Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12343.495ON1611618711e-121
AFR314W3.495ON1551505927e-79
KLLA0E04027g3.495ON1581513427e-41
Suva_7.4213.495ON1651583401e-40
Skud_7.4443.495ON1621593305e-39
NDAI0G009103.495ON1631573253e-38
SAKL0F02706g3.495ON1611533211e-37
Smik_6.2293.495ON1651593202e-37
YGR133W (PEX4)3.495ON1831583176e-37
TPHA0D042603.495ON1581523113e-36
Kpol_480.133.495ON1571513096e-36
KAFR0C019903.495ON1511483025e-35
TDEL0D056303.495ON1501503017e-35
TBLA0C045003.495ON1651502974e-34
NCAS0E007803.495ON1711632951e-33
KNAG0B007803.495ON1531552932e-33
CAGL0I10450g3.495ON1621612871e-32
ZYRO0D09878g3.495ON1531522852e-32
Kwal_55.212463.495ON1601522774e-31
KLTH0F14894g3.495ON1661522672e-29
Kpol_1065.127.54ON1591092235e-23
TPHA0J017506.109ON1691432229e-23
Suva_2.2183.308ON1481192182e-22
Skud_4.3143.308ON1481192182e-22
YDR059C (UBC5)3.308ON1481192182e-22
Suva_8.3897.54ON1561162183e-22
Skud_15.5047.54ON1561162183e-22
Smik_4.2973.308ON1481192174e-22
Kpol_461.86.109ON1671432175e-22
SAKL0A07260g6.109ON1691432166e-22
Ecym_30776.109ON1701432167e-22
ZYRO0C04950g6.109ON1681382167e-22
AAR156C6.109ON1701432167e-22
Smik_7.2226.109ON1711432167e-22
TDEL0G036106.109ON1691432167e-22
Suva_7.2136.109ON1731432167e-22
YGL058W (RAD6)6.109ON1721432168e-22
KLLA0C05632g6.109ON1641382159e-22
CAGL0I00352g6.109ON1671432159e-22
NCAS0D032206.109ON1711432151e-21
Kwal_14.18286.109ON1521052112e-21
TBLA0F024406.109ON1741382133e-21
NDAI0D011401.436ON2451112173e-21
Suva_4.3263.308ON1481192095e-21
ZYRO0C03784g8.375ON2181422135e-21
KLTH0H06732g6.109ON1601052105e-21
YEL012W (UBC8)1.436ON2181112137e-21
Smik_5.981.436ON2151112127e-21
KAFR0A047006.109ON1531052088e-21
CAGL0E00671g8.375ON2131422128e-21
CAGL0E04752g3.308ON1471192078e-21
Suva_5.531.436ON2151112129e-21
KNAG0F025706.109ON1511052079e-21
Skud_2.2073.308ON1481192071e-20
Smik_2.2193.308ON1481192071e-20
YBR082C (UBC4)3.308ON1481192071e-20
Skud_7.2226.109ON1701432081e-20
Kpol_1030.181.436ON2231112111e-20
TDEL0H039707.54ON1561532071e-20
NCAS0A108003.308ON1481192061e-20
NDAI0A054903.308ON1471192061e-20
ZYRO0D04466g7.54ON1591542071e-20
KAFR0C002703.308ON1471352052e-20
KNAG0H018701.436ON2101112102e-20
CAGL0M03399g1.436ON2141142102e-20
ADR169C8.375ON2111422092e-20
KLTH0E14300g3.308ON1471192052e-20
SAKL0B06512g3.308ON1471192052e-20
Ecym_74313.308ON1471192052e-20
AER173C3.308ON1471192052e-20
TPHA0L008508.375ON2161422092e-20
YOR339C (UBC11)7.54ON1561162052e-20
KLLA0E12563g3.308ON1481192042e-20
Kpol_1052.23.308ON1481192042e-20
Suva_2.3438.375ON2151422083e-20
Smik_4.4258.375ON2151422083e-20
YDR177W (UBC1)8.375ON2151422083e-20
TBLA0H031308.375ON2141542083e-20
NCAS0G031301.436ON2311132093e-20
TPHA0A038503.308ON1481192043e-20
Skud_5.871.436ON2101132073e-20
KNAG0J023403.308ON1611132043e-20
Skud_4.4418.375ON2151422084e-20
NDAI0E038707.54ON1641542044e-20
TDEL0F021003.308ON1471192025e-20
KAFR0B060608.375ON2131422075e-20
Smik_15.5177.54ON1561132035e-20
KLLA0C18656g8.375ON2281532075e-20
KNAG0A048108.375ON2141422066e-20
ZYRO0G12870g3.308ON1471192026e-20
TBLA0I021303.308ON1481192026e-20
Kwal_27.124013.308ON2361192069e-20
KLLA0A11198g1.436ON2021102031e-19
Ecym_60388.375ON2111422041e-19
SAKL0D10560g1.436ON2071112022e-19
KLTH0A07546g8.375ON2151482032e-19
Kpol_1030.108.375ON2151472032e-19
KAFR0H029601.436ON1871112012e-19
TPHA0O009201.436ON2261112032e-19
Kwal_23.64858.375ON2151482022e-19
TBLA0A012901.436ON2191112023e-19
TDEL0B056701.436ON2031112003e-19
ZYRO0E03806g1.436ON2091112004e-19
NCAS0B031508.375ON2141421988e-19
TDEL0F049908.375ON2171421988e-19
NDAI0I016506.109ON1761431968e-19
KLTH0H13816g1.436ON2331111981e-18
NDAI0A011608.375ON2161421971e-18
AEL045W1.436ON2111111952e-18
SAKL0A00396g8.375ON2151421927e-18
Ecym_13481.436ON2111111919e-18
Kwal_34.161741.436ON2131111873e-17
TPHA0B007704.249ON1571141843e-17
CAGL0D00814g4.249ON1571141834e-17
Ecym_32704.249ON1571181826e-17
KAFR0H012303.308ON1101011796e-17
Kwal_26.70097.54ON1611381783e-16
KLTH0D01760g7.54ON1611441783e-16
CAGL0M07568g2.569ON1651531783e-16
SAKL0H03058g4.249ON1571191774e-16
TPHA0I024602.569ON1671521774e-16
AER056C4.249ON1571181764e-16
KLTH0D14344g4.249ON1571181757e-16
SAKL0B10582g7.54ON1611501757e-16
NCAS0A024904.249ON1571181749e-16
Smik_4.1714.249ON1571131731e-15
ZYRO0B12386g4.249ON1571021731e-15
Smik_13.1862.569ON1651251732e-15
KNAG0D043904.249ON1571151722e-15
Kpol_483.164.249ON1221141702e-15
TDEL0E012204.249ON1571151722e-15
Skud_13.1762.569ON1651251722e-15
Suva_13.1892.569ON1651251722e-15
YMR022W (UBC7)2.569ON1651251722e-15
Kwal_23.42274.249ON1221141693e-15
YDL064W (UBC9)4.249ON1571191713e-15
YDR092W (UBC13)8.230ON1531111703e-15
Suva_4.1864.249ON1571191704e-15
Skud_4.3528.230ON1431001677e-15
Skud_4.1914.249ON1571191687e-15
KLTH0D07986g2.569ON1651491687e-15
AGR121C8.230ON1541001688e-15
Suva_2.2538.230ON1431001678e-15
Smik_4.3358.230ON1431001678e-15
TDEL0B065702.569ON1651561681e-14
NDAI0D043804.249ON1571151671e-14
Ecym_55638.230ON1641081671e-14
ZYRO0E06358g2.569ON1651511671e-14
Kwal_26.82242.569ON1651531671e-14
TBLA0I029604.249ON1571181662e-14
SAKL0H17930g8.230ON1531001652e-14
SAKL0D13552g2.569ON1651501652e-14
ZYRO0B11682g8.230ON151901642e-14
KNAG0H029808.230ON1521081642e-14
Kpol_1075.1b8.230ON1521081642e-14
TDEL0A013408.230ON1571081634e-14
NCAS0A127402.569ON1651541634e-14
Kpol_1056.52.569ON1651601634e-14
NCAS0A059404.49ON1931071646e-14
KAFR0G032404.249ON1571191617e-14
CAGL0G08063g8.230ON1491061617e-14
KLLA0C17622g8.230ON1591001601e-13
KAFR0A024208.230ON1471001591e-13
KLLA0E05039g4.249ON1571191601e-13
Kwal_56.234828.230ON1491001591e-13
NDAI0J015408.230ON1541011582e-13
KLTH0G14366g8.230ON1491001582e-13
TPHA0B034108.230ON152901573e-13
KAFR0A021602.569ON1651291573e-13
SAKL0D02530g3.301ON2721641614e-13
TBLA0H026102.569ON1651241565e-13
ABR059W2.569ON1651481565e-13
NDAI0B015202.569ON1651511557e-13
NCAS0B040108.230ON153901547e-13
TBLA0F037908.230ON151901548e-13
KLLA0E07745g2.569ON1651581549e-13
Ecym_45782.569ON1651471532e-12
AGL203C3.301ON2701641562e-12
Ecym_26693.301ON2681641544e-12
Kwal_27.104443.301ON2781641544e-12
KNAG0M021502.569ON1701251487e-12
KLTH0C04818g3.301ON2751641527e-12
NDAI0A055303.301ON2731641528e-12
NCAS0A107703.301ON2731641501e-11
TBLA0E015704.49ON1941091437e-11
Smik_12.3894.49ON1871041427e-11
Smik_4.2903.301ON2971641458e-11
Skud_4.3063.301ON2971641459e-11
YDR054C (CDC34)3.301ON2951641441e-10
Suva_10.4014.49ON1871131411e-10
TPHA0M012803.301ON4351611451e-10
Suva_2.2113.301ON2971641431e-10
TDEL0D032603.301ON2891641432e-10
ZYRO0G12650g3.301ON2851641413e-10
Kpol_1065.453.301ON3231641423e-10
KAFR0H012703.301ON2871641403e-10
KNAG0H010403.301ON2961121394e-10
TPHA0F003904.49ON1931021358e-10
Skud_12.3894.49ON1871041358e-10
TBLA0G032703.301ON3301091389e-10
KLLA0D09196g3.301ON2921591371e-09
CAGL0E04598g3.301ON2951121352e-09
TDEL0E055604.49ON1871141313e-09
NDAI0A075703.301ON2391121323e-09
KLLA0C17248g4.49ON1841061295e-09
CAGL0D06468g4.49ON1871021286e-09
NCAS0I014303.301ON2581041307e-09
ZYRO0G19910g4.49ON1791121271e-08
KNAG0J022803.301ON2171281281e-08
NDAI0D029104.49ON1891111252e-08
Kpol_414.2singletonOFF1921141234e-08
Kpol_YGOB_414.24.49ON1931141234e-08
YLR306W (UBC12)4.49ON188851234e-08
SAKL0H24112g4.49ON185841201e-07
KNAG0I029404.49ON1971031182e-07
CAGL0H03157g6.187ON1391221153e-07
KAFR0F030404.49ON1691271146e-07
ADL035C4.49ON200881131e-06
Suva_7.1826.187ON1371211064e-06
Skud_7.1956.187ON100881045e-06
TPHA0J022506.187ON1371201031e-05
YGL087C (MMS2)6.187ON1371211031e-05
Smik_7.1966.187ON100881011e-05
KLTH0H09504g4.49ON1841061042e-05
KLLA0E19119g6.187ON1391211022e-05
Ecym_83714.49ON2671121034e-05
SAKL0A05192g6.187ON140121994e-05
ZYRO0G08228g6.187ON138122995e-05
AFL064W6.187ON138119986e-05
KLTH0H04796g6.187ON138121961e-04
Kwal_27.111826.187ON10189941e-04
TDEL0G015806.187ON138122943e-04
Kpol_1002.656.187ON10189906e-04
NDAI0A016507.392ON251148910.001
YER100W (UBC6)7.392ON250118900.002
KNAG0F021306.187ON138121880.002
Smik_5.2467.392ON250118900.002
Ecym_22306.187ON138119870.002
KLLA0E20395g7.392ON251117890.002
Suva_5.2197.392ON249118890.002
Ecym_46837.392ON243118890.002
Skud_5.2257.392ON250117870.004
SAKL0F12474g7.392ON251118870.005
TBLA0D006007.392ON25686860.006
AGR372W7.392ON242118850.007
TBLA0A019006.187ON139123830.007
Kpol_1045.397.392ON253118840.009
KAFR0C021406.187ON138122820.012
NCAS0D036606.187ON138122810.012
NDAI0I012306.187ON157121810.015
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1234
         (161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   340   e-121
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   232   7e-79
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   136   7e-41
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   135   1e-40
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   131   5e-39
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   129   3e-38
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   128   1e-37
