  Y  LE K D  + + +  L V+  +E   YDYP  + ES+
Sbjct: 36  QRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESV 95

Query: 117 SDWWGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYI--PPSFAQAISKAADDS 174
           +++  S + K          S+                  G I  P +   A+SK +   
Sbjct: 96  NEFSRSVASKLTELTHATSASE----------AQNILVAPGPIKEPKTLNYALSKVS--- 142

Query: 175 ITILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNK 234
                 LN  + +N    AE +      L   L  +++ Q+ I + + Q D  +  +FNK
Sbjct: 143 ------LNSSECLNKMFPAEEQ-----PLASALLQFSDVQAKIAQTRIQQDTLIQTKFNK 191

Query: 235 KLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKD 294
           KL   ++ +  K    RK V   RL++D  R  L                      N+K 
Sbjct: 192 KLRERLSFEIGKADKCRKDVHSMRLRYDVARTNL---------------------ANNKK 230

Query: 295 KENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLS 354
            E E +L                     R+ +E  ED+F   T DA   + ++    N S
Sbjct: 231 PEKEASL---------------------RVQMETLEDKFAQVTEDATVCLQEVISHANFS 269

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 123/337 (36%), Gaps = 81/337 (24%)

Query: 60  LQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDW 119
           ++E LG  KDIS LP  Y  LE K D  +++    L V+  +E + YDYP    ES  ++
Sbjct: 39  MKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESFWEF 98

Query: 120 WGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKA---ADDSIT 176
             S  +K   F        N+                  IP +   A+      A++ + 
Sbjct: 99  TDSVGEK---FSALNISEHNNKVK---------------IPKTLNYALHNVFLTANEKVK 140

Query: 177 ILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKL 236
           +L E        P +         +SL   L + +E +++I EA+   D  + +  N +L
Sbjct: 141 LLHE--------PLD---------NSLSETLASLSETEADIAEARLHQDSLVKSRINYQL 183

Query: 237 DSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKE 296
              ++ +F +    RK V   R  +D  +   E  K       E   T+ +Q        
Sbjct: 184 KEELSQNFERAAKYRKAVHHKRFNYDVAKTNFEHAKP------EKQATLSAQA------- 230

Query: 297 NEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTL 356
             D LK                            DEF   T DA   M +I  +  L  +
Sbjct: 231 --DILK----------------------------DEFEQATKDATIVMQEIISNSRLEHI 260

Query: 357 VKLFHNFQLIYHKKCVQELQASLNVINTLTVEEDGEE 393
           +K     QL+YH++    L   L+  N    E +  E
Sbjct: 261 LKELAVSQLVYHQRSTDLLNKFLDAQNDAITERERRE 297

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 77/335 (22%), Positives = 133/335 (39%), Gaps = 73/335 (21%)

Query: 60  LQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDW 119
           +QE  G + DIS LP  Y  LE++ D+ + V    L ++  +E + YDYP ++ +SI+++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 120 W-GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYI-------PPSFAQAISKAA 171
              +SS+   +       S N                 G I       P +   A+SKAA
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKAA 120

Query: 172 DDSITILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINE 231
                         L      AE    D DS   +  +++EA+S I + + + D+ +   
Sbjct: 121 --------------LF----AAEQLKMDKDSST-VFHSFSEAESIISDERIKQDKIIQKS 161

Query: 232 FNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVN 291
           FN +L +++ N        RK V+  RL++D  R +L+     AS+ KE+          
Sbjct: 162 FNTELKNVLTNRIDVANKHRKDVQNKRLQYDISRTKLD----HASEDKES---------- 207

Query: 292 DKDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSV 351
                                          R+ +E+ +  F  +  DA+  M ++    
Sbjct: 208 -----------------------------SLRVAMEQHKQAFEQSIDDAIIMMHEVISHS 238

Query: 352 NLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLT 386
           N  T +      QL YH++  + LQ   + I T+T
Sbjct: 239 NFITNLNELAMAQLEYHERSFKALQ---DFITTMT 270

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/324 (20%), Positives = 122/324 (37%), Gaps = 63/324 (19%)

Query: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120
           QE LG I DIS++P  Y  LE + D  +     +L V++ +E   YD+P +  ES+ DW 
Sbjct: 44  QEKLGQITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDW- 102

