Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12373.492ON72772731270.0
SAKL0F02772g3.492ON7732954832e-50
KLTH0F14828g3.492ON8362864339e-44
Kwal_55.212293.492ON7872834241e-42
AFR310C3.492ON6232933693e-36
KLLA0D16236g3.492ON8712973548e-34
Smik_6.2263.492ON8393113539e-34
YGR130C3.492ON8162963474e-33
Skud_7.4413.492ON8073053403e-32
Suva_7.4183.492ON8313053201e-29
Kpol_480.143.492ON6992982781e-24
CAGL0I10516g3.492ON8132632655e-23
TDEL0D056003.492ON7002572557e-22
ZYRO0D09988g3.492ON9942862201e-17
NCAS0E008103.492ON6922702057e-16
TPHA0D042503.492ON6292641967e-15
NDAI0G009403.492ON6562631798e-13
KNAG0B008103.492ON7572191352e-07
KAFR0C019603.492ON5631841102e-04
TBLA0C044803.492ON802991056e-04
KAFR0G036903.492ON363124950.007
CAGL0D04994g3.479ON692102870.079
AER045C4.238ON1292104840.20
TDEL0F042208.295ON490995790.90
NCAS0F035503.492ON441102742.6
KNAG0H035002.159ON634109742.6
NCAS0B018008.604ON791304733.9
Kpol_392.88.259ON1427102734.2
ZYRO0E06666g2.582ON103070709.0
SAKL0H08294g8.609ON46263699.3
NOTE: 2 genes in the same pillar as Ecym_1237 were not hit in these BLAST results
LIST: NDAI0B05860 KNAG0A07940

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1237
         (727 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...  1209   0.0  
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   190   2e-50
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   171   9e-44
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   167   1e-42
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...   146   3e-36
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   140   8e-34
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   140   9e-34
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   138   4e-33
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   135   3e-32
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   127   1e-29
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   111   1e-24
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   106   5e-23
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   102   7e-22
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    89   1e-17
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    84   7e-16
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    80   7e-15
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    74   8e-13
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    57   2e-07
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    47   2e-04
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    45   6e-04
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    41   0.007
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    38   0.079
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    37   0.20 
TDEL0F04220 Chr6 complement(778175..792904) [14730 bp, 4909 aa] ...    35   0.90 
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    33   2.6  
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    33   2.6  
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    33   3.9  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...    33   4.2  
ZYRO0E06666g Chr5 complement(501139..504231) [3093 bp, 1030 aa] ...    32   9.0  
SAKL0H08294g Chr8 (713096..714484) [1389 bp, 462 aa] {ON} simila...    31   9.3  

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 1209 bits (3127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/727 (84%), Positives = 616/727 (84%)

Query: 1   MSSIFKKNKQPDPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSP 60
           MSSIFKKNKQPDPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSP
Sbjct: 1   MSSIFKKNKQPDPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSP 60

Query: 61  FRDDKAVAEAERIRDLKFPTTGHHSTVRVKDNVKRKAQDIAEPRSFGTTDLKQQKQLDEL 120
           FRDDKAVAEAERIRDLKFPTTGHHSTVRVKDNVKRKAQDIAEPRSFGTTDLKQQKQLDEL
Sbjct: 61  FRDDKAVAEAERIRDLKFPTTGHHSTVRVKDNVKRKAQDIAEPRSFGTTDLKQQKQLDEL 120

Query: 121 GMKENQLEYLRNSQKIVDVRXXXXXXXXXXXXXXXXATSALSGEGAMPVSAASDGXXXXX 180
           GMKENQLEYLRNSQKIVDVR                ATSALSGEGAMPVSAASDG     
Sbjct: 121 GMKENQLEYLRNSQKIVDVRKSSVGKGSEVGSVGEEATSALSGEGAMPVSAASDGKSFAS 180

Query: 181 XXXXXXXXXXXXXXXXXIRSAGNLEEGSAVGQDTRELASGTALDERSEISEAPTKVSGLK 240
                            IRSAGNLEEGSAVGQDTRELASGTALDERSEISEAPTKVSGLK
Sbjct: 181 DMKADKKSDVKSDVKSDIRSAGNLEEGSAVGQDTRELASGTALDERSEISEAPTKVSGLK 240

Query: 241 SAVSDGGQTXXXXXXXXXXXXXXXXKSGVSEGKXXXXXXXXXXXXXSDVPPTKQKGHRGP 300
           SAVSDGGQT                KSGVSEGK             SDVPPTKQKGHRGP
Sbjct: 241 SAVSDGGQTASSVAGEAGGASVAEVKSGVSEGKAGVVNAGNAAAVASDVPPTKQKGHRGP 300

Query: 301 FKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQEKLAS 360
           FKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQEKLAS
Sbjct: 301 FKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQEKLAS 360

Query: 361 LDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQ 420
           LDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQ
Sbjct: 361 LDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQ 420

Query: 421 AKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQSEV 480
           AKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEP                QQYQSEV
Sbjct: 421 AKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEV 480

Query: 481 QALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLE 540
           QALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLE
Sbjct: 481 QALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLE 540

Query: 541 NHPSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKEPTLSAVNPPKMVEEIDVQE 600
           NHPSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKEPTLSAVNPPKMVEEIDVQE
Sbjct: 541 NHPSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKEPTLSAVNPPKMVEEIDVQE 600

Query: 601 ISELPDDVIVPEELDRLLHSSKQKPLGNPFTSHDGDSLDFTHVPASAKADNGEVKISLDP 660
           ISELPDDVIVPEELDRLLHSSKQKPLGNPFTSHDGDSLDFTHVPASAKADNGEVKISLDP
Sbjct: 601 ISELPDDVIVPEELDRLLHSSKQKPLGNPFTSHDGDSLDFTHVPASAKADNGEVKISLDP 660

Query: 661 NAESKKPVXXXXXXXXXXXXXXIATTSPGTAKGNSXXXXXXXXXXXXXXGDGTRSDSSRL 720
           NAESKKPV              IATTSPGTAKGNS              GDGTRSDSSRL
Sbjct: 661 NAESKKPVNLSSLSSRPRNPPSIATTSPGTAKGNSEYEYETIEEVVIVEGDGTRSDSSRL 720