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   127   2e-37
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   126   6e-37
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   124   3e-36
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   123   6e-36
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   120   5e-35
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   120   7e-35
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   119   4e-34
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   118   1e-33
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   117   2e-33
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   115   1e-32
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   114   2e-32
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   111   4e-31
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   107   2e-29
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    91   5e-23
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    90   9e-23
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    89   2e-22
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    89   2e-22
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    89   2e-22
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    89   3e-22
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    89   3e-22
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    88   4e-22
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    88   5e-22
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    88   6e-22
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    88   7e-22
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    88   7e-22
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    88   7e-22
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    88   7e-22
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    88   7e-22
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    88   7e-22
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    88   8e-22
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    87   9e-22
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    87   9e-22
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      87   1e-21
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    86   2e-21
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    87   3e-21
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    88   3e-21
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    85   5e-21
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    87   5e-21
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    86   5e-21
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    87   7e-21
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    86   7e-21
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    85   8e-21
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    86   8e-21
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    84   8e-21
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    86   9e-21
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    84   9e-21
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    84   1e-20
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    84   1e-20
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    84   1e-20
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    85   1e-20
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    86   1e-20
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    84   1e-20
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    84   1e-20
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    84   1e-20
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    84   1e-20
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    84   2e-20
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    86   2e-20
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    86   2e-20
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    85   2e-20
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    84   2e-20
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    84   2e-20
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    84   2e-20
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    84   2e-20
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    85   2e-20
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    84   2e-20
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    83   2e-20
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    83   2e-20
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    85   3e-20
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    85   3e-20
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    85   3e-20
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    85   3e-20
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                85   3e-20
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    83   3e-20
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    84   3e-20
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    83   3e-20
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    85   4e-20
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    83   4e-20
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    82   5e-20
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    84   5e-20
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    83   5e-20
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    84   5e-20
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    84   6e-20
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    82   6e-20
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    82   6e-20
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    84   9e-20
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    83   1e-19
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    83   1e-19
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    82   2e-19
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    83   2e-19
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    83   2e-19
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    82   2e-19
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    83   2e-19
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    82   2e-19
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    82   3e-19
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    82   3e-19
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    82   4e-19
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      81   8e-19
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    81   8e-19
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      80   8e-19
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    81   1e-18
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      80   1e-18
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    80   2e-18
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    79   7e-18
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    78   9e-18
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    77   3e-17
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    75   3e-17
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    75   4e-17
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    75   6e-17
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    74   6e-17
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    73   3e-16
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    73   3e-16
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    73   3e-16
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    73   4e-16
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    73   4e-16
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    72   4e-16
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    72   7e-16
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    72   7e-16
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    72   9e-16
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    71   1e-15
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    71   1e-15
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    71   2e-15
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    71   2e-15
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    70   2e-15
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    71   2e-15
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    71   2e-15
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    71   2e-15
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    71   2e-15
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    70   3e-15
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    70   3e-15