Query: 121 GSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYIPPSFAQAISKAADDSITILKE 180
                        G + + +                   P +  + ++ A   +   +  
Sbjct: 103 ---------SRAIGSRVQ-ELSRASSASEAGNLLKSPVGPENGPRTLNYALSQASLAVST 152

Query: 181 LNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLV 240
           L    +  P NG        + L   L A+++ Q+ + + +   D  +  +FNK+L  ++
Sbjct: 153 LTSSNMPGP-NG--------EGLSSGLIAYSDTQAKLAQIRIAQDTQVQTKFNKQLREIL 203

Query: 241 NNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDN 300
           NN   K    RK V+  R+ +D  R  L+                              N
Sbjct: 204 NNPIAKANKYRKDVQYKRVLYDIARTNLQ------------------------------N 233

Query: 301 LKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLF 360
            +P             E++   R+ +E  ED+F   T +A   M +   + +L   V   
Sbjct: 234 ARP-------------EKEASLRVEMETLEDQFAQITEEATIVMQETLSNTHLLKNVAEL 280

Query: 361 HNFQLIYHKKCVQELQASLNVINT 384
              Q  Y+K+ ++ +   + V NT
Sbjct: 281 AEIQKNYYKQSLELMNDLMPVFNT 304

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 97/219 (44%), Gaps = 34/219 (15%)

Query: 60  LQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDW 119
           +QE LG + DIS+LP  Y  LE++ D  + V    L ++  ++ + YDYP  +++S++D+
Sbjct: 43  VQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDY 102

Query: 120 WGSSSKKDGVFWGFGKKSKNDXXXXXXXXXXXXXXXXGYI--PPSFAQAISKAADDSITI 177
                        F  K ++                 G I  P +   A+SK A   +T 
Sbjct: 103 SK----------LFQSKIEDLSRATSAEEAQNILVTPGPITEPRTLNYALSKVA---LTS 149

Query: 178 LKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNK--- 234
            + LN+ Q           D +V ++   L  +++ Q+ I + + Q D  +  + NK   
Sbjct: 150 SESLNQLQ-----------DPNVSAVASTLLKFSDMQTKIAQQRLQQDTLIQTKVNKVIK 198

Query: 235 -KLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRK 272
            KL SL+     K    R+ V+  RL++D  R +L   K
Sbjct: 199 EKLSSLIE----KATKSRRDVQYKRLQYDVARSKLAQAK 233

>NDAI0C03050 Chr3 (693899..696091) [2193 bp, 730 aa] {ON} Anc_5.161
          Length = 730

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 33/64 (51%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ S       +  +++ E Q+Q+ H +  I+ ++P T L     + +L + +  + D
Sbjct: 56  LDKVYSFCKVKHGEVVRRVKEVQQQVQHTVRQIDSNNPPTELDFEILEEELSDVIADVYD 115

Query: 70  ISKL 73
           ++K 
Sbjct: 116 LAKF 119

>Suva_12.65 Chr12 complement(93503..95665) [2163 bp, 720 aa] {ON}
           YJL012C (REAL)
          Length = 720

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 33/64 (51%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ +       +  +++ E QEQ+ H +  ++ ++P T L     + +L + +  + D
Sbjct: 56  LDKVYTFCKVKHSEVYRRVKEVQEQVQHTVRLLDSNNPPTQLDFEILEEELSDIIADVHD 115

Query: 70  ISKL 73
           ++K 
Sbjct: 116 LAKF 119

>TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8.517
           YPL058C
          Length = 1516

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 51/103 (49%), Gaps = 10/103 (9%)

Query: 221 KQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVE--ESRLKFDTLRYELEMRKSGA--- 275
           K++MD F +N+ +  L +L+N  +L+ R L + +E  +S + F  L   + +  S A   
Sbjct: 80  KKEMDAFEVNDLDFDLRALLN--YLRSRQLEQGIEPGDSGVAFKNLT-AVGIDASAAYGP 136

Query: 276 --SQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSSSD 316
              +    FT I  + +N   K N+  ++  I N TGI  S +
Sbjct: 137 SVEEMVRNFTNIPHRILNKFRKTNDTPMRNIIQNCTGIIESGE 179

>Kpol_1018.157 s1018 complement(403373..407017) [3645 bp, 1214 aa]
           {ON} complement(403373..407017) [3645 nt, 1215 aa]
          Length = 1214