Query: 721 IAVPLEQ 727
           IAVPLEQ
Sbjct: 721 IAVPLEQ 727

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 105/295 (35%), Positives = 185/295 (62%), Gaps = 4/295 (1%)

Query: 290 PPTKQKGHRGPFKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEY 349
           P    K  R PFK +K G+FALW RS+K ++  ATP+DPE+IV T+KGYMSK IYD+LEY
Sbjct: 320 PIDPNKAPRVPFK-AKTGVFALWTRSDKQDQPLATPQDPEYIVRTDKGYMSKAIYDKLEY 378

Query: 350 EEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIE 409
           +E++HQ +LA+ ++  A KY+ T + Y +KL  L ++I E+ A M+QL+  T+ ++K  E
Sbjct: 379 DEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSE 438

Query: 410 ASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXXXX 469
           + LS+ ++D+ A H   K  + KE EN K  KI E++ I  K  +V+             
Sbjct: 439 SELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEELNVLKKQV 498

Query: 470 XXXXQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVV 529
                +YQ+++  LTA+LD+++ ++Q ++D+Q E+   +A L +++++IE +  ++  + 
Sbjct: 499 DAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRDAEELH 558

Query: 530 ANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581
             +  +L++++N    P I A+D+QV+ +  +++ ++QE+A QK E   ++ + E
Sbjct: 559 KESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAITKRLE 613

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 83/146 (56%), Gaps = 19/146 (13%)

Query: 3   SIFKKNKQPDPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSPFR 62
           SIFKK +Q DPF  LL  E+ +      F++KV  ++K  E            +Y SPFR
Sbjct: 2   SIFKKKQQVDPFAHLLQPEQPQEQPN--FLRKVVTNKKKEE---------EEKDYSSPFR 50

Query: 63  DDKAVAEAERIRDLKFPTTGHHSTV--------RVKDNVKRKAQDIAEPRSFGTTDLKQQ 114
             + +  A+ ++  KFPT    S          +V D+ KR+A+DI+ PR    TD KQ+
Sbjct: 51  SQQELIAAKNVKAKKFPTVSATSGTASAADLGYKVIDSAKRRAKDISVPRYLKNTDEKQR 110

Query: 115 KQLDELGMKENQLEYLRNSQKIVDVR 140
           K+LD+L  KEN L+YL++SQKIVDVR
Sbjct: 111 KKLDKLEFKENHLQYLKDSQKIVDVR 136

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  171 bits (433), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 165/286 (57%), Gaps = 12/286 (4%)

Query: 298 RGPFKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQEK 357
           R PF     GIFALW RS+K  +  A+P DPEFIV  +KGYMSK +YD LEYEE +H+ +
Sbjct: 356 RVPFA---TGIFALWTRSDKRGQPVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKRE 412

Query: 358 LASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLM 417
           +    +   AKYE  A  YE++L SL ++IAE+ A M+ L+  T  +++  EA LS  ++
Sbjct: 413 MDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMI 472

Query: 418 DIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQ 477
           D+ A+H   K  + KE EN K AK+ EK  +  K   V+                 +++Q
Sbjct: 473 DLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQ 532

Query: 478 SEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAV---VANNKE 534
             V  LTAELDA+L  +Q ++ +Q E+  S+  L++++  +   ISE+NA      +N  
Sbjct: 533 GRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDAL---ISEANAADEQHGSNVA 589

Query: 535 LLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELS 577
           +L+++EN    P + A+D ++SE+  +++ V+QE A  K E   +S
Sbjct: 590 VLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVS 635

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 23/146 (15%)

Query: 4   IFKKNKQPDPFKELLDNEEDKHGTTEL-FVKKVTNHRKASEDDGTQGNVEGGGEYVSPFR 62
           +FKK +  DP + L    E + G  +  F+ KV +  +                Y SPFR
Sbjct: 1   MFKKRQ--DPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQ------------SAYNSPFR 46

Query: 63  DDKAVAEAERIRDLKFPTTGHHST--------VRVKDNVKRKAQDIAEPRSFGTTDLKQQ 114
             +++A A++ +  KFPT     +         +V D  +R+A+DIA PR     D +Q+
Sbjct: 47  TSQSLAAAQKRKMQKFPTVSASVSAHSSSDMGYKVIDAARRRAKDIAVPRYLQGNDERQR 106

Query: 115 KQLDELGMKENQLEYLRNSQKIVDVR 140
           ++LD+L  KE+ L+Y ++SQ+IVDVR
Sbjct: 107 RRLDKLERKEDALKYKKDSQRIVDVR 132

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  167 bits (424), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 101/283 (35%), Positives = 164/283 (57%), Gaps = 6/283 (2%)

Query: 298 RGPFKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQEK 357
           R PF     GIFALW RS+K  +  A+P+DPEFIV  +KGYMSK +YD LEYEE +H+++
Sbjct: 328 RVPFA---TGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTLEYEEAVHKQE 384

Query: 358 LASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLM 417
           +    + +  KY+  A+ YE+ L SL ++IAE+ A M+QL+  T +++    A LS  ++
Sbjct: 385 MDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMI 444

Query: 418 DIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQ 477
           +  AKH   K  + KE EN K AKI EK  +  K  +V+                 Q+  
Sbjct: 445 ESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELL 504

Query: 478 SEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQ 537
           S +  LT +LD++   +Q ++D+Q E+  S+ ALE+++  +  D + ++ +  +N  +L+
Sbjct: 505 SRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILE 564

Query: 538 NLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELS 577
            + N    P I ALD+Q+S++  +++ V+QE A Q  E   +S
Sbjct: 565 GISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVS 607

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 79/145 (54%), Gaps = 22/145 (15%)

Query: 4   IFKKNKQPDPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSPFRD 63
           +FKK    DPF+ L   ++ K  T++ F++KV       ++D T         Y SPFR 
Sbjct: 1   MFKKKH--DPFEHLFQQDQPKKETSKGFLRKVVTK---EQEDAT---------YSSPFRT 46

Query: 64  DKAVAEAERIRDLKFPTTGHHST--------VRVKDNVKRKAQDIAEPRSFGTTDLKQQK 115
            ++  EA++ +  +FPT    S          +V D  +++A+DIA PR     D +Q++
Sbjct: 47  SQSQVEAQKRKVQRFPTVSASSGGNSSAEMGFKVIDAARKRAKDIAVPRYLQGNDERQRR 106

