Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12363.493ON1691696727e-91
AFR312W3.493ON1681694366e-55
KLLA0D16280g3.493ON1691694202e-52
Kwal_55.212383.493ON1701703993e-49
KLTH0F14850g3.493ON1711723862e-47
SAKL0F02750g3.493ON1701703663e-44
Smik_16.4023.493ON1731733508e-42
YPR149W (NCE102)3.493ON1731733482e-41
Skud_16.4443.493ON1731733472e-41
KAFR0C019703.493ON1791793394e-40
Suva_16.4783.493ON1661733221e-37
TDEL0D056103.493ON1751753142e-36
CAGL0L08448g3.493ON1731733117e-36
CAGL0I10494g3.493ON1721723082e-35
KNAG0B008003.493ON1821823013e-34
NDAI0B058803.493ON1821822987e-34
NDAI0G009303.493ON1761762856e-32
TPHA0D032803.493ON1841842856e-32
ZYRO0D09966g3.493ON1781782847e-32
NCAS0E008003.493ON1741742761e-30
Kpol_1017.63.493ON1871872711e-29
YGR131W (FHN1)3.493ON1741742621e-28
KNAG0A079503.493ON1821732561e-27
Skud_7.4423.493ON1741742552e-27
KAFR0G037003.493ON1861862474e-26
NCAS0F035603.493ON1831562465e-26
Suva_7.4193.493ON1741742394e-25
TBLA0C044903.493ON1861542404e-25
Smik_6.2273.493ON1741742385e-25
TBLA0D029603.493ON1891242082e-20
ADL138C5.101ON50971681.8
CAGL0D03960g5.309ON49837671.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1236
         (169 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   263   7e-91
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   172   6e-55
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   166   2e-52
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   158   3e-49
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   153   2e-47
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   145   3e-44
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   139   8e-42
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   138   2e-41
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   138   2e-41
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   135   4e-40
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   128   1e-37
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   125   2e-36
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   124   7e-36
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   123   2e-35
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   120   3e-34
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   119   7e-34
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   114   6e-32
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   114   6e-32
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   114   7e-32
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   110   1e-30
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   108   1e-29
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   105   1e-28
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   103   1e-27
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   102   2e-27
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   100   4e-26
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...    99   5e-26
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...    97   4e-25
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....    97   4e-25
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...    96   5e-25
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...    85   2e-20
ADL138C Chr4 complement(448985..450514) [1530 bp, 509 aa] {ON} S...    31   1.8  
CAGL0D03960g Chr4 (394925..396421) [1497 bp, 498 aa] {ON} simila...    30   1.9  

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  263 bits (672), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 140/169 (82%), Positives = 140/169 (82%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           FISALAWPILLITTDVLN                PHSCSNSGFLRGNDISEGREGRCRKV
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRKTGGGVPTISQV 169
           QA             AKAVLSGLNIVSTGAFSSGSGRKTGGGVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGGGVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  172 bits (436), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 106/169 (62%), Positives = 114/169 (67%), Gaps = 1/169 (0%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLSILDNSLRA NF+FLIIVL LTGSLI+GQ  SHSRVNFGLFTA+FAL+ DS YS++AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           FISA AWPI+ I  DVLN                 HSCSN GFL GN ISE    RCRKV
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRKTGGGVPTISQV 169
           QA             AKAV SGLNI S+GA  S  G K GGGVPTISQV
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNIFSSGA-FSSGGSKRGGGVPTISQV 168

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  166 bits (420), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 108/169 (63%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLSILDNSLR  NF+FLIIVL L G+LI  Q+ S SRVNF +F A+F ++FDSLY+++AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           FISALAWPI+L++ D LN                  SC+N  F  GN I+EG + RCRK 
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRKTGGGVPTISQV 169
           QA              K +LS +N +++GAF + S RKT  GVPTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKTQVGVPTISQV 169

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  158 bits (399), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 107/170 (62%), Gaps = 1/170 (0%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLSILDNSLRAANF+FL+IVL LTGSL   ++ ++ +VNF +F A F LLFD+LY++ AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           FISALAWP+L+   D LN                 HSC+NS ++  N +++G   RCRK 
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRKTGG-GVPTISQV 169
           QA              K  LS +N+ S GAFS+ SGRK+   GVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRKSANVGVPTISQV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  153 bits (386), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 108/172 (62%), Gaps = 4/172 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHS--RVNFGLFTAIFALLFDSLYSVL 58
           MLSILDNSLRA NF FL+I+L LTGSL    +++H+  +VNF +FTA F LLFDSLY++ 
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLA-ATHKTHNNPQVNFAIFTAAFGLLFDSLYAIP 59