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 74/183 (40%), Gaps = 38/183 (20%)

Query: 205 PILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSL---VNNDFLKVRALRKKVEESRLKF 261
           P+LE++  A++  +    +  +++   FN + +     + N  L+ + +  +++E R   
Sbjct: 169 PLLESFGCAKTLRNNNSSRHGKYLEIRFNNQFEPCAGNITNYLLEKQRVVSQIKEER--- 225

Query: 262 DTLRYELEMRKSGASQTKETFTTIESQQ-------------VNDKDKENEDNLKPTIHNN 308
                  +  K  +   ++TF   + +Q               D  K+ ED LK      
Sbjct: 226 -NFHIFYQFTKGASENYRQTFGVQKPEQYIYTSAAGCTSVDTIDDVKDYEDTLKAM---- 280

Query: 309 TGIGSSSDEEDQKFRLL---LEKAEDEFVSN-----------TTDAVAYMTQITDSVNLS 354
             IG S DE+DQ FR+L   L      FV N            TD VAY+ QI   V + 
Sbjct: 281 QVIGLSQDEQDQIFRMLSSILWVGNISFVENEEGNAQVRDTSVTDFVAYLLQIDSQVLMK 340

Query: 355 TLV 357
            LV
Sbjct: 341 ALV 343

>Skud_10.205 Chr10 complement(378631..380796) [2166 bp, 721 aa] {ON}
           YJL012C (REAL)
          Length = 721

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 33/64 (51%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ +       +  +++ E QEQ+ H +  ++ ++P T L     + +L + +  + D
Sbjct: 56  LDKVYTFCKVKHSEVFRRVKEVQEQVQHTVRLLDSNNPPTQLDFEILEEELSDIIADVHD 115

Query: 70  ISKL 73
           ++K 
Sbjct: 116 LAKF 119

>YJL012C Chr10 complement(411234..413399) [2166 bp, 721 aa] {ON}
           VTC4Vacuolar membrane polyphosphate polymerase; subunit
           of the vacuolar transporter chaperone (VTC) complex
           involved in synthesis and transfer of polyP to the
           vacuole; regulates membrane trafficking; role in
           non-autophagic vacuolar fusion
          Length = 721

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 33/64 (51%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ +       +  +++ E QEQ+ H +  ++ ++P T L     + +L + +  + D
Sbjct: 56  LDKVYTFCKVKHSEVFRRVKEVQEQVQHTVRLLDSNNPPTQLDFEILEEELSDIIADVHD 115

Query: 70  ISKL 73
           ++K 
Sbjct: 116 LAKF 119

>Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa]
           {ON} YPL058C (REAL)
          Length = 1513

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 10/103 (9%)

Query: 221 KQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVE--ESRLKFDTLRYELEMRKSGA--- 275
           K++MD F IN+ +  L SL+N  +L+ R L + +E  +S + F  L   + +  S A   
Sbjct: 78  KKEMDSFEINDLDFDLRSLLN--YLRSRQLEQGIEPGDSGVAFKNLT-AVGVDASAAYGP 134

Query: 276 --SQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSSSD 316
             ++   +  TI +  ++   K+++  L+  I N TG+  S +
Sbjct: 135 SVAEMLRSIATIPAHLISKFTKKSDVPLRNIIQNCTGVVESGE 177

>TPHA0G02880 Chr7 complement(612962..616174) [3213 bp, 1070 aa] {ON}
           
          Length = 1070

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 14/61 (22%)

Query: 311 IGSSSDEEDQKFRLL---LEKAEDEFVSN-----------TTDAVAYMTQITDSVNLSTL 356
           IG S DE+DQ FR+L   L      FV N            TD VAY+ QI  S+ +  L
Sbjct: 172 IGLSQDEQDQIFRMLAFILWIGNISFVENEEGNAQVRDTSVTDFVAYLLQIDASILIKGL 231

Query: 357 V 357
           V
Sbjct: 232 V 232

>TPHA0G02430 Chr7 complement(493879..497424) [3546 bp, 1181 aa] {ON}
           Anc_2.440 YMR109W
          Length = 1181

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 14/61 (22%)