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    70   3e-15
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    70   4e-15
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    69   7e-15
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    69   7e-15
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    69   7e-15
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    69   8e-15
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    69   8e-15
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    69   8e-15
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    69   1e-14
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    69   1e-14
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    69   1e-14
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    69   1e-14
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    69   1e-14
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    69   2e-14
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    68   2e-14
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    68   2e-14
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    68   2e-14
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    68   2e-14
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    68   2e-14
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    67   4e-14
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    67   4e-14
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    67   4e-14
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     68   6e-14
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    67   7e-14
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    67   7e-14
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    66   1e-13
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    66   1e-13
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    66   1e-13
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    66   1e-13
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    65   2e-13
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    65   2e-13
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    65   3e-13
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    65   3e-13
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    67   4e-13
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    65   5e-13
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    65   5e-13
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    64   7e-13
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    64   7e-13
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    64   8e-13
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    64   9e-13
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    64   2e-12
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    65   2e-12
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    64   4e-12
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    64   4e-12
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    62   7e-12
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    63   7e-12
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    63   8e-12
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    62   1e-11
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    60   7e-11
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    59   7e-11
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    60   8e-11
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    60   9e-11
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    60   1e-10
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    59   1e-10
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    60   1e-10
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    60   1e-10
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    60   2e-10
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    59   3e-10
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    59   3e-10
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                59   3e-10
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                58   4e-10
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    57   8e-10
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    57   8e-10
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    58   9e-10
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    57   1e-09
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    57   2e-09
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    55   3e-09
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    55   3e-09
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    54   5e-09
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    54   6e-09
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                55   7e-09
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    54   1e-08
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    54   1e-08
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       53   2e-08
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    52   4e-08
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    52   4e-08
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    52   4e-08
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    51   1e-07
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    50   2e-07
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    49   3e-07
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    49   6e-07
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    48   1e-06
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    45   4e-06
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    45   5e-06
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    44   1e-05
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    44   1e-05
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    44   1e-05
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    45   2e-05
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    44   2e-05
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    44   4e-05
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    43   4e-05
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    43   5e-05
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    42   6e-05
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    42   1e-04
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    41   1e-04
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    41   3e-04
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    39   6e-04
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    40   0.001
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    39   0.002
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    39   0.002
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    39   0.002
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    38   0.002
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    39   0.002
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    39   0.002
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    39   0.002
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    38   0.004
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    38   0.005
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    38   0.006
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    37   0.007
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    37   0.007
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    37   0.009
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    36   0.012
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    36   0.012
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    36   0.015
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    36   0.019
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    36   0.024
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    36   0.024
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    35   0.033
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    35   0.044
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    34   0.10 
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    33   0.14 
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    33   0.14 
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    33   0.19 
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    32   0.33 
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    32   0.38 
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    31   1.7  
KLLA0B13068g Chr2 complement(1140423..1142438) [2016 bp, 671 aa]...    29   5.4  
KLTH0B05104g Chr2 (420999..423680) [2682 bp, 893 aa] {ON} simila...    29   6.9  