Query: 59  ANFISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCR 118
           ANF+SALAWP+L+   D LN                 HSC+N  +L  N +++G   RCR
Sbjct: 60  ANFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCR 119

Query: 119 KVQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRKTGG-GVPTISQV 169
           K QA             AK  LS +N++S GAF +GS R+TG  GVPTISQV
Sbjct: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  145 bits (366), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 96/170 (56%), Gaps = 1/170 (0%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLSILDNSLR  NF FL+I+L LTGSLI  Q+    RVNF +FTA FAL+ DS Y+V AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
             SA AWPILL+T D LN                 HSC+N  +L  N+I++G   RCRK 
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNI-VSTGAFSSGSGRKTGGGVPTISQV 169
           QA              K VLS +N+  S    S    R+   GVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRRANVGVPTISQV 170

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  139 bits (350), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 100/173 (57%), Gaps = 4/173 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML++ DN LR  NFLFL+I +AL  SL+N Q++  SRVN+ +F   + +  DSLY V AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           FI  LAWP++L T D LN                 HSC+NS ++  N I++G   RCR+ 
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGS---GRKTGG-GVPTISQV 169
           QA             AK ++S  N++S GAF SGS    R+TG  GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  138 bits (348), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 99/173 (57%), Gaps = 4/173 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML++ DN LR  NFLFL+I + L  SL+N Q+R  SRVN+ +F   + +  DSLY V AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           FI  LAWP++L T D LN                 HSC+NS ++  N I++G   RCR+ 
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGS---GRKTGG-GVPTISQV 169
           QA             AK ++S  N++S GAF SGS    R+TG  GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  138 bits (347), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 99/173 (57%), Gaps = 4/173 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML+  DN LR  NFLFL+IV+ L  SL+N Q+R+ SRVNF +F A + +  DSLY V AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F   LAWP++L T D LN                 HSC+N  ++  N I++G   RCR+ 
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGS---GRKTGG-GVPTISQV 169
           QA             AK ++S  N++S GAF SGS    R+TG  GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  135 bits (339), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 92/179 (51%), Gaps = 10/179 (5%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSH-SRVNFGLFTAIFALLFDSLYSVLA 59
           ML + DN LR  N +FLII +ALT +LIN QN  H SRVN+ +F   F L FDS+Y + A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRK 119
           NF   LAWP+LL T D LN                 HSC N  +L  N I  G   RCR+
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 VQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRKTG---------GGVPTISQV 169
            QA             AK ++S +N+   GAFSSGS R            GGVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  128 bits (322), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 98/173 (56%), Gaps = 11/173 (6%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML+ +DN LR  NFLFL+I + L  SL+N Q+ + SR+N+ +F   +A++ DSLY V AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F   LAWP++L + D LN                 HSC N  +L  N I++G   RCR+ 
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTAIRA-------HSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGS---GRKTGG-GVPTISQV 169
           QA             AK ++S  N++S GAF SGS    R+TG  GVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  125 bits (314), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 94/175 (53%), Gaps = 6/175 (3%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML+I+DN+LR  NF FL+I+L L G LI+ ++   SRVNF +F A F ++ DS Y +LAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
                AWP++L   D LN                 HSC N  +L  N+I++G   RCR  
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSG-----RKTGG-GVPTISQV 169
           QA             AK ++S + I++ G FSS +      RK+   GVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  124 bits (311), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 92/173 (53%), Gaps = 4/173 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML++ DN LR  NF+F++I + L   LI  ++R  SRVN+ +F A + +  DSLY V AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F   LAWP++L T D LN                 HSC+N+ +   N I +G E RCR+ 
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRKTGG----GVPTISQV 169
           QA             AK ++S LNI S GAF +   R+       GVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  123 bits (308), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 92/172 (53%), Gaps = 3/172 (1%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS+ DN LR  N +FLII + L  SLIN + R  SRVNF LF A + +  DSLY + AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFL-RGNDISEGREGRCRK 119
           F   LAWP++L   D LN                 HSC+N  +L R   I +G   RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 VQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRK--TGGGVPTISQV 169
            QA             AK ++S +++VS GAF +   RK  T  GVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  120 bits (301), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 89/182 (48%), Gaps = 13/182 (7%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML + DN LR  NF FL+I LA   +LIN Q    SRVN+ +F A + +  D LY +LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F   LAWP++L T D LN                 HSC N  +   N I +G E RCR  
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGR-------------KTGGGVPTIS 167
           QA             AK V+SG+N+ S GAF++ S +                 GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 168 QV 169
           QV
Sbjct: 181 QV 182

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  119 bits (298), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 92/182 (50%), Gaps = 13/182 (7%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS +DN LR  N +FL++ +A   +L+N Q  + SR+NF +F A F LL DS + V  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FISALA-WPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRK 119
              ALA WPILL   D LN                 HSC N  ++  N I++G E RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 VQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSG------SGRKTGG------GVPTIS 167
            QA             AK ++SG+N+ S G F SG      S R+T        GVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 168 QV 169
           QV
Sbjct: 181 QV 182

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  114 bits (285), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 93/176 (52%), Gaps = 7/176 (3%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS+ DN LR  N +FL+I + L  +L+N Q   +SR+N+ +FT ++ LL DS + +LAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F   L++P +L T D LN                 HSC+N  +L  N I++G   RCR+ 
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFS----SGSGRKTGG---GVPTISQV 169
           QA              K  +S ++++  GAFS    S   R+ G    GVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  114 bits (285), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 90/184 (48%), Gaps = 15/184 (8%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML + DN LR  NF F +I L L GSL+  QN+  SRVN+ +F   FAL+ D+ Y  LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FISA-LAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRK 119
             S  LAWPI+L   D LN                 HSC+N  +L  N+I++G   RCRK
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 VQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRKTGG--------------GVPT 165
            QA             AK ++S +N+ + GA  S S  +  G              GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 166 ISQV 169
           ISQV
Sbjct: 181 ISQV 184

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  114 bits (284), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 92/178 (51%), Gaps = 9/178 (5%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSH-SRVNFGLFTAIFALLFDSLYSVLA 59
           ML++ DN LRA NF F +I+L L G LI  +   H SRVNF +F A F ++ DS Y +LA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRK 119
           N     A+P++L   D LN                 HSC+N  +L  N I++G   RCR+
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 VQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSG--------RKTGGGVPTISQV 169
            QA              K V+S L+++S GAF S SG        ++   GVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  110 bits (276), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 89/174 (51%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML + DN LR  N +FL+I + L  +L+N +  ++SR+N+ +FT  + L  DS+Y + AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F   LA P L    D LN                 HSC +  ++  N I++G + RCR+ 
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGRK-----TGGGVPTISQV 169
           QA             AK ++S +N++  GAF+   GR+        GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  108 bits (271), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 91/187 (48%), Gaps = 18/187 (9%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS+ DN +RA NF F +I + L GSL+  +    SRVN+ +F   FA++ DS Y +LAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  -FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRK 119
            + +  AWPI+L   D LN                 HSC N  ++  N I +G   RCRK
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 VQAXXXXXXXXXXXXXAKAVLSGLNIVSTGA--FSSGS-GRKTGG--------------G 162
            QA              K V+S +N++S GA  FS+ S GR+                 G
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 163 VPTISQV 169
           VP ISQV
Sbjct: 181 VPNISQV 187

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  105 bits (262), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 85/174 (48%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS  DN +R  N +FLII + L   LI  Q +  SRVNF +F A++ L+ DSLY  LAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F ++L +P +L+  D LN                 HSC N  +L  N I +G   RC + 
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSG-----RKTGGGVPTISQV 169
           QA              K  ++ + ++  G F S +G      +   G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  103 bits (256), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 85/173 (49%), Gaps = 9/173 (5%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           ML++ D  LR  NF+FL+I + L  +L+N Q+   SR+N+ +FTA + +  DS Y V+AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F   L+WP+LL   D LN                 HSC N  +   N I +G E RCR+ 
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSG---------SGRKTGGGVP 164
           QA             AK ++S +NI + G F S          S RK   GVP
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVP 173