Query: 116 QLDELGMKENQLEYLRNSQKIVDVR 140
           +LD+L  KE+ L+Y ++SQKIV V+
Sbjct: 107 RLDKLERKEDSLQYKKDSQKIVKVK 131

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score =  146 bits (369), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/293 (30%), Positives = 178/293 (60%), Gaps = 6/293 (2%)

Query: 300 PFKFSKKG-IFALWKRSEKPEKL--NATPEDPEFIVLTEKGYMSKNIYDRLEYEEELHQE 356
           PFK  K G +  L+K  +K + L  N TPE+PE ++LT +GYMSK +YDRL  EE+ H  
Sbjct: 255 PFKLQKGGKLGGLFKHHDKEQLLVPNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLG 314

Query: 357 KLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNL 416
           +L + D+++A  Y+  ++ YE+++A L+ EI+++ A +  L+++TE ++  +EASLS+N+
Sbjct: 315 RLVNSDEDAAQDYQLVSQHYEKEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNI 374

Query: 417 MDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQY 476
            D++A++ +++  L ++AE ++  ++ +K  I  +  +++P                 + 
Sbjct: 375 QDMKAENADKQHVLHEQAEAQRAEQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITEC 434

Query: 477 QSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELL 536
           Q+ +  L  +LDA+  EL+ V+D+Q EV++ +A L+E++ Q+E+++++SN     N+E L
Sbjct: 435 QARIDQLQQQLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREAL 494

Query: 537 QNL---ENHPSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKEPTLSA 586
           + L   +   ++  +D + SE+   ++ + QE   Q+ EL  L  + + T ++
Sbjct: 495 ERLNQTDYTATVREIDAKNSEILTEIAKIRQEIEFQRKELVALKERPQRTAAS 547

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 78/139 (56%), Gaps = 8/139 (5%)

Query: 3   SIFKKNKQP-DPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSPF 61
           ++FKK  +P DPF+EL    E+K      F+++  +H   +      G+     EY SPF
Sbjct: 4   ALFKKKLKPADPFEELSGLPEEKKKDPTEFLRQ--SHHPPTGGAAVTGDA-SHDEYYSPF 60

Query: 62  RDDKAVAEAERIRDLKFPTTGHHSTVRVKDNVKRKAQDIAEPRSFGTTDLKQQKQLDELG 121
           RD  AV EA     LKFPTTG H    V +  +R+  DI EP+   T D +Q++QL EL 
Sbjct: 61  RDAIAVEEAHGSGTLKFPTTGTH----VTEEARRRVPDIDEPKRLSTVDERQRQQLQELE 116

Query: 122 MKENQLEYLRNSQKIVDVR 140
           +KE QL   + SQKIVDVR
Sbjct: 117 LKEGQLRLYKESQKIVDVR 135

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  140 bits (354), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 95/297 (31%), Positives = 161/297 (54%), Gaps = 22/297 (7%)

Query: 307 GIFALWKRSEKPEKLN-------------------ATPEDPEFIVLTEKGYMSKNIYDRL 347
           G+FAL+KRS+KPE                      ATPEDPE IV T++GY+SK++YD+L
Sbjct: 411 GLFALFKRSKKPESSTKVAANAAAGTVVPGDDAPVATPEDPELIVRTQEGYVSKSVYDKL 470

Query: 348 EYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKA 407
           +Y+E+ HQ KLA   +    +YE  A+ YEEK+ S+  EIAE+ A M+Q++ + E ++K 
Sbjct: 471 QYDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKL 530

Query: 408 IEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXX 467
            +   SQ L++   KH   K  L K+ E  KN  I++K         V+           
Sbjct: 531 KQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKD 590

Query: 468 XXXXXXQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNA 527
                 Q+++S+V+ LTAELD +   L     ++ E N  + ALEE + ++E++I E+  
Sbjct: 591 EVAKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQE 650

Query: 528 VVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581
           +   N   +++++N    P +  ++ ++S +  ++  ++QE A QK E + ++ + E
Sbjct: 651 LHQQNVSKIESIDNKEYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVTRRLE 707

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 74/154 (48%), Gaps = 23/154 (14%)

Query: 3   SIFKKNKQPDPFKELLDN------EEDKHGTTEL--FVKKVTNHRKASEDDGTQGNVEGG 54
           ++F+K  + DPF  LLD+      ++ +H  T     +K+VT  ++  +++         
Sbjct: 5   NLFRKRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEEL------DD 58

Query: 55  GEYVSPFRDDKAVAEAERIRDLKFPTTGHHST---------VRVKDNVKRKAQDIAEPRS 105
            EY SPFR  +    A ++R  KFPT    +            V D   +KA+DI  P  
Sbjct: 59  NEYHSPFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSG 118

Query: 106 FGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
              T+ +Q+ +L  L  KE QL Y R SQKIVD+
Sbjct: 119 LKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDL 152

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  140 bits (353), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 166/311 (53%), Gaps = 18/311 (5%)

Query: 289 VPPTKQKGHRGPF----KFSKKGIFALWKRSEK----------PEKLNATPEDPEFIVLT 334
           VP    K  + PF    +  K GIFALWK S            P    ATPE PE IV T
Sbjct: 375 VPIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKT 434

Query: 335 -EKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAA 393
            E GY+SK +YD++ Y+E++HQ  L  L     AKY+   + YEEKL  L N+I EV  +
Sbjct: 435 KEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDS 494

Query: 394 MDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLT 453
           M  ++ +T  +++  +  L + ++D+ A H+ +K  + K+ EN KN K+ EKN +  K T
Sbjct: 495 MKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQT 554

Query: 454 QVEPXXXXXXXXXXXXXXXXQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEE 513
            V+                   + + +  L+ +LDA++ ++  ++ +Q++V   + +LE+
Sbjct: 555 NVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQ 614

Query: 514 RRVQIEKDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQK 570
           ++  +     E+  +   N ++L+++EN    P I  +DNQ+S +   ++ ++QE+A +K
Sbjct: 615 KKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEK 674

Query: 571 DELTELSTKKE 581
            +L+ ++ + E
Sbjct: 675 TQLSAITKRLE 685

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 72/164 (43%), Gaps = 41/164 (25%)

Query: 4   IFKKNKQ-PDPFKELLDNE---------EDKHGTTELFVKKVTNHRKASEDDGTQGNVEG 53
           +F  N+Q  DPF +L++           + K    +   K V+N  K            G
Sbjct: 2   LFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPK------------G 49

Query: 54  GGEYVSPFRDDKAVAE-------AERIRDLKFPT---TGHHSTVRVKD--------NVKR 95
             E++SPFR D   ++        E  ++ KFPT   T  +S  + KD        N KR
Sbjct: 50  KEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKR 109

Query: 96  KAQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
            A+DI  P      + +Q + L EL +KE  L+YL+  QKI D+
Sbjct: 110 -AKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDL 152

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  138 bits (347), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 88/296 (29%), Positives = 164/296 (55%), Gaps = 14/296 (4%)

Query: 300 PFKFSKKGIFALWK----------RSEKPEKLNATPEDPEFIVLT-EKGYMSKNIYDRLE 348
           P +  + GIFALWK          ++  P    ATPE+PE IV T E GY+SK +YD++ 
Sbjct: 367 PSRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPENPELIVKTKEHGYLSKAVYDKIN 426

Query: 349 YEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAI 408
           Y+E++HQ  LA L      KY+   + Y+EKL  L N+I E+  +M  ++ +T  +++  
Sbjct: 427 YDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVS 486

Query: 409 EASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXXX 468
           +  L + ++D+ A+H+ +K  +LK+ EN KN K+ EKN + +K T V+            
Sbjct: 487 KNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTN 546

Query: 469 XXXXXQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAV 528
                  + + +  L+ +LDA++ ++  ++ +Q +V   +  LE+++  +     E+  +
Sbjct: 547 VQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKL 606

Query: 529 VANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581
              N ++L+++EN    P I  +DNQ+S +   V+ ++QE+A +K +L+ ++ + E
Sbjct: 607 HEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLE 662

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 76/162 (46%), Gaps = 38/162 (23%)

Query: 4   IFKKNKQPD-PFKELLD----NEEDKHGTTE----LFVKKVTNHRKASEDDGTQGNVEGG 54
           +F  N+Q D PF +L++    N +++    +     F++KV ++             +G 
Sbjct: 2   LFNINRQEDDPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEP-----------KGK 50

Query: 55  GEYVSPFRDDKAV------AEAERIRDLKFPT---TGHHSTVRVKD--------NVKRKA 97
            E+VSPFR D         A  E  ++ KFPT   T  +S  + KD        N KR A
Sbjct: 51  EEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKR-A 109

Query: 98  QDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
           +DI  P      + +Q + L EL +KE  L+YL+  QKI D+
Sbjct: 110 KDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKITDL 151

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  135 bits (340), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/305 (29%), Positives = 162/305 (53%), Gaps = 18/305 (5%)

Query: 295 KGHRGPFKFSKK----GIFALWKRSEK----------PEKLNATPEDPEFIVLT-EKGYM 339
           K  + PFK   K    GIFALWK              P    ATPE+PE IV T E GY+
Sbjct: 349 KAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYL 408

Query: 340 SKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKS 399
           SK +YD++ Y+E++HQ  LA L     AKY+ T+  Y E+L  L N+I E+  +M  ++ 
Sbjct: 409 SKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRK 468

Query: 400 QTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXX 459
           +T  +++  +  L + ++D+   H+ +K  + K+ EN KN K+ EK+ +  K T V+   
Sbjct: 469 ETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEI 528

Query: 460 XXXXXXXXXXXXXXQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIE 519
                           + + +  L+ +LDA++ ++  ++ +Q++V   + AL++++  + 
Sbjct: 529 DELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLI 588

Query: 520 KDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTEL 576
               E+  +   N + L+++EN    P I  +DNQVS +   ++ + QE+A +K EL+ +
Sbjct: 589 AQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAI 648

Query: 577 STKKE 581
           + + E
Sbjct: 649 TKRLE 653

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 74/166 (44%), Gaps = 46/166 (27%)

Query: 4   IFKKNKQ-PDPFKELLDN---------EEDKHGTTELFVKKVTNHRKASEDDGTQGNVEG 53
           +F  N+Q  DPF +L++          E+ +    +   K V+N  K            G
Sbjct: 2   LFNTNRQDEDPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPK------------G 49

Query: 54  GGEYVSPFRDDK---------AVAEAERIRDLKFPT---TGHHSTVRVKD--------NV 93
             E+VSPFR D           VA+A   ++ KFPT   T  +S  + KD        N 
Sbjct: 50  KEEWVSPFRQDALSRNQNNRLYVADA---KNKKFPTVSATSAYSKQQPKDLGYKNIPKNA 106

Query: 94  KRKAQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
           KR A+DI  P      + +Q + L EL +KE  L+YL+  QKI D+
Sbjct: 107 KR-AKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDL 151

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 159/305 (52%), Gaps = 18/305 (5%)

Query: 295 KGHRGPFK----FSKKGIFALWKR----------SEKPEKLNATPEDPEFIVLT-EKGYM 339
           K  + PF+      + G FALWK           +  P    ATPE+PE IV T E GY+
Sbjct: 372 KAPKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAPLNPVATPENPELIVKTKEHGYL 431

Query: 340 SKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKS 399
           SK +YD++ Y+E++HQ  L  L     AKY+     Y+EKL  L N+I E+  +M QL+ 
Sbjct: 432 SKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLRE 491

Query: 400 QTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXX 459
           +T  +++  +  L + ++DI  +H+ +K  + K+ EN K  K+ EKN +  K T V+   
Sbjct: 492 ETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEI 551

Query: 460 XXXXXXXXXXXXXXQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIE 519
                           + + + +L+ +LDA++ ++  ++ +Q++    +  LE+++  + 
Sbjct: 552 DELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLI 611

Query: 520 KDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTEL 576
               E+  +   N E+L+++EN    P I  +D Q+S +   ++ + QE+A ++  L+ +
Sbjct: 612 TQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAI 671

Query: 577 STKKE 581
           + K E
Sbjct: 672 TKKLE 676

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 53/104 (50%), Gaps = 18/104 (17%)

Query: 53  GGGEYVSPFRDDKAVA-EAERI-----RDLKFPT---TGHHSTVRVKD--------NVKR 95
           G  ++VSPFR D     +  R+     ++ KFPT   T  +S  + +D        +VKR
Sbjct: 47  GKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKR 106

Query: 96  KAQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
            A+DI  P      + +Q + L EL +KE  L+YL+  QKI D+
Sbjct: 107 -AKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDL 149

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 166/298 (55%), Gaps = 13/298 (4%)

Query: 297 HRGPFK--FSKKGIFALWKRSE----KPEKLN--ATPEDPEFIVLTEK-GYMSKNIYDRL 347
           H GP +   S  GI A++K +     +P   N  ++PE+PE+++ T++ GY+SK +YD++
Sbjct: 324 HMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKV 383

Query: 348 EYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKA 407
           +Y++ +HQ  L +L+     KY++    YE+ LA + ++I  +H  MD+LK +T  +++ 
Sbjct: 384 QYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEV 443

Query: 408 IEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXX 467
           +E  L +N++D+   H++ K  + KE E  K  K+  K     K  ++            
Sbjct: 444 MEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQT 503

Query: 468 XXXXXXQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNA 527
                  ++ S++  +TA+LDA++ +++  + ++ ++   MA L   ++++E++I ++  
Sbjct: 504 GVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELEEEIKKNEE 563

Query: 528 VVANNKELLQNL---ENH-PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581
           +  NN ELL +L   +N+ P I  +DN+++     +S +++E   + + LT L+ K E
Sbjct: 564 IHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLE 621

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 19/99 (19%)

Query: 56  EYVSPFRDDKAV-----AEAERIRDLKFPT---TGHHSTV--------RVKDNVKRKAQD 99
           EYVSPFRD   V     A+A+++   +FPT   + H S +         +  + KR A+D
Sbjct: 37  EYVSPFRDPSNVQAANYAKAKKME--RFPTVSASSHFSRMSPNELGYKNISKSTKR-AKD 93

Query: 100 IAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVD 138
           I+ P      + +Q   + +L +KE  L+YLRNSQ +++
Sbjct: 94  ISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  106 bits (265), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 141/263 (53%), Gaps = 12/263 (4%)

Query: 323 ATPEDPEFIVLTEK-GYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381
           ATPE+PE I  TE+ GYMSK IYD++ Y+E  H+  L    ++  AKY+D    Y  +L 
Sbjct: 420 ATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELE 479

Query: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441
            L  EI  ++ +M+ LK +T ++++  E +L + + +    H+EQK  + KE EN KN K
Sbjct: 480 ELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQK 539

Query: 442 ITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQSEVQALTAELDARLGELQNVSDEQ 501
           I +K  I +K   V+                  ++ + +  L  +LDA++ ++  ++ +Q
Sbjct: 540 IQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQ 599

Query: 502 TEVNLSMAALE----ERRVQIE---KDISESNAVVANNKELLQNLENHPSIAALDNQVSE 554
            E    +  LE    E + QI+   K+  E   VV    E  +N E  P I  +DNQ+SE
Sbjct: 600 DETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVV----ESYENKEYLPKIHTIDNQISE 655

Query: 555 VTRTVSAVEQEHAAQKDELTELS 577
           +   ++ ++QE+A ++ EL++++
Sbjct: 656 LLNELAIIKQENANEQTELSKIT 678

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 12/92 (13%)

Query: 58  VSPFRDDKAVAEAERIRDLKFPTTGHHSTV----------RVKDNVKRKAQDIAEPRSFG 107
           V+PF +  A  +    + +KFPT    S +          +  D   ++A+DI  P    
Sbjct: 105 VNPFTNKPAYNK--NAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLT 162

Query: 108 TTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
             + +QQ  L EL +KE +L+YL++SQKI+D+
Sbjct: 163 ENEFRQQTILKELELKEGKLQYLKDSQKIIDL 194

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  102 bits (255), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 141/257 (54%), Gaps = 3/257 (1%)

Query: 326 EDPEFIVLTEKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNN 385
           E+PE +V T+ GY++K IYD++  ++  H E +A   ++   K++D       K+ SL  
Sbjct: 346 ENPEHVVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRA 405

Query: 386 EIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEK 445
           +I E+   M QL+S T+ +++  E  L++   ++   H ++K  + K+ E  K+ K++EK
Sbjct: 406 QIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEK 465

Query: 446 NTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQSEVQALTAELDARLGELQNVSDEQTEVN 505
           +++ +K  +V+                 Q++  +++ L+A +DA++ +L+ V+ +Q    
Sbjct: 466 DSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQ 525

Query: 506 LSMAALEERRVQIEKDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAV 562
             +  L++++V I   I ++N   A N+++++  +N    P +  +DNQ+S +   ++ +
Sbjct: 526 EEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTI 585

Query: 563 EQEHAAQKDELTELSTK 579
            Q  A ++ EL+ ++ K
Sbjct: 586 RQHCANERTELSAITKK 602

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 48/93 (51%), Gaps = 12/93 (12%)

Query: 53  GGGEYVSPFRDDKAVAEAERIRDLKFPTTGHHSTV-----------RVKDNVKRKAQDIA 101
           G  +YVSPFRD++ V  A+R R  +FPTT   S             ++    KR A+DI+
Sbjct: 36  GERDYVSPFRDEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKR-AKDIS 94

Query: 102 EPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQ 134
            P      + KQ + L EL +KE  L YL++ Q
Sbjct: 95  FPVYLEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 140/286 (48%), Gaps = 10/286 (3%)

Query: 305 KKGIFALWKRSEK-----PEKLNATPEDPEFIVLTEK-GYMSKNIYDRLEYEEELHQEKL 358
           K+ IF+++ R +K     P  L ATPE+PE +V T++ G++SK +YD+++YE   H E L
Sbjct: 468 KRSIFSIFGRKKKSQNRAPNPL-ATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWL 526

Query: 359 ASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMD 418
                +   +YE+    Y+ +L  L  E+ ++  +M ++K      ++     LS+  ++
Sbjct: 527 TEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLE 586

Query: 419 IQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQS 478
              ++ E+K  +  E +  ++ K  E + I  +  +V+                   + +
Sbjct: 587 STQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTN 646

Query: 479 EVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQ- 537
            +   +A LDA++  L  +  + T+    +  L  ++  +EK+++      A N + ++ 
Sbjct: 647 RLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEK 706

Query: 538 --NLENHPSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581
             N E  P +  +D+++S +   +S ++QE A +K +L  ++ K E
Sbjct: 707 HANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLE 752

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 55  GEYVSPFRDDKAVAEAERIRDLKFPTTGHHSTV----------RVKDNVKRKAQDIAEPR 104
           GE+ SPFR +    +AE+ R  +FPT   +S            R      R+A+DI  P 
Sbjct: 67  GEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPI 126

Query: 105 SFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
                + +Q + L E+ ++E +L Y++NSQ + D 
Sbjct: 127 YLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDY 161

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 145/270 (53%), Gaps = 4/270 (1%)

Query: 316 EKPEKLNATPEDPEFIVLTEK-GYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTAR 374
           EKP    A+P + E IV T + GY+SK +YD+++Y+E+ H++ LA  +     KYE   +
Sbjct: 263 EKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQ 322

Query: 375 AYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEA 434
            Y++ L  ++N+++E++  +++ +  T+ ++  +   L + + D +      K  +  E 
Sbjct: 323 EYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNET 382

Query: 435 ENEKNAKITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQSEVQALTAELDARLGEL 494
           +  K  K++EK  +    T+V+                   + + +  + +ELDA+L ++
Sbjct: 383 KQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKI 442

Query: 495 QNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLENH---PSIAALDNQ 551
             ++  Q  +   + AL  ++  ++ +I+++  +  +N +L+++++N    P +  +DN+
Sbjct: 443 SQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNE 502

Query: 552 VSEVTRTVSAVEQEHAAQKDELTELSTKKE 581
           ++ +   ++ V+QE+A +K +L E++ K E
Sbjct: 503 INGLLNQMTIVKQENANEKVQLAEITKKLE 532

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 72/164 (43%), Gaps = 27/164 (16%)

Query: 2   SSIFKKNKQPDPFKELLDNEED----KHGT------TELFVKKVTNHRKASEDDGTQGNV 51
           SSI    ++ DPF  L +  E     KH T      T  F+++V +   ++     +  +
Sbjct: 3   SSILSFKRRDDPFDHLFEEAEAAEAAKHNTSMAPRTTSSFLQRVVSTTSSTTQKQPKKKI 62

Query: 52  EGG-----GEYVSPFRDDKAVAEAERIRDLKFPTTGHHSTVRVKDNVKRK---------- 96
                    +Y SPFR + +    +  +  +FPT    S   +K N K+K          
Sbjct: 63  AASEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLK-NPKQKGFTTIKKGQN 121

Query: 97  -AQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
            A+DI  P      + +QQ +L  L  KE  L+YL++SQ I+D+
Sbjct: 122 FAKDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDL 165

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 133/264 (50%), Gaps = 5/264 (1%)

Query: 323 ATPEDPEFIVLT-EKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381
           A+PE+PE++V T E   +SK +YD++ YE++LH E L + +     KY    + YE+KL 
Sbjct: 316 ASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLV 375

Query: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441
            L  ++ ++         + + +++ +E  L +N++D+Q+K++  K  ++KE E  K  K
Sbjct: 376 ELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQK 435

Query: 442 ITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQSEVQALTAELDARLGELQNVSDEQ 501
           I  K  +  K   V+                   +   ++ LT  LD ++ +++ +++  
Sbjct: 436 INAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENN 495

Query: 502 TEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNL----ENHPSIAALDNQVSEVTR 557
             +   +  L+ +++ +E +I +       NK++LQ L    +  P +  +D Q++    
Sbjct: 496 MRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFD 555

Query: 558 TVSAVEQEHAAQKDELTELSTKKE 581
            ++ ++ E  ++ ++L+ L+ K E
Sbjct: 556 KLAIIKNETISENNQLSILTKKLE 579

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 15/96 (15%)

Query: 56  EYVSPFRDDKAVAE---AERIRDLKFPTT-----------GHHSTVRVKDNVKRKAQDIA 101
           EY+SPFR+ +       A+ +++ KFPTT           G      +  N KR A+DI 
Sbjct: 36  EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKR-AKDIQ 94

Query: 102 EPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIV 137
            P+     + +Q + L EL +KE++L  L+ S +++
Sbjct: 95  FPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 138/263 (52%), Gaps = 4/263 (1%)

Query: 323 ATPEDPEFIVLTEK-GYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381
           ATP   E IV T+K G +SK+IYD+L+Y+++ H++ LAS       KY+   + YE +L 
Sbjct: 230 ATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELK 289

Query: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441
           SL+ +I   +  ++Q K  T+ ++  + A L + + D ++   + K  +  E +  K  K
Sbjct: 290 SLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREK 349

Query: 442 ITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQSEVQALTAELDARLGELQNVSDEQ 501
           I EK  + E   QV                   ++   +  +  +LDA+L +++ ++  Q
Sbjct: 350 IDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQ 409

Query: 502 TEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRT 558
             +   +  L   ++ + K+I  +    ANN E ++N++N    P +  +D+Q++++   
Sbjct: 410 MNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQ 469

Query: 559 VSAVEQEHAAQKDELTELSTKKE 581
           ++ ++QE+A +K +L+EL+ K E
Sbjct: 470 LTLIKQENANEKIQLSELTQKLE 492

 Score = 38.1 bits (87), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 17/99 (17%)

Query: 56  EYVSPFR-----DDKAVAEAERIRDLKFPTTGHHS--TVRVKDNV--------KRKAQDI 100
           EY+SPFR     ++KA  + E+ +  +FPT    S  T R    +        K  A+DI
Sbjct: 67  EYLSPFRSNLVTNNKAYIQNEKTK--RFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDI 124

Query: 101 AEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
             P      + +QQ +L +L   E  L+Y ++SQ I+D+
Sbjct: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDL 163

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 107/219 (48%), Gaps = 1/219 (0%)

Query: 323 ATPEDPEFIV-LTEKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381
           AT + PE ++ L + G++S  +++++ Y++++H+ ++A   +   +K+    + YE+KLA
Sbjct: 300 ATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLA 359

Query: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441
            +++    V A M+  K     + + IE    + L D  A  ++ K  +L EA+  K  K
Sbjct: 360 QVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQK 419

Query: 442 ITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQSEVQALTAELDARLGELQNVSDEQ 501
           + +   I++K T ++                   + + +  +T  LDA+L +L   + +Q
Sbjct: 420 LQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQ 479

Query: 502 TEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLE 540
            ++   +  L +R+ ++E +I  +     N    L +LE
Sbjct: 480 DKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLE 518

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 16/98 (16%)

Query: 56  EYVSPFRDDKAVAEAERIRDL----KFPTTGHHSTV-----------RVKDNVKRKAQDI 100
           EYVSPFR  +    +++   L    KFPT    S             +V D+ +R+A+DI
Sbjct: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDD-QRRARDI 105

Query: 101 AEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVD 138
             P      + +Q+  L +L  +E  L +L+  Q ++D
Sbjct: 106 VFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 82/184 (44%), Gaps = 3/184 (1%)

Query: 323 ATPEDPEFIV-LTEKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381
           A+PE+ E +V LT    +SK +YD++E++ +++ + +     +   K       Y EK+ 
Sbjct: 249 ASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEKIK 308

Query: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441
           S+  E  +    ++ L  ++ N  + I+  L +NLMD  A   + K  +L++    K  K
Sbjct: 309 SIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKLQK 368

Query: 442 ITEKNTINEKLTQVEPXXXXXXXXXXXXXXXXQQYQSEVQALTAELDARLGEL--QNVSD 499
           + E   +N+K   +                        +  +  ELDA+L +L   N+ +
Sbjct: 369 LNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNIRN 428

Query: 500 EQTE 503
           E  E
Sbjct: 429 ENLE 432

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 20/121 (16%)

Query: 31  FVKKVTNHRKASEDDGTQGNVEGGGEYVSPFRDDKAVAEAER-IRDLK---FPTTGHHST 86
           F+ KV  ++    DD          +Y SPFR++    E ++ ++DLK   FP     ST
Sbjct: 33  FLSKVNTNKSKENDDE--------NKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATST 84

Query: 87  VRVK--------DNVKRKAQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVD 138
                       D  K  A+DI  P      + +Q + L +L +K++ L+ L++S +++D
Sbjct: 85  YNTDTKDVYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVID 144

Query: 139 V 139
           V
Sbjct: 145 V 145

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (55%), Gaps = 13/99 (13%)

Query: 54  GGEYVSPFRDDKAVAE---AERIRDLKFPT---TGHHSTVRVKD----NVK---RKAQDI 100
           G +Y SPFRD +  +    A + ++ ++PT   T  +S +  +D    N+    ++A+DI
Sbjct: 53  GKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDI 112

Query: 101 AEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
             P      +++Q K   +L  KE+QL+YL+ SQK++ V
Sbjct: 113 PFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKV 151

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 56/107 (52%), Gaps = 7/107 (6%)

Query: 323 ATPEDPEFIVLTEKG----YMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEE 378
           ATP++PE +V T        +SK++YD + Y  ++H +++     +S  KY++    +  
Sbjct: 379 ATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNN 438

Query: 379 KLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDE 425
            +  L+ +I  +   +   K++ ++ M     ++ +N +DI+  H++
Sbjct: 439 SINELDLKIKSIEKDIIDYKAKIDSLM---NDNVEKNDIDIENYHEK 482

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 62/124 (50%), Gaps = 5/124 (4%)

Query: 323 ATPEDPEFIVLTEKG-----YMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYE 377
           ATP++ E +++  K      Y SK ++D ++YE ++H +KL  L+     ++      Y+
Sbjct: 186 ATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYD 245

Query: 378 EKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENE 437
            ++++LN +I   +  + +L S+  +     +   ++N +    +++  K  L  E E  
Sbjct: 246 TQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEAI 305

Query: 438 KNAK 441
           KN +
Sbjct: 306 KNQR 309

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 18/106 (16%)

Query: 51  VEGGGEYVSPFRDDKAVAEAERIRD-----------------LKFPTTGHHSTVRVKDNV 93
           +    +Y SPFR +        IR+                 L   T G+  T+      
Sbjct: 33  IAHDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGY-KTIPTDRKS 91

Query: 94  KRKAQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139
           ++ A+DI  PRS    +  Q   L+EL  KEN L++L++SQ +V +
Sbjct: 92  RKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (50%), Gaps = 5/102 (4%)

Query: 349 YEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNE-IAEVHAAMDQLKSQTE---NE 404
           + EE H+ KL  L  N  A+       Y  KL +L  E I +     ++L  + E   N+
Sbjct: 138 FLEESHKLKLEQLTANKNAELNKMNDEYRSKLEALKYEKIKKFENEKNELIEKIEEIRNK 197

Query: 405 MKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKN 446
           M   + +L Q + DI+A H E+KE  LK+ + E   ++TEKN
Sbjct: 198 MITNDVALQQRMKDIEADHLEEKEKWLKDYQKEWR-EVTEKN 238

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 61/104 (58%), Gaps = 16/104 (15%)

Query: 476  YQSEVQALTAELDARLGELQNVSDEQT-----------EVNLSMAALE-ERRVQIEKDIS 523
            Y+++V  L+AEL++ +G+LQ  S EQT           ++N ++A LE E++ Q+  +  
Sbjct: 1118 YKAQVSKLSAELESTMGQLQKSSVEQTDRIENLIKENKDLNTTIATLEKEKKAQVVVNAH 1177

Query: 524  ESNAVVANNKELLQN---LENHPSIAALDNQVSEVTRTVSAVEQ 564
            + NA  ANNK ++ N    ++ P+   ++++V E+   + A+++
Sbjct: 1178 QENA-RANNKAVVDNKQKAKSQPATPLVNSKVQELEEQLEALQR 1220

>TDEL0F04220 Chr6 complement(778175..792904) [14730 bp, 4909 aa] {ON}
            Anc_8.295 YLR106C
          Length = 4909

 Score = 35.0 bits (79), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 343  IYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTE 402
            +Y R    E   + KL   +Q+S  KY+D    YEE    +  +  E+ +  D   +  E
Sbjct: 3145 LYYRWSLRERKAESKLK--EQSSIFKYQDDTDNYEEDFKKMFPDYEEILSVTDVDGNTAE 3202

Query: 403  NEMKAIEASLSQNLMDI-QAKHDEQKETLLKEAEN 436
             E+  I  SL+++ M I +   D + E+LL+E  N
Sbjct: 3203 TELNEIYFSLAKSYMAIFEDDQDVRLESLLQEGSN 3237

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 17/102 (16%)

Query: 290 PPTKQ-KGHRGPFKFSKKGIFALWKRSEKPEKLNATPEDPEFIV-LTEK--GYMSKNIYD 345
           PPT+Q + HRG                  P+   ATP++PE +V LTE     +SK  YD
Sbjct: 161 PPTEQEQFHRG-------------MNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYD 207

Query: 346 RLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEI 387
           RL   +  H   L S +  + A Y    + Y++++  L+ +I
Sbjct: 208 RLVQVQSEHDAWLKSYNAENMANYNQRHQWYQKQIDVLDEKI 249

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 10/109 (9%)

Query: 354 HQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEV-------HAAMDQLKSQTENEMK 406
           H +     DQN A+K        E     +N    E+       +AA+D+ K   ++   
Sbjct: 102 HGQLAVDFDQNVASKLNGLYTKLEMTYGKINGFYGEISDKKKNAYAALDKAKKNYDDSCS 161

Query: 407 AIEASL---SQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKL 452
            +EA+    ++N  D   +  E+KE  + +A+NE   KI++ N I +K 
Sbjct: 162 NMEAARNKHTKNNNDRSKRKMEEKEVEMNDAKNEYLIKISQANRIKDKY 210

>NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {ON}
           Anc_8.604 YOR195W
          Length = 791

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 141/304 (46%), Gaps = 54/304 (17%)

Query: 315 SEKPEKLNATPEDP--EFIVLTEKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDT 372
           +EK +KL A  ++   E ++L +   + +  YD L  E +  +    +L+   + + E  
Sbjct: 339 TEKRDKLKAKIKNSKDEILMLNQNQKILQEKYDNLSNENDTWRNNYETLELEISKQKESH 398

Query: 373 ARAYEE---KLASLNNEIAE--------------VHAAMDQLKS--QTENEM-KAIEASL 412
           A    E   KL +L +E+AE              +H  +D ++   QT+NE+  ++EA++
Sbjct: 399 AIELNETSTKLETLKSELAESMAKSQSLTEKNNDMHEELDTIQQSLQTKNELISSLEATI 458

Query: 413 --SQNLMDI---QAKHDEQKETLLKEAENEKNAKITEK-NTINEK-LTQVEPXXXXXXXX 465
              QN  D+     K+ EQ E+L KE +     ++T K N +NE+ LT++E         
Sbjct: 459 KEQQNTQDLTKENEKYREQFESLFKEKD-----ELTNKFNAMNEEYLTKIEEYQQKVIEA 513

Query: 466 XXXXXXXXQQYQSEVQALTAELDARLGELQNV--------------SDEQTEVNLSMAAL 511
                   ++Y     A+T EL+A+ G + ++              + E TE+N  +A +
Sbjct: 514 ETELINIREKYN----AVTVELEAKNGSMASLKKTSEELDDANKIKAAEVTELNDDLAEI 569

Query: 512 EERRVQIEKDISESNAVVANNKELLQNLENHPSIAALDNQVSEVTRTVSAVEQEHAAQKD 571
           +E    +EK +S+   VV+  K   + L++    A+L+ +  ++      +E EH  + +
Sbjct: 570 KETNEYLEKSVSKLEKVVSEWKVKYETLQSDYDKASLELESFQLKN--DNIETEHLKELE 627

Query: 572 ELTE 575
           +L E
Sbjct: 628 DLHE 631

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
           complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 58/102 (56%), Gaps = 9/102 (8%)

Query: 475 QYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKE 534
           Q++ E++    +L  +  ++Q    +++E++L    ++E RV++E DI   N++++   E
Sbjct: 553 QHEKELEPWNLQLQGKKSQIQV---KESEISL----IKEGRVKLENDIENLNSLISVKIE 605

Query: 535 LLQNLENHPSIAALDNQVSEVTRTVSAVEQEHAAQKDELTEL 576
             + +     I +L N+++ +T+ VS  + E+   K++L E+
Sbjct: 606 --EKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREM 645

>ZYRO0E06666g Chr5 complement(501139..504231) [3093 bp, 1030 aa]
           {ON} similar to uniprot|P35729 Saccharomyces cerevisiae
           YKL057C NUP120 Subunit of the Nup84p subcomplex of the
           nuclear pore complex (NPC) required for even
           distribution of NPCs around the nuclear envelope
           involved in establishment of a normal nucleocytoplasmic
           concentration gradient of the GTPase Gsp1p
          Length = 1030

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 15/70 (21%)

Query: 292 TKQKGHRGPFKFSKKGIFA-------LWKRSE----KPEKLNATPEDPEFIVLTEKGYMS 340
           T   G RG   F+ KG+FA       +W   +    KP  LN T      +VL + G +S
Sbjct: 296 TLTPGGRGRINFTSKGVFAANLSSSSIWSLVDMTLLKPLDLNLTYSYANLVVLWKSGTVS 355

Query: 341 K----NIYDR 346
           K    NI D+
Sbjct: 356 KLQILNILDQ 365

>SAKL0H08294g Chr8 (713096..714484) [1389 bp, 462 aa] {ON} similar
           to uniprot|P38934 Saccharomyces cerevisiae YOR198C BFR1
           Component of mRNP complexes associated with
           polyribosomes implicated in secretion and nuclear
           segregation multicopy suppressor of BFA (Brefeldin A)
           sensitivity
          Length = 462

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 352 ELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEAS 411
           E  Q+KL  L   S   Y D  +    K   L  +  E++AA+ Q++S  +NE KA +A 
Sbjct: 192 ETTQKKLNDLQSKSQVVY-DKRQTLFSKRTVLYKKRDEIYAAIKQIRSDFDNEFKAFKAK 250

Query: 412 LSQ 414
           L Q
Sbjct: 251 LDQ 253

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.123    0.324 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,310,142
Number of extensions: 2649508
Number of successful extensions: 11157
Number of sequences better than 10.0: 753
Number of HSP's gapped: 11273
Number of HSP's successfully gapped: 1069
Length of query: 727
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 610
Effective length of database: 40,065,477
Effective search space: 24439940970
Effective search space used: 24439940970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 69 (31.2 bits)