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  340 bits (871), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFT 60
           MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFT
Sbjct: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFT 60

Query: 61  FTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAI 120
           FTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAI
Sbjct: 61  FTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAI 120

Query: 121 RTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
           RTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL
Sbjct: 121 RTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  232 bits (592), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 124/150 (82%), Gaps = 1/150 (0%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69
           R+L EYKQ+++QL  H ++L L P G+  G L +WEA F GPENTPYA FTFTL I +PE
Sbjct: 3   RILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINVPE 62

Query: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGV 129
            YPNEPP C FPP+HICHPNIKWSTGEVCLDLLKHE WSP+YNLLQVVEAI TLLAEPGV
Sbjct: 63  TYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGV 122

Query: 130 DSPLDVDLAKLYSVDKQAYQGLVTYRLCSR 159
           DSPLDVDL++LY+ D+ AY G+V YRL +R
Sbjct: 123 DSPLDVDLSRLYTTDRAAYDGVVNYRLRTR 152

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  136 bits (342), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 99/151 (65%), Gaps = 6/151 (3%)

Query: 10  SRMLAEYKQIREQLQSHES--ILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           SR++ EY  ++++LQ+ E   I  L P  D   LS+W  +F GP  +P+  F   L+I I
Sbjct: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDD-DLSEWVCRFQGPSESPFEGFELGLNITI 60

Query: 68  P-EMYP-NEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
             E YP +  P   F P  + HPN+KW TGE+CLDLLK + W+P+Y LL VV AIR LLA
Sbjct: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDLLA 119

Query: 126 EPGVDSPLDVDLAKLYSVDKQAYQGLVTYRL 156
           +PG+DSPLD+D+A++Y  D +AY  +V YRL
Sbjct: 120 DPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  135 bits (340), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 71/158 (44%), Positives = 95/158 (60%), Gaps = 8/158 (5%)

Query: 10  SRMLAEYKQIREQLQS-------HESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFT 62
           SR+  EY+ IR+ L S       +  I+      D   LSKWEA  CGPE+TPY  + F 
Sbjct: 2   SRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFR 61