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  102 bits (255), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 86/174 (49%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS  DN +R  + +FLII + L G L+  Q    SRVNF +F A + L+ DS Y  LAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F S+L +P +L+  D LN                 HSC N  +L  N+I++G   RC + 
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTG--AFSSGSGRKTGG---GVPTISQV 169
           QA              K  +S   ++  G   F++G GR+      GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score = 99.8 bits (247), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 87/186 (46%), Gaps = 17/186 (9%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLING-QNRSHSRVNFGLFTAIFALLFDSLYSVLA 59
           ML+I DNSLR  NF F++I +A    L+N  Q  + +RVN+ +F   F +L DS+Y + A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRK 119
           NF   LAWPI+L   D LN                 H+C+N  +   N I  G E RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 VQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAF---------------SSGSG-RKTGGGV 163
            QA              K V S +  +S G F               S+G+G   T  GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 164 PTISQV 169
           PT+S+V
Sbjct: 181 PTVSEV 186

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score = 99.4 bits (246), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 82/156 (52%), Gaps = 1/156 (0%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS +DN+LR  N +FL++ +A   +L++ QN   SRVN+ +F A F LL DS + + AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FISAL-AWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRK 119
            I  L +WPI+L   D LN                 HSC+N  +L  N I +G   RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 VQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGS 155
            QA             AK ++S +++ S GAF SGS
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGS 156

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score = 96.7 bits (239), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 85/174 (48%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS+ DN +R  N +FLII + L   LI+ Q +  SRVNF +F A + LL DS Y  LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
             S+L +P+++   D LN                 HSCSN  +L  N I++G   RC + 
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGR-----KTGGGVPTISQV 169
           +A              K V+S   +V  G F  G+       +   G+PTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score = 97.1 bits (240), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 74/154 (48%), Gaps = 2/154 (1%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHS-RVNFGLFTAIFALLFDSLYSVLA 59
           MLS   N LR  NF FL+I+  + G LI  + R HS RVN+ +F A FAL+ DS Y++ A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFI-SALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCR 118
           NF  S  AWPILL + D LN                 HSC N  +L  N I++G   RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 KVQAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFS 152
             QA              + V S L +   G F 
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFK 154

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score = 96.3 bits (238), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 84/174 (48%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60
           MLS  DN +R  N +FLII + L   LI+ Q +  SRVNF +FTA + L+ DSLY  LAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FISALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCRKV 120
           F S+L +P +L+  D+LN                 HSC N  +L  N I++    RC + 
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QAXXXXXXXXXXXXXAKAVLSGLNIVSTGAFSSGSGR-----KTGGGVPTISQV 169
           QA              K  ++    +  G F   SG      +   GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score = 84.7 bits (208), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (51%), Gaps = 2/124 (1%)

Query: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSH-SRVNFGLFTAIFALLFDSLYSVLA 59
           ML + DN  R  NF F +I   + G+L+N ++  H SRVN+ +F   + L+ DS Y +LA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFI-SALAWPILLITTDVLNXXXXXXXXXXXXXXXXPHSCSNSGFLRGNDISEGREGRCR 118
           N +    A+P +L   D LN                 HSC+N  + R N I +G E RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 KVQA 122
           + QA
Sbjct: 121 EAQA 124

>ADL138C Chr4 complement(448985..450514) [1530 bp, 509 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR227W
           (DIE2)
          Length = 509

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 10/71 (14%)

Query: 11  AANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSV--------LANFI 62
           A NF   +I L   GS+  G   SH    F L    + LLF + +SV        L N++
Sbjct: 255 AVNFALFLIFLLYNGSVTLGDKSSHV-AGFHLVQMFYCLLFITFFSVPVWFCRSFLLNYV 313

Query: 63  S-ALAWPILLI 72
           S  + +PI  I
Sbjct: 314 SRTVVYPIWTI 324

>CAGL0D03960g Chr4 (394925..396421) [1497 bp, 498 aa] {ON} similar
           to uniprot|P38770 Saccharomyces cerevisiae YHR036w
          Length = 498

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 36  SRVNFGLFTAIFALLFDSLYSVLANFISALAWPILLI 72
           SR N  LFTA  +L+   L S+L +FI  L W  LL+
Sbjct: 402 SRDNDKLFTARISLVARILGSILNSFIEPLGWKALLV 438

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,194,379
Number of extensions: 344978
Number of successful extensions: 848
Number of sequences better than 10.0: 33
Number of HSP's gapped: 802
Number of HSP's successfully gapped: 33
Length of query: 169
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 67
Effective length of database: 41,785,467
Effective search space: 2799626289
Effective search space used: 2799626289
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)