Query: 311 IGSSSDEEDQKFRLL---LEKAEDEFVSN-----------TTDAVAYMTQITDSVNLSTL 356
           IG S DE+DQ FR+L   L      FV N            TD VAY+ QI  S+ +  L
Sbjct: 283 IGLSQDEQDQIFRMLASILWIGNISFVENEEGNAQVRDTSVTDFVAYLLQIDASILIKGL 342

Query: 357 V 357
           V
Sbjct: 343 V 343

>TDEL0E04690 Chr5 complement(879084..881252) [2169 bp, 722 aa] {ON}
           Anc_5.161 YJL012C
          Length = 722

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 32/64 (50%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ +       +  +++ E Q Q+ H + S++ + P T L     + +L + +  + D
Sbjct: 56  LDKVYTFCKVKHGEVVRRVEEAQAQVQHTVRSLDSNMPATELDFDMLEEELSDIIADVHD 115

Query: 70  ISKL 73
           I+K 
Sbjct: 116 IAKF 119

>KLLA0F22627g Chr6 complement(2112336..2114525) [2190 bp, 729 aa]
           {ON} highly similar to uniprot|P47075 Saccharomyces
           cerevisiae YJL012C VTC4 Phosphate metabolism
           transcription is regulated by PHO system polyphosphate
           synthetase (putative)
          Length = 729

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 36/64 (56%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ +      ++  +++ + QEQ++ A+ S++ + P T L  +  + +L + +  + D
Sbjct: 57  LDKVYTFCKVKHNEVVRRIKQAQEQVSVAVRSLDTNVPVTDLDFQILEEELSDIIADVHD 116

Query: 70  ISKL 73
           ++K 
Sbjct: 117 LAKF 120

>Smik_10.257 Chr10 complement(407331..409496) [2166 bp, 721 aa] {ON}
           YJL012C (REAL)
          Length = 721

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/64 (20%), Positives = 33/64 (51%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ +       +  +++ E QE++ H +  ++ ++P T L     + +L + +  + D
Sbjct: 56  LDKVYTFCKVKHSEVFRRVKEVQEEVQHTVRLLDSNNPPTQLDFEILEEELSDIIADVHD 115

Query: 70  ISKL 73
           ++K 
Sbjct: 116 LAKF 119

>CAGL0G06952g Chr7 complement(663828..665981) [2154 bp, 717 aa] {ON}
           similar to uniprot|P47075 Saccharomyces cerevisiae
           YJL012c VTC4
          Length = 717

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 33/64 (51%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ S       +  +++ E QEQ++  +  I+ ++P + L     + +L + +  + D
Sbjct: 56  LDKVYSFCRVKQSELSRRVKEVQEQVSKTVRLIDSNNPPSELDFEILEEELSDVIADVHD 115

Query: 70  ISKL 73
           ++K 
Sbjct: 116 LAKF 119

>Ecym_5112 Chr5 complement(243053..246019) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AFR133C
          Length = 988

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 35/81 (43%)

Query: 261 FDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSSSDEEDQ 320
           FD    EL  RK G+  TK+T  T    Q ++    N   LK +   +     S+  ED+
Sbjct: 531 FDVDEPELPSRKEGSKNTKKTVETPLWFQSHNDPSSNNHYLKDSFVKDKVANPSAITEDE 590

Query: 321 KFRLLLEKAEDEFVSNTTDAV 341
           KFRL       E +   T+ V
Sbjct: 591 KFRLYTGHRARELIEEVTNPV 611

>TBLA0B09040 Chr2 (2146155..2149883) [3729 bp, 1242 aa] {ON}
           Anc_2.440 YMR109W
          Length = 1242

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 14/61 (22%)

Query: 311 IGSSSDEEDQKFRLL---LEKAEDEFVSN-----------TTDAVAYMTQITDSVNLSTL 356
           IG S DE+DQ FR+L   L      FV N            TD VAY+ Q+   V + +L
Sbjct: 285 IGLSQDEQDQIFRMLSAILWIGNITFVENDEGNAQVADSSVTDFVAYLLQVDAGVLVKSL 344

Query: 357 V 357
           V
Sbjct: 345 V 345

>YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}
           PDR12Plasma membrane ATP-binding cassette (ABC)
           transporter, weak-acid-inducible multidrug transporter
           required for weak organic acid resistance; induced by
           sorbate and benzoate and regulated by War1p; mutants
           exhibit sorbate hypersensitivity
          Length = 1511

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 59/116 (50%), Gaps = 10/116 (8%)

Query: 207 LEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVE--ESRLKFDTL 264
           LE+ A   S+  + K++MD F IN+ +  L SL++  +L+ R L + +E  +S + F  L
Sbjct: 64  LESMARVISH--KTKKEMDSFEINDLDFDLRSLLH--YLRSRQLEQGIEPGDSGIAFKNL 119

Query: 265 -RYELEMRKSGASQTKETF---TTIESQQVNDKDKENEDNLKPTIHNNTGIGSSSD 316
               ++   +     +E F    +I +  ++   K+++  L+  I N TG+  S +
Sbjct: 120 TAVGVDASAAYGPSVEEMFRNIASIPAHLISKFTKKSDVPLRNIIQNCTGVVESGE 175

>Kpol_1060.44 s1060 (106337..108502) [2166 bp, 721 aa] {ON}
           (106337..108502) [2166 nt, 722 aa]
          Length = 721

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/64 (18%), Positives = 34/64 (53%)

Query: 10  LDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETLGTIKD 69
           LDK+ S       +  +++ + Q+Q+ H + +++ ++P + L     + +L + +  + D
Sbjct: 56  LDKVYSFCKVKQSEVVRRVKDAQDQVRHTVRALDSNNPPSELDFDILEEELSDIIADVHD 115

Query: 70  ISKL 73
           ++K 
Sbjct: 116 LAKF 119

>NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {ON}
           
          Length = 1512

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 221 KQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVE--ESRLKFDTL-RYELEMRKSGASQ 277
           K++MD+F +NE +  L SL+N  +L+ R L + +E  +S + F  L    ++   +    
Sbjct: 77  KKEMDKFEVNELDFDLRSLLN--YLRSRQLEQGIEPGDSGVAFRNLTSIGVDASAAYGPS 134

Query: 278 TKETFTTI---ESQQVNDKDKENEDNLKPTIHNNTGIGSSSD 316
            +E    I    +  +N   K+ +  L+  I N TG+  S +
Sbjct: 135 VEEMLRDIGNLPAHLLNVFKKKGDVPLRKIIQNCTGVVESGE 176

>YOR320C Chr15 complement(913619..915094) [1476 bp, 491 aa] {ON}
           GNT1N-acetylglucosaminyltransferase capable of
           modification of N-linked glycans in the Golgi apparatus
          Length = 491

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 15/132 (11%)

Query: 178 LKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLD 237
           LK  +   ++NPS   E  DE V+ ++P           I   K++ D  +INE    L 
Sbjct: 311 LKFASNLMVINPSK--EAFDEIVNVMLP----------KILNKKEKYDMDLINEEMYNLK 358

Query: 238 SLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDKEN 297
            ++   F+  R +RK  +   L     RY L    +G+ +    ++ I +  +  K  +N
Sbjct: 359 KIIYKQFIFFRKVRKLFKPEVLVLPFARYGL---LTGSLRNPRHYSIIYNDVLGYKTLDN 415

Query: 298 EDNLKPTIHNNT 309
           + N  P   N++
Sbjct: 416 DGNDIPVGLNDS 427

>Smik_7.354 Chr7 complement(587094..587408) [315 bp, 105 aa] {ON}
           YFR035C (REAL)
          Length = 105

 Score = 28.9 bits (63), Expect = 9.1,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 6/98 (6%)

Query: 272 KSGASQTKETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEK-AE 330
           KSG S+T  T T + +  + ++D+E   +L      N  + + S+ +   F+ LL   AE
Sbjct: 11  KSGISKTSRTTTFVITPNLRERDEEGASSLY-----NAFLNTFSNLKSGMFKCLLGMGAE 65

Query: 331 DEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYH 368
             F+S     +  +     SV +  +   F N   + H
Sbjct: 66  GTFISEFLQQLFCLQPCLVSVRVCGIASFFFNLSSLLH 103

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,397,373
Number of extensions: 1937585
Number of successful extensions: 9970
Number of sequences better than 10.0: 386
Number of HSP's gapped: 10427
Number of HSP's successfully gapped: 438
Length of query: 393
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 281
Effective length of database: 40,638,807
Effective search space: 11419504767
Effective search space used: 11419504767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)