Query: 63  LSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRT 122
           + I++P+ YP  PP   F  + I H NI  STGE+CLD+LK + W+P+++LL  V A+  
Sbjct: 62  MLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWR 121

Query: 123 LLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCSR 159
           LL EP  DSPLDVD+  +    DK+AYQG+V Y L  R
Sbjct: 122 LLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAER 159

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  131 bits (330), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 95/159 (59%), Gaps = 10/159 (6%)

Query: 10  SRMLAEYKQIREQLQSHESIL--------MLCPAGDGGSLSKWEAQFCGPENTPYADFTF 61
           SR+  EY  I++ L S++ I+         L P  D   LSKWEA   GP +TPY  + F
Sbjct: 2   SRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPI-DETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 62  TLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIR 121
            + I++P  YP  PPN RF  N+I H NIK  TGE+CLD+LK E W+P+++LL  V AI 
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120

Query: 122 TLLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCSR 159
            LL EP  DSPLDVD+  +    D  AYQG++ Y L  R
Sbjct: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAER 159

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  129 bits (325), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 67/157 (42%), Positives = 95/157 (60%), Gaps = 10/157 (6%)

Query: 10  SRMLAEYKQIREQLQSHES---------ILMLCPAGDGGSLSKWEAQFCGPENTPYADFT 60
           SR++ EYK I++QL ++ +         I+ L P      L+KWEA   GP+ TPY  F 
Sbjct: 2   SRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFN 61

Query: 61  FTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAI 120
           F L I IP+ YP  PP   F P  + H N+ ++TGE+CLD+LK + W+P++NL+  ++AI
Sbjct: 62  FILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAI 121

Query: 121 RTLLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRL 156
             LL +P  +SPL+VDLA L    D  AY GL+ Y L
Sbjct: 122 WLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYL 158

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  128 bits (321), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 96/153 (62%), Gaps = 8/153 (5%)

Query: 11  RMLAEYKQIREQLQ---SHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+  E+K +R+ L    S+  IL L P  D G++  W A   GP  TPYA   F L +E+
Sbjct: 5   RITKEFKSVRKTLAEDPSYNHILKLEPK-DTGNMYHWIADISGPPETPYASAVFALDVEL 63

Query: 68  PEMYPNEPPNCRFPP---NHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLL 124
           P  YP EPP  +F P   N+ICH N+ + TGE+CLD+L  E WSP+++L+ V+ AI  LL
Sbjct: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123

Query: 125 AEPGVDSPLDVDLAK-LYSVDKQAYQGLVTYRL 156
            EP  +SPL+VD+A  L + D +AY+GL+ Y +
Sbjct: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  127 bits (320), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (59%), Gaps = 10/159 (6%)

Query: 10  SRMLAEYKQIREQLQSHESIL--------MLCPAGDGGSLSKWEAQFCGPENTPYADFTF 61
           SR+  EY+ I + L S + I+         L P  D   LS+WEA+  GP +TPY ++ F
Sbjct: 2   SRITKEYRVILKTLASDDPIVNPYRGIIRSLNPI-DETDLSRWEAKIYGPSHTPYENYQF 60

Query: 62  TLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIR 121
            + I++P  YP  PP   F  N I H N+K +TGE+CLD+LK E W+P+++LL  V A+ 
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120

Query: 122 TLLAEPGVDSPLDVDLAKLYS-VDKQAYQGLVTYRLCSR 159
            LL EP  DSPLDVD+  +    D+ AYQG+V Y L  R
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAER 159

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  126 bits (317), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 92/158 (58%), Gaps = 8/158 (5%)

Query: 10  SRMLAEYKQIREQLQS-------HESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFT 62
           SR++ EYK I + L S       +  I+      D   LSKWEA   GP +TPY +  F 
Sbjct: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79

Query: 63  LSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRT 122
           + IE+P  YP  PP   F  N+I H N+K +TGE+CL++LK E W+P+++LL  V A+  
Sbjct: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139

Query: 123 LLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCSR 159
           LL EP  DSPLDVD+  +    D  AYQG+V Y L  R
Sbjct: 140 LLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAER 177

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  124 bits (311), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 95/152 (62%), Gaps = 3/152 (1%)

Query: 11  RMLAEYKQIREQLQSH-ESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69
           R+L E + I ++L  + ESI +L P      L KW A   GP NTPY   +F L IE+P 
Sbjct: 5   RLLKEKRLIEKELSGYSESIELLEPVAFENFL-KWRAVLKGPVNTPYHKHSFKLLIELPS 63

Query: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGV 129
            YP  PP   F P  + H N+++STG++CL++L+HE WSP++NL+ V+ A+  LL EP V
Sbjct: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123

Query: 130 DSPLDVDLAK-LYSVDKQAYQGLVTYRLCSRT 160
           DSPL++DLA  L + D  AY GL+ Y L   T
Sbjct: 124 DSPLNIDLANILRAGDTSAYHGLINYYLQEDT 155

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  123 bits (309), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 94/151 (62%), Gaps = 1/151 (0%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+L EY+ ++++L +H++I+      D   L+ W A   GP NTPY   +F L I +   
Sbjct: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPE 64

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVD 130
           YP +PP   F    + H NI++ TG++CL++L +  WSP++NLL VV AI  LL++P  D
Sbjct: 65  YPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTD 124

Query: 131 SPLDVDLAKLYSV-DKQAYQGLVTYRLCSRT 160
           SPL++DL+ +  + D  AY GL+ Y L +++
Sbjct: 125 SPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  120 bits (302), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 92/148 (62%), Gaps = 5/148 (3%)

Query: 10  SRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69
           SR+L EYK  R  LQS + IL L P      L+ WE    GP ++P+A+ TF L I+IP+
Sbjct: 3   SRILKEYKDSR-SLQS-QYILALDPIS-TDDLTHWECTIKGPLHSPFANHTFKLRIDIPQ 59

Query: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGV 129
            YP   P C+F P  + HPN+ + TGE+CLD+L    WSP++N+  +VEAI  LL EP  
Sbjct: 60  TYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPNF 118

Query: 130 DSPLDVDLAKLYSVDK-QAYQGLVTYRL 156
            SPL++DLA L   D  +AY  L++Y L
Sbjct: 119 KSPLNLDLANLLRFDDLKAYHDLISYHL 146

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  120 bits (301), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 90/150 (60%), Gaps = 2/150 (1%)

Query: 10  SRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69
           +R+  EYK I+  L S  S+++     DG  LS+W  +  GP  TPY   TF+L + + +
Sbjct: 2   ARIAREYKHIQATLGSESSLVVSLEPIDG-DLSRWAGEIRGPTGTPYEGHTFSLRLVLGD 60

Query: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGV 129
            YP  PP   F    + H N+ + TG +CL++L  E WSP ++LL V+EAI  LL++P  
Sbjct: 61  RYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEP 120

Query: 130 DSPLDVDLAK-LYSVDKQAYQGLVTYRLCS 158
           DSPLD+DLA  L + D+ AY GLV Y L S
Sbjct: 121 DSPLDIDLANILRAQDRSAYYGLVNYYLQS 150

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  119 bits (297), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 96/150 (64%), Gaps = 3/150 (2%)

Query: 10  SRMLAEYKQIREQLQSHESILMLCPAGDGGS-LSKWEAQFCGPENTPYADFTFTLSIEIP 68
           SR++ EY  IR+     +++  L P  +  S LS W +   GP+++PY + +F L I IP
Sbjct: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61

Query: 69  EMYPNEPPNCRFPPNHIC-HPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127
             YP+ PP  +F  N I  H N+ ++TGE+CL++LK+E WSP++NLL  V+AI  LLA P
Sbjct: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121

Query: 128 GVDSPLDVDLAKLYSV-DKQAYQGLVTYRL 156
              SPL++DL++L ++ D +AY  L+ Y L
Sbjct: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  118 bits (295), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 93/163 (57%), Gaps = 15/163 (9%)

Query: 10  SRMLAEYKQIREQLQSHES-------------ILMLCPAGDGGSLSKWEAQFCGPENTPY 56
           SR+L EYK+I+  L  + +             I  L P      L+ W+AQ  GP+ TPY
Sbjct: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPIS-TSDLTHWQAQIKGPQGTPY 60

Query: 57  ADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQV 116
           A+  F L IE P  YP EPP   F P  + H N+ + TG +CLD+L+ + W+P +NL+  
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 117 VEAIRTLLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCS 158
           ++AI  LL +P  DSPL+VD+A +  V D+ AY GL+ Y L +
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSA 163

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  117 bits (293), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 93/155 (60%), Gaps = 6/155 (3%)

Query: 9   ASRMLAEYKQ-IREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           + R+L EY++ +     ++ES L      D   L+ WEA   GP+ TPY   +F L + +
Sbjct: 2   SQRVLREYRRLVAAGGAANESNLHPT---DPADLTHWEATLEGPQGTPYEGHSFPLRVTV 58

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127
           P+ YP  PP+  FP   + HPN+KW TGEVCLD L    W+P+ +L   V A+R LLAEP
Sbjct: 59  PDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEP 117

Query: 128 GVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCSRTL 161
             +SPL+++LA L  + D +AY G++ YRL   ++
Sbjct: 118 NPESPLNLELAALSRLGDHKAYDGIIKYRLAHSSI 152

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  115 bits (287), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 93/161 (57%), Gaps = 18/161 (11%)

Query: 10  SRMLAEYKQIREQLQSHES--ILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           +R+  E  +IR+ L+  +S  ++ L P  D   LS+W A   GP  TPY  + F L+IE+
Sbjct: 2   ARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIEV 60

Query: 68  PEMYPNEPPNCRF----------PPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVV 117
           P  YP  PP  +F          PP    H N+   TGE+CLD+LK E WSP++++L VV
Sbjct: 61  PASYPMVPPTIKFVSDAKAGIRVPP----HCNVDRRTGEICLDILKPEGWSPIWDILHVV 116

Query: 118 EAIRTLLAEPGVDSPLDVDLAK-LYSVDKQAYQGLVTYRLC 157
           +AI  LL EP  DSPLDVD+A  L + D  AY G++ Y L 
Sbjct: 117 QAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLT 157

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  114 bits (285), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 85/152 (55%), Gaps = 3/152 (1%)

Query: 10  SRMLAEYKQIREQLQSHESILMLCPAG--DGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           SR   EYK I + L+  + +      G      L++WEA   GP  TPY    F L + +
Sbjct: 2   SRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSL 61

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127
           P+ YP  PP  +F P  + H N+ + TGE+CLD+L  + WSP ++LL VV+AI  LL EP
Sbjct: 62  PQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEP 121

Query: 128 GVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCS 158
              SPL+VD+A +    D  AY GLV Y + S
Sbjct: 122 VSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  111 bits (277), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 87/152 (57%), Gaps = 5/152 (3%)

Query: 9   ASRMLAEYKQIREQLQ---SHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSI 65
           + R+  EYK + + L+   ++  I  L P  D  +L  WEA   GP +TPY    F+L I
Sbjct: 2   SQRLAKEYKTLLKTLKEDPAYSHIRKLRPVSDD-NLYVWEADITGPSDTPYQGHEFSLLI 60

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
            IP  YP EPP  +F    + H N+ + +G +C++LL+   WSP ++LL +V AI  LLA
Sbjct: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLA 120

Query: 126 EPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRL 156
            P  DSPLDVDLA L    D  A+ GLV Y L
Sbjct: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYL 152

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  107 bits (267), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 85/152 (55%), Gaps = 5/152 (3%)

Query: 9   ASRMLAEYKQIREQLQ---SHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSI 65
           + R+  EY+ + + L     +  I+ L P  +  +L KWE+   GP +TPY    FTL I
Sbjct: 2   SQRLAKEYRALSKTLGRDPEYAYIISLAPVSEE-NLRKWESLITGPPDTPYFGHEFTLQI 60

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YP EPP  +F    + H N+ + +G +CL +L    W+P ++LL VV AI  LLA
Sbjct: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120

Query: 126 EPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRL 156
            P  DSPLDVDLA L    D+ A+  L+ Y L
Sbjct: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 90.5 bits (223), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L+KW     GP+++PYA   F +S+  P+ YP EPP  +F  + + HPN+  S G +CL
Sbjct: 41  NLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKF-VSPMWHPNVDLS-GNICL 98

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAY 148
           D+LK E WS +YN+  ++ +++ LL EP   SPL+   A+L+  DK+ Y
Sbjct: 99  DVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNAIAAELWDGDKEEY 146

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 90.1 bits (222), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 82/143 (57%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G  GS     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSGSPLPDNVMIWNAMIIGPSDTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-ISEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            S+G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A++Y  DK  Y+ 
Sbjct: 81  -SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEA 137

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            S+G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A++Y  DK  Y+ 
Sbjct: 81  -SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEA 137

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            S+G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A++Y  DK  Y+ 
Sbjct: 81  -SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEA 137

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 88.6 bits (218), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 69/116 (59%), Gaps = 3/116 (2%)

Query: 37  DGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGE 96
           D   L+ W     GP+ TPY+D  F +S+  PE YP  PP  +F  + + HPN+  S G 
Sbjct: 34  DDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKF-VSPMWHPNVDMS-GN 91

Query: 97  VCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           +CLD+LK E WS +YN+  ++ ++++LL EP   SPL+   A+L+  D + Y+  V
Sbjct: 92  ICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDKDMEEYKKKV 146

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 88.6 bits (218), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 69/116 (59%), Gaps = 3/116 (2%)

Query: 37  DGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGE 96
           D   L+ W     GP+ TPY+D  F +S+  PE YP  PP  +F  + + HPN+   +G 
Sbjct: 34  DDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKF-VSPMWHPNVD-KSGN 91

Query: 97  VCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           +CLD+LK E WS +YN+  ++ ++++LL EP   SPL+   A+L+  D + Y+  V
Sbjct: 92  ICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDKDMEGYKKKV 146

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 88.2 bits (217), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            S+G +CLD+LK + WSP   L +V+ ++ +LL +   D PL  ++A++Y  DK  Y+ 
Sbjct: 81  -SSGNICLDILKDQ-WSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYKTDKAKYEA 137

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 88.2 bits (217), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-VSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 87.8 bits (216), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 87.8 bits (216), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 87.8 bits (216), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 82/138 (59%), Gaps = 8/138 (5%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R++ ++K+++E      S     P  D  ++  W A   GP +TPY D TF L +E  E 
Sbjct: 8   RLMRDFKRMKEDAPPGVSA---SPLPD--NVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVD 130
           YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  +P   
Sbjct: 63  YPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPNPA 119

Query: 131 SPLDVDLAKLYSVDKQAY 148
           SP +V+ A L+   K  Y
Sbjct: 120 SPANVEAATLFKDHKSQY 137

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 87.8 bits (216), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 87.8 bits (216), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 87.8 bits (216), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 87.8 bits (216), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 87.8 bits (216), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 87.4 bits (215), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 81/138 (58%), Gaps = 8/138 (5%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R++ ++K+++E      S     P  D   +  W A   GP +TPY D TF L +E  E 
Sbjct: 8   RLMRDFKRMKEDSPPGVSA---SPLPDNVMI--WNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVD 130
           YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  +P   
Sbjct: 63  YPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFNDPNPA 119

Query: 131 SPLDVDLAKLYSVDKQAY 148
           SP +V+ A L+   K  Y
Sbjct: 120 SPANVEAATLFQDHKSQY 137

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 87.4 bits (215), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 81/143 (56%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------SPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEDYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 87.4 bits (215), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 80/143 (55%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP  TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 85.9 bits (211), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 66/105 (62%), Gaps = 3/105 (2%)

Query: 44  WEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLK 103
           W A   GP  TPY D TF L +E  E YPN+PP+ +F  + I HPN+ ++ GE+CLD+L+
Sbjct: 21  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEIFHPNV-YANGEICLDILQ 78

Query: 104 HETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAY 148
           +  W+P Y++  ++ +I++L  +P   SP +V+ A L+   K  Y
Sbjct: 79  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQY 122

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 86.7 bits (213), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 80/138 (57%), Gaps = 8/138 (5%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R++ ++K+I+         +   P  D   L  W A   GP +TPY D TF L +E  E 
Sbjct: 8   RLMRDFKRIKSDSPPG---ISASPLPDNVML--WNAMIIGPSDTPYEDGTFRLVLEFDEE 62

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVD 130
           YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  +P   
Sbjct: 63  YPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVSSILTSIQSLFNDPNPA 119

Query: 131 SPLDVDLAKLYSVDKQAY 148
           SP +V+ A L+   +  Y
Sbjct: 120 SPANVEAATLFKDHRAQY 137

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 88.2 bits (217), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 72/111 (64%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +FCGP++TPY +  + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 46  NMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 104

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+LL +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 105 DVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELKDKKLYE 154

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 85.1 bits (209), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRSKYEA 137

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 86.7 bits (213), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 79/142 (55%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +R+   ++ ++  +  +     + + +  F GP  TPY    F + IE
Sbjct: 2   SRAKRLMKELQAVRDDPAANITLEFISES----DIHRLKGSFLGPPETPYQGGRFIIDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  DK+++
Sbjct: 116 PEPNDPQDAEVAQHYLRDKESF 137

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 85.5 bits (210), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 66/105 (62%), Gaps = 3/105 (2%)

Query: 44  WEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLK 103
           W A   GP  TPY D TF L +E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L+
Sbjct: 32  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 89

Query: 104 HETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAY 148
           +  W+P Y++  ++ +I++L  +P   SP +V+ A L+   K  Y
Sbjct: 90  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQY 133

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 86.7 bits (213), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           S+ ++  +F GP++TPY +  + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 28  SMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 86

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L+ +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 87  DVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 136

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 86.3 bits (212), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           S+ ++  +F GP++TPY +  + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 28  SMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 86

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L+ +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 87  DVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 136

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 84.7 bits (208), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (63%), Gaps = 3/105 (2%)

Query: 44  WEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLK 103
           W A   GP +TPY D TF L +E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 78

Query: 104 HETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAY 148
           +  W+P Y++  ++ +I++L  +P   SP +V+ A L+   K  Y
Sbjct: 79  NR-WTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFKDHKSQY 122

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 86.3 bits (212), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 80/142 (56%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++  +++ S+  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKELQAVKDDPEANISLEFVSES----DIHHLKGSFLGPPGTPYEGGKFIVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F  + + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DSKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D+Q++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRQSF 137

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 84.3 bits (207), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 21  CSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 79

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 80  -ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEA 136

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 86.3 bits (212), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           S+ ++  +F GP++TPY +  + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 28  SMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 86

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L+ +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 87  DVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 136

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 84.3 bits (207), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (63%), Gaps = 3/105 (2%)

Query: 44  WEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLK 103
           W A   GP +TPY D TF L +E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 78

Query: 104 HETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAY 148
           +  W+P Y++  ++ +I++L  +P   SP +V+ A L+   K  Y
Sbjct: 79  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDYKSQY 122

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEA 137

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEA 137

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEA 137

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 84.7 bits (208), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP +T Y D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPADTSYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YPN+PP+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +FCGP++TPY +  + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 29  NMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 87

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+LL +VE  I  LL EP    PL+ + A L   DK  Y+
Sbjct: 88  DVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAGLQLHDKTLYE 137

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 81/153 (52%), Gaps = 14/153 (9%)

Query: 14  AEYKQIREQLQSHESILMLCPA-------GDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           AE   + ++LQ+    LM+ P             L++W     GPE TPY +  F LS++
Sbjct: 5   AEGHSVVKRLQNELVQLMMSPTPGLSAFPASEDDLTQWFGVIVGPEGTPYENLKFRLSLK 64

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
             + YP +PP   F  + + HPN+  S G +CLD+LK + WS +YN+  ++ +++ LL E
Sbjct: 65  FTDQYPYQPPKVTF-VSPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQALLEE 121

Query: 127 PGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSR 159
           P   SPL+   A+L+  D   Y+     RL +R
Sbjct: 122 PNNGSPLNAIAAELWDTDMDEYKK----RLFAR 150

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 84.0 bits (206), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEA 137

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 84.0 bits (206), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 21  CSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 79

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 80  -ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEA 136

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 79/154 (51%), Gaps = 14/154 (9%)

Query: 13  LAEYKQIREQLQSHESILMLCPA-------GDGGSLSKWEAQFCGPENTPYADFTFTLSI 65
           + E   + ++LQS    LM+ P         +   L  W     GPE TPY    F +S+
Sbjct: 7   IPEGHSVVKRLQSELVQLMMSPTPGLSAFPNNEDDLRDWSGMIVGPEGTPYESLKFKