Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12353.494ON28328314890.0
SAKL0F02728g3.494ON28228311701e-163
KLTH0F14872g3.494ON28028311671e-162
TPHA0D032903.494ON28528311471e-159
CAGL0I10472g3.494ON28828211441e-159
TDEL0D056203.494ON27928111281e-156
Kpol_1017.53.494ON28328611251e-156
Kwal_55.212403.494ON28326611201e-155
Suva_7.4203.494ON28728311201e-155
Smik_6.2283.494ON28728311181e-155
NCAS0E007903.494ON32728210951e-151
YGR132C (PHB1)3.494ON28728310801e-149
NDAI0G009203.494ON29628410771e-148
Skud_7.4433.494ON28728310681e-147
TBLA0D029503.494ON28227810661e-147
KAFR0C019803.494ON28328210651e-147
AFR313C3.494ON28328610641e-147
ZYRO0D09900g3.494ON28328210631e-146
KNAG0B007903.494ON28428410501e-144
KLLA0D16302g3.494ON2262149051e-123
TBLA0H022205.98ON3072327125e-93
KAFR0B042505.98ON3102446987e-91
ADL141W5.98ON3072326952e-90
YGR231C (PHB2)5.98ON3102326919e-90
Kpol_1050.615.98ON3102406892e-89
SAKL0G15510g5.98ON3082326892e-89
Smik_16.755.98ON3102326883e-89
Kwal_27.127475.98ON3072326856e-89
ZYRO0B15136g5.98ON3102366856e-89
CAGL0L06490g5.98ON3132416841e-88
TPHA0A050905.98ON3102326831e-88
KLLA0E15731g5.98ON3082346822e-88
KNAG0A015805.98ON2882416802e-88
NCAS0F006005.98ON3132406813e-88
NDAI0D025305.98ON3162406813e-88
Suva_7.5235.98ON3102326813e-88
Skud_7.5655.98ON3102326797e-88
KLTH0C01672g5.98ON3072326771e-87
TDEL0G012105.98ON3092326726e-87
TPHA0I013002.117ON37980721.4
KLTH0F18546g7.518ON277779712.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1235
         (283 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   578   0.0  
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   455   e-163
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   454   e-162
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   446   e-159
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   445   e-159
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   439   e-156
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   437   e-156
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   436   e-155
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   436   e-155
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   435   e-155
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     426   e-151
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   420   e-149
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     419   e-148
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   416   e-147
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   415   e-147
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   414   e-147
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   414   e-147
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   414   e-146
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   409   e-144
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   353   e-123
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   278   5e-93
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   273   7e-91
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   272   2e-90
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   270   9e-90
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   270   2e-89
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   270   2e-89
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   269   3e-89
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   268   6e-89
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   268   6e-89
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   268   1e-88
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   267   1e-88
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   267   2e-88
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   266   2e-88
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   266   3e-88
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   266   3e-88
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   266   3e-88
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   266   7e-88
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   265   1e-87
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   263   6e-87
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    32   1.4  
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    32   2.1  

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/283 (100%), Positives = 283/283 (100%)

Query: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60
           MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120
           QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180
           IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240
           SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240

Query: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR
Sbjct: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  455 bits (1170), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/283 (76%), Positives = 259/283 (91%), Gaps = 1/283 (0%)

Query: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60
           MS+  +++A IA+PIG+A  A Q  +YDV+GGTRAVIFDRLSGVQQ+V+GEGTHFL+PWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120
           Q+A++YDVRTKPKNIATNTGTKDLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180
           IGNEVLKAIVAQFDAAELITQRE+VSQ+IR+EL+ RA  F+I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240
           +VE+KQIAQQ++ERAK+LV+ AEQER AAVIRAEG+AE+A+YISKAL+KAGDGLL+IRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240

Query: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           EASK+IAQTLA SSN+TYLPS+  GG+ +  G+P+SLLLNLGR
Sbjct: 241 EASKEIAQTLANSSNVTYLPSNGAGGA-EQQGSPNSLLLNLGR 282

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  454 bits (1167), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 217/283 (76%), Positives = 254/283 (89%), Gaps = 3/283 (1%)

Query: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60
           MSR  +++A IA+P+G+A  A Q  +YDV+GG+RAVIFDRLSGVQQ+VVGEGTHFL+PWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120
           QKAV+YDVRTKPKNIATNTGTKDLQ+V+LTLRVLHRPDV+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180
           IGNEVLKAIVAQFDAAELITQRE VSQ+IRQEL+ RA  F+I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240
           +VE+KQIAQQ++ERA+Y+V+LAEQER A+VIRAEG+AE+AEYISKAL KAGDGLL+IRR+
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           EASK+IA+TLA SSN+TYLPSS         G+P+SLLLNLGR
Sbjct: 241 EASKEIAKTLANSSNVTYLPSSHSASEQ---GSPNSLLLNLGR 280

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  446 bits (1147), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 212/283 (74%), Positives = 255/283 (90%), Gaps = 1/283 (0%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           ++ L+ +  IAVP+G+A+   Q  +YDV+GG+RAVIFDRLSGV+Q+V+GEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KA+++DVRTKPK+IATNTGTKDLQ+V+LTLRVLHRPDV  LP IYQ LGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLKAIVAQFDAAELITQRE+VS KIR+EL+ R++ F IKLEDV+ITHM FG EFTK+
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE+KQIAQQ++ERAK+LV+ AEQER AAVIRAEG+AE+AEYISKAL KAGDGLL+IRRLE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 242 ASKKIAQTLAGSSNITYLPS-SSKGGSHDACGTPSSLLLNLGR 283
           ASK+IA+TL+ SSN+TYLPS SS  G++++ GTP+SLLLNLGR
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  445 bits (1144), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 209/282 (74%), Positives = 250/282 (88%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           + F+  I  +A+P+G+A+   Q  +YDV+GG+R VIFDRL GV+  VVGEGTHFL+PWLQ
Sbjct: 6   NNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQ 65

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KA+IYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRPDV+ LP IYQ LGLDYDERVLPSI
Sbjct: 66  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSI 125

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLK+IVAQFDAAELITQRE+VSQKIRQEL+ RA+ F I+LEDV+ITHM FG EFTK+
Sbjct: 126 GNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKA 185

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE+KQIAQQ++ERA++LV+ AEQER A+VIRAEG+AE+AEYISKAL+K GDGLL+IRRLE
Sbjct: 186 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLE 245

Query: 242 ASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           ASK+IAQTLA S+NITYLPS+  GG  D  G+P++LLLNLGR
Sbjct: 246 ASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  439 bits (1128), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 208/281 (74%), Positives = 249/281 (88%), Gaps = 3/281 (1%)

Query: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60
           MSR +EN+A +A+P+G+ +   Q  +YDVRGG+RAVIFDRLSGVQ++VVGEGTHFL+PWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120
           QKA++YD+RTKPK IATNTGTKD+Q+V+LTLRVLHRPDV+ LP+IYQ LGLDYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180
           IGNEVLKAIVAQFDAAELITQRELVSQ+IR EL+ RA  F I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240
           +VE+KQIAQQ++ERAK+LV+ AEQ R A+VIRAEG+AE+AEYISKAL +AGDGLL+IRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240

Query: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNL 281
           EASK+IAQTLA SSNITYLP  + G +    G+ +SLLLN+
Sbjct: 241 EASKEIAQTLAASSNITYLPGKAHGNTE---GSQNSLLLNI 278

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  437 bits (1125), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 208/286 (72%), Positives = 254/286 (88%), Gaps = 6/286 (2%)

Query: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60
           MS+ ++ +A +A+PIG+ +   Q  +YDV+GG+RAVIFDR+SGV+Q ++GEGTHFLIPWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120
           QKA+IYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRPDV+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180
           I NEVLKAIVAQFDAAELITQRE+VS +IR EL +R++ F I+LEDV+ITHM FG+EFTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240
           +VE KQIAQQ++ERAK+LV+ AEQER AAVIRAEG+AE+AEYISKAL+KAGDGLL+IRRL
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240

Query: 241 EASKKIAQTLAGSSNITYLPS---SSKGGSHDACGTPSSLLLNLGR 283
           EASK+IA TL+ SSN+TYLP+   +++GGS    GTP++LLLNLGR
Sbjct: 241 EASKEIAATLSQSSNVTYLPNGHGNARGGSD---GTPNTLLLNLGR 283

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  436 bits (1120), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 205/266 (77%), Positives = 245/266 (92%)

Query: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60
           MSRF +++A IA+P+G+A  A Q  +YDV+GG+RAVIFDRLSGVQQ+VVGEGTHFLIPWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120
           QKAV++DVRTKPKNIATNTGTKDLQ+V+LTLRVLHRPDV+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQ+IRQEL+ RA  F+I+LEDV+ITHM FG +FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240
           +VE+KQIAQQ++ERA+++V+LAEQER A+VIRAEG+AE+AEYISKAL KAGDGLL+IRR+
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKKIAQTLAGSSNITYLPSSSKGG 266
           EASK+IA+TLA SSN+TYLPS+ +G 
Sbjct: 241 EASKEIAKTLANSSNVTYLPSNQQGA 266

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  436 bits (1120), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/283 (72%), Positives = 250/283 (88%), Gaps = 1/283 (0%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           SRF++ I  +A+PIG+     Q  +YDV+GG+R VIFDR++GV+Q+VVGEGTHFL+PWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KA+IYDVRTKPK+IATNTGT+DLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLK+IVAQFDAAELITQRE++SQKIR+EL+ RA+ F IKLEDV+ITHM FG EFTK+
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE+KQIAQQ++ERAK++V+ AEQER A+VIRAEG+AE+AEYISKAL K GDGLL+IRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 242 ASKKIAQTLAGSSNITYLPSSSKG-GSHDACGTPSSLLLNLGR 283
           ASK IAQTLA SSN+ YLPS   G G+ +  G+P+SLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  435 bits (1118), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 205/283 (72%), Positives = 250/283 (88%), Gaps = 1/283 (0%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           SR ++ I  +A+PIG+     Q  +YDV+GG+R VIFDR++GV+Q+VVGEGTHFL+PWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KA+IYDVRTKPK+IATNTGT+DLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLK+IVAQFDAAELITQRE++SQKIR+EL+ RA+ F IKLEDV+ITHM FG EFTK+
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE+KQIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AE+ISKAL K GDGLL+IRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKKIAQTLAGSSNITYLPSSSKG-GSHDACGTPSSLLLNLGR 283
           ASK IAQTLA SSN+ YLPS   G G+ ++ G+P+SLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  426 bits (1095), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 203/282 (71%), Positives = 245/282 (86%), Gaps = 1/282 (0%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           ++ L  I  +A+P+G+     +  +YDV+GG+R VIFDRLSGVQ++V+GEGTHFL+PWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KAVIYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRP++  LPKIYQ LGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLK+IVAQFDAAELITQRE+VSQ+I+ EL+ RA  F I+LEDV+ITHM FG EFTK+
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE+KQIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AEYISKAL K GDGLL+IRRLE
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 242 ASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           ASK IAQTLA S NITYLP   +GG  +  G+P+SLLLN+GR
Sbjct: 287 ASKDIAQTLANSPNITYLP-GQQGGRGNDSGSPNSLLLNIGR 327

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  420 bits (1080), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 205/283 (72%), Positives = 251/283 (88%), Gaps = 1/283 (0%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           ++ ++ I  +A+PIG+     Q  +YDV+GG+R VIFDR++GV+Q+VVGEGTHFL+PWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KA+IYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLK+IVAQFDAAELITQRE++SQKIR+EL+ RA+ F IKLEDV+ITHM FG EFTK+
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE+KQIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AE+ISKAL K GDGLL+IRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKKIAQTLAGSSNITYLPSS-SKGGSHDACGTPSSLLLNLGR 283
           ASK IAQTLA SSN+ YLPS  S GG+ ++ G+P+SLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  419 bits (1077), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 242/284 (85%), Gaps = 3/284 (1%)

Query: 3   RFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQK 62
           +F   +  +A+PIG+ +      +YDV+GG+R VIFDRLSGV+  VVGEGTHFL+PWLQK
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 63  AVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIG 122
           AVIYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRP+V  LPKIYQ LGLDYDE+VLPSIG
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 123 NEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSV 182
           NEVLK+IVAQFDAAELITQRE+VSQ+I+ EL+ RA+ F ++LEDV+ITHM FG EFTK+V
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 183 EKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEA 242
           E+KQIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AE+ISKAL K GDGLL+IRRLEA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 243 SKKIAQTLAGSSNITYLPSSSK---GGSHDACGTPSSLLLNLGR 283
           SK IAQTLA S N+TYLP  ++    G+     +P+SLLLN+GR
Sbjct: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  416 bits (1068), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 207/283 (73%), Positives = 250/283 (88%), Gaps = 1/283 (0%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           SR ++ I  +A+PIG+     Q  +YDV+GG+R VIFDR++GV+Q+VVGEGTHFL+PWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KA+IYDVRTKPK+IATNTGT+DLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLK+IVAQFDAAELITQRE++SQKIR+EL+ RA+ F IKLEDV+ITHM FG EFTK+
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE+KQIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AE+ISKAL K GDGLL+IRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKKIAQTLAGSSNITYLPSS-SKGGSHDACGTPSSLLLNLGR 283
           ASK IAQTLA SSN+ YLPS  S  GS D+ G+P+SLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  415 bits (1066), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 197/278 (70%), Positives = 241/278 (86%), Gaps = 3/278 (1%)

Query: 6   ENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVI 65
           E +A IA+P+GV +      +YDV+GG+RAVIFDR+ GV+Q VVGEGTHFL+PWLQK+VI
Sbjct: 8   EKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVI 67

Query: 66  YDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEV 125
           +D+RTKPKNI TNTGT+DLQ+V+LTLR+LHRPD++ LP IYQ LGLDYDERVLPSIGNEV
Sbjct: 68  FDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEV 127

Query: 126 LKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKK 185
           LK+IVAQFDAAELITQRE+VSQ+IR+EL  RA+ F I+LEDV+ITHM FG EFTK+VE+K
Sbjct: 128 LKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQK 187

Query: 186 QIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKK 245
           QIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AE IS+AL KAGDGLL+IRRLE SK+
Sbjct: 188 QIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKE 247

Query: 246 IAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           IA+TLAGS ++TYLP    GG+     + +SLLLNLGR
Sbjct: 248 IAETLAGSPHVTYLPG---GGNQAEDASKNSLLLNLGR 282

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  414 bits (1065), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 196/282 (69%), Positives = 245/282 (86%), Gaps = 1/282 (0%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           +R +  +  +A+P G+ + A    +YDV+GG+R VIFDR+SGV++ V+GEGTHFL+PWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KA+IYDVRTKPK+I+TNTGTKDLQ+V+LTLR+LHRP+V+ LP+IYQ LGLDYDERVLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLK+IVAQFDAAELITQRE+VSQ+IR+E++ RA+ F IKLEDV+ITHM FG EFTK+
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE+KQIAQQ++ERA++LV+ AEQER A+VIRAEG+AE+AE ISKAL++ GDGLL+IRRLE
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242

Query: 242 ASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           ASK IA+TL+ SSNITYLP   KG   D    P+SLLLN+GR
Sbjct: 243 ASKDIARTLSKSSNITYLP-GGKGREGDEKTPPNSLLLNIGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  414 bits (1064), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 213/286 (74%), Positives = 251/286 (87%), Gaps = 6/286 (2%)

Query: 1   MSRFLENIANIAVP---IGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLI 57
           MSR  +++  + +P   I +A  A Q  +YDVRGGTRA+IFDR+SGV+  VVGEGTHFLI
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 58  PWLQKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERV 117
           PWLQKA+I+DVRTKP+NIATNTGTKDLQ+V+LTLRVLHRPDV+AL +IY+ELG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 118 LPSIGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHE 177
           LPSIGNEVLKAIVAQF+A+ELITQRELVSQ+IR ELA+RA  F+I+LEDV+ITHM FG E
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 178 FTKSVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMI 237
           FTK+VE+KQIAQQES+RAK++V+ AEQER AAVIRAEG+AEAAE+ISKAL KAGDGLLMI
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 238 RRLEASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           RRLEASK IA+TLA S N+TYLP  SKG + D+ G P+SLLLNLGR
Sbjct: 241 RRLEASKGIAETLANSPNVTYLP--SKGQAADS-GAPNSLLLNLGR 283

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  414 bits (1063), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 211/282 (74%), Positives = 240/282 (85%), Gaps = 2/282 (0%)

Query: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61
           SR  E +A +A+P+G+     Q  +YDVRGG+RAVIFDRLSGVQQ+VVGEGTHFL+PWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121
           KAVIYDVRTKPK+IATNTGTKD+Q+V+LTLRVLHRP V+ LP IYQ LGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181
           GNEVLKAIVA++DAAELITQRELVS  IR EL+ RA  F I+LEDV+ITHM FG EFTK+
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241
           VE KQIAQQ++ERAK+LV+ AEQ R  +VIRAEG+AEAAE ISKAL KAGDGLL+IRRLE
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 242 ASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283
           ASK IAQTLA SSN+TYLPS   GG  +  GT  SLLLNLGR
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGGGQE--GTSQSLLLNLGR 282

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  409 bits (1050), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 250/284 (88%), Gaps = 1/284 (0%)

Query: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60
           MS+ +  ++ +A+P G+ I AA   +YDV+GG+R VIFDR+SGVQQ+VVGEGTHFL+PWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120
           QKA+IYDVR+KPK+IATNTGTKDLQ+V+LTLRVLHRP+V+ LP+IYQ LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180
           IGNEVLK+IVAQFDAAELITQRE+VSQ+IR+EL+ RA  F I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240
           +VE+KQIAQQ++ERAK+LV+ AEQ R A+VIRAEG+AE+AE ISKAL K GDGLL+IRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRL 240

Query: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHD-ACGTPSSLLLNLGR 283
           EASK+IA+TL+ SSN+TYLPS+  GG H    G+ ++LLLN+GR
Sbjct: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  353 bits (905), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 193/214 (90%)

Query: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60
           MSR  + +A IA+P+G+ + A Q  +YDVRGG RAVIFDRL GVQQ V+GEGTHFL+PWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120
           QK++++DVRTKPKNIATNTGTKDLQ+V+LTLRVLHRPDV+ LPKIYQ LG+DYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180
           IGNEVLKAIVAQFDAAELITQRE+VSQ+IR EL+KRA  FHIKLEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAE 214
           +VE+KQIAQQ++ERA++LV+ AEQER AAVIRAE
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  278 bits (712), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 181/232 (78%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           S +++V GG RA+++ RLSGV  K+  EGTHF+IPWLQ  +IYDVR KP+N+A+ TGTKD
Sbjct: 54  SSLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKD 113

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RPD+ +LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+
Sbjct: 114 LQMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRD 173

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F+I L+DV+IT M F  EFT +VE KQIAQQ+++RA +LV  A 
Sbjct: 174 KVSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRAR 233

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ SK IA+ LA SSN
Sbjct: 234 QEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDISKDIAKILATSSN 284

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  273 bits (698), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 186/244 (76%), Gaps = 1/244 (0%)

Query: 20  FAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNT 79
           F  Q  +++V GG RA+++ R++GV  ++  EGTHF++PWL+  ++YDVR KP+N+A+ T
Sbjct: 51  FLLQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLT 110

Query: 80  GTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELI 139
           GTKDLQ+V +T RVL RPDV +LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LI
Sbjct: 111 GTKDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLI 170

Query: 140 TQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLV 199
           TQRE VS+ IR+ L +RA  F+I L+DV+IT M F  EFT++VE KQIAQQ+++RA ++V
Sbjct: 171 TQREKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIV 230

Query: 200 QLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSNITYL 259
             A QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ +++IA+ LA S N   L
Sbjct: 231 DKARQEKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTAREIARILANSPNRVVL 289

Query: 260 PSSS 263
            + S
Sbjct: 290 DNES 293

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  272 bits (695), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 127/232 (54%), Positives = 182/232 (78%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           + +++V GG RA+++ RLSGVQQ V GEGTHF+IPWL+  V+YDVR+KP+ +++ TGT D
Sbjct: 56  ASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTND 115

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE
Sbjct: 116 LQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRE 175

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR  L +RA  F+I L+DV+IT+M F  EFT +VE KQ+AQQ+++RA + V+ A+
Sbjct: 176 SVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAK 235

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+ + +++A+G+A++AE I +A+ K+ D  + ++RL+ +++IA  LA S N
Sbjct: 236 QEKQSMIVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIAGILAASPN 286

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  270 bits (691), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 178/232 (76%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           + +++V GG RA+++ R+ GV  ++  EGTHF+ PWL   +IYDVR KP+N+A+ TGTKD
Sbjct: 56  NALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKD 115

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RPDV+ LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE
Sbjct: 116 LQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRE 175

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F+I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 176 KVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 235

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V+RA+G+A++AE I +A+ K+ D  + ++RL+ ++ IA+ LA S N
Sbjct: 236 QEKQGMVVRAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILASSPN 286

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  270 bits (689), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 182/240 (75%), Gaps = 1/240 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           S +++V GG RA+++ R+ GV  K+  EGTHF++PWL+  V+YDVR KP+N+A+ TGTKD
Sbjct: 59  SALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKD 118

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE
Sbjct: 119 LQMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRE 178

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L  RA  F++ L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A+
Sbjct: 179 KVSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAK 238

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSNITYLPSSS 263
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ +++IA  LA S N   L + S
Sbjct: 239 QEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIADILAKSPNRVVLDNES 297

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  270 bits (689), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 181/232 (78%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           S +++V GG RA+++ R+ G+QQ++  EGTHF +PWL+  ++YDVR KP+N+A+ TGTKD
Sbjct: 57  SALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKD 116

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE
Sbjct: 117 LQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRE 176

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F+I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 177 RVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 236

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ +++IA+ L+ S N
Sbjct: 237 QEKQGMVVKAQGEAQSAELIGEAIKKSKD-YVELKRLDTAREIAEILSKSPN 287

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  269 bits (688), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 125/232 (53%), Positives = 178/232 (76%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           + +++V GG RA+++ R+ GV  K+  EGTHF+ PWL   ++YDVR KP+N+A+ TGTKD
Sbjct: 56  NALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKD 115

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RPDV+ LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE
Sbjct: 116 LQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRE 175

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F+I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 176 KVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 235

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ ++ IA+ LA S N
Sbjct: 236 QEKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILASSPN 286

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  268 bits (685), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 122/232 (52%), Positives = 180/232 (77%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           + +++V GG RA+++ RL+GVQ ++  EGTHF IPWL+  ++YDVR KP+N+A+ TGTKD
Sbjct: 56  ASLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKD 115

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RPDV  LP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE
Sbjct: 116 LQMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQRE 175

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F++ L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 176 KVSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 235

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ +++IA  L+ S N
Sbjct: 236 QEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILSSSPN 286

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  268 bits (685), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 127/236 (53%), Positives = 180/236 (76%), Gaps = 1/236 (0%)

Query: 20  FAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNT 79
           F   + +++V GG RA+++ R+ GV  ++  EGTH L+PW +  V+YDVR KP+N+A+ T
Sbjct: 55  FFFNNALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLT 114

Query: 80  GTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELI 139
           GTKDLQ+V +T RVL RPDV  LP IY+ LGLDYDERVLPSI NEVLKA+VAQF+A++LI
Sbjct: 115 GTKDLQMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLI 174

Query: 140 TQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLV 199
           TQRE VS+ IR+ L +RA  F+I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V
Sbjct: 175 TQREKVSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVV 234

Query: 200 QLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
             A QE+   V++A+GDA++AE I +A+ K+ D  + ++RL+ +++IAQ L+ S N
Sbjct: 235 DRALQEKQGLVVKAQGDAKSAELIGEAIRKSKD-YVELKRLDTAREIAQILSRSPN 289

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  268 bits (684), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 180/241 (74%), Gaps = 1/241 (0%)

Query: 15  IGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKN 74
           +G       + +++V GG RA+++ R+ GV QK+  EGTH +IPW++  ++YDVR KP+N
Sbjct: 49  LGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRN 108

Query: 75  IATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFD 134
           +A+ TGTKDLQ+V +T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+
Sbjct: 109 VASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFN 168

Query: 135 AAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESER 194
           A++LITQRE VS+ IR  L +RA  F+I L+DV+IT+M F  EFT++VE KQIAQQ+++R
Sbjct: 169 ASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQR 228

Query: 195 AKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSS 254
           A ++V  A QE+   V++A+G+A++AE I  A+ K+ D  + ++RL+ +K IA+ LA S 
Sbjct: 229 AAFIVDKARQEKQGMVVKAQGEAKSAELIGDAIKKSRD-YVELKRLDTAKDIAKILANSP 287

Query: 255 N 255
           N
Sbjct: 288 N 288

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  267 bits (683), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 127/232 (54%), Positives = 176/232 (75%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           S +++V GG RA+++ R+ GV  K+  EGTHF+IPW++  VIYDVR KP+N+A+ TGTKD
Sbjct: 57  SALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKD 116

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+
Sbjct: 117 LQMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRD 176

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR  L  RA  F+I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 177 KVSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKAR 236

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ +K IA  LA S N
Sbjct: 237 QEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAKDIADILAKSPN 287

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  267 bits (682), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 123/234 (52%), Positives = 182/234 (77%), Gaps = 1/234 (0%)

Query: 22  AQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGT 81
           A   +++V GG RA+++ R++GVQ ++  EGTHF+IPW++  V+YDVR KP+N+++ TGT
Sbjct: 55  ANEALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGT 114

Query: 82  KDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQ+V +T RVL RP+V  LP IY+ LG+DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 142 RELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQL 201
           RE VS+ IR+ L +RA  F+I L+DV+IT+M F  EFT SVE KQIAQQ++++A ++V  
Sbjct: 175 RERVSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDK 234

Query: 202 AEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           A QE+   +++A+G+A++AE I +A+ K+ D  + ++RL+ +++IA  L+ S N
Sbjct: 235 ATQEKQGMIVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIASILSRSPN 287

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  266 bits (680), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 125/241 (51%), Positives = 181/241 (75%), Gaps = 1/241 (0%)

Query: 23  QSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTK 82
            S +++V GG RA+++ R+ GV  ++  EGTHF++PWL+  ++YDVR KP+N+A+ TGTK
Sbjct: 33  NSALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTK 92

Query: 83  DLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQR 142
           DLQ+V +T RVL RPDV  LP +Y+ LG DYD+RVLPSI NEVLK++VAQF+A++LITQR
Sbjct: 93  DLQMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQR 152

Query: 143 ELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLA 202
           E VS+ IR+ L +RA  F+I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A
Sbjct: 153 EKVSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKA 212

Query: 203 EQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSNITYLPSS 262
            QE+   V++A G+A++AE I +A+ K+ D  + ++RL+ +K+IA  LA S N   L + 
Sbjct: 213 RQEKQGMVVKAVGEAKSAELIGEAIKKSKD-YVELKRLDTAKEIATILAASPNRVVLDNE 271

Query: 263 S 263
           S
Sbjct: 272 S 272

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  266 bits (681), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 181/240 (75%), Gaps = 1/240 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           S +++V GG RA+++ R+SGV  K+  EGTHF+IPW++  +IYDVR KP+N+A+ TGTKD
Sbjct: 58  SSLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKD 117

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE
Sbjct: 118 LQMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQRE 177

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L  R+  F+I L+DV+IT M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 178 KVSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 237

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSNITYLPSSS 263
           QE+   V+RA+G+A++AE I +A+ K+ D  + ++RL+ +++IA  LA S N   L + S
Sbjct: 238 QEKQGMVVRAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILAKSPNRVVLDNES 296

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  266 bits (681), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 181/240 (75%), Gaps = 1/240 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           S +++V GG RA+++ R+SGV  ++  EGTHF IPW++  +IYDVR KP+N+A+ TGTKD
Sbjct: 61  SALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGTKD 120

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE
Sbjct: 121 LQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRE 180

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L  RA+ F+I L+DV+IT M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 181 KVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 240

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSNITYLPSSS 263
           QE+   V+RA+G+A++AE I  A+ K+ D  + ++RL+ +++IA+ LA S N   L + S
Sbjct: 241 QEKQGMVVRAQGEAKSAELIGDAIKKSKD-YVELKRLDTAREIARILAKSPNRVVLDNES 299

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  266 bits (681), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 125/232 (53%), Positives = 177/232 (76%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           + +++V GG RA+++ RL+GV  ++  EGTHF+ PW+   +IYDVR KP+N+A+ TGTKD
Sbjct: 56  NALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKD 115

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE
Sbjct: 116 LQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRE 175

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 176 KVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 235

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ ++ IA+ LA S N
Sbjct: 236 QEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTARDIAKILANSPN 286

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  266 bits (679), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 125/232 (53%), Positives = 177/232 (76%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           + +++V GG RA+++ R+ GV  K+  EGTHF+ PWL   +IYDVR KP+N+A+ TGTKD
Sbjct: 56  NALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKD 115

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE
Sbjct: 116 LQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQRE 175

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F+I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 176 KVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 235

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ ++ IA+ LA S N
Sbjct: 236 QEKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILANSPN 286

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  265 bits (677), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 179/232 (77%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           S +++V GG RA+I+ RL+GVQ ++  EGTHF IPW +  ++YDVR KP+N+A+ TGTKD
Sbjct: 56  SSLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKD 115

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RP+V  LP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE
Sbjct: 116 LQMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQRE 175

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F+I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 176 KVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKAR 235

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ +++IA  L+ S N
Sbjct: 236 QEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILSQSPN 286

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  263 bits (672), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 125/232 (53%), Positives = 177/232 (76%), Gaps = 1/232 (0%)

Query: 24  SCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPKNIATNTGTKD 83
           S +++V GG RA+++ R+ GV  ++  EGTH +IPWL+  V+YDVR KP+N+A+ TGTKD
Sbjct: 58  SALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGTKD 117

Query: 84  LQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQFDAAELITQRE 143
           LQ+V +T RVL RP+V  LP IY+ LG DY ERVLPSI NEVLKA+VAQF+A++LITQRE
Sbjct: 118 LQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQRE 177

Query: 144 LVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAE 203
            VS+ IR+ L +RA  F I L+DV+IT+M F  EFT +VE KQIAQQ+++RA ++V  A 
Sbjct: 178 KVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAR 237

Query: 204 QERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGSSN 255
           QE+   V++A+G+A++AE I +A+ K+ D  + ++RL+ +++IAQ LA S N
Sbjct: 238 QEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIAQILARSPN 288

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 53  THFLIPWLQKAVIYDVRTKPKNIATNT---GTKDLQIVTLTLRVLHRPDVIALPKIYQEL 109
           + F +P  +   I +VR +   +  N    G +   +  +  + L R D+   P +Y+ L
Sbjct: 244 SKFKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSL 303

Query: 110 GLDYDERVLPSIGNEVLKAI 129
            L+    VLP  GN +LK +
Sbjct: 304 VLNGGTTVLPGFGNRILKEL 323

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 162 IKLEDVAITHMVFGHEFTKSVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAE 221
           IKL DV+I++     + TKS+E     Q+ +ER++     + ++     ++     E+ E
Sbjct: 197 IKLRDVSISY----DQLTKSIESA-YQQKAAERSEAPANESHKDHFQTNMQPVTTGESIE 251

Query: 222 YISKALNKAGDGLLMIRRL 240
           YI   L KA D + M  R 
Sbjct: 252 YIKSLLLKASDFVTMFDRF 270

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,126,147
Number of extensions: 942077
Number of successful extensions: 3054
Number of sequences better than 10.0: 53
Number of HSP's gapped: 3123
Number of HSP's successfully gapped: 53
Length of query: 283
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 175
Effective length of database: 41,097,471
Effective search space: 7192057425
Effective search space used: 7192057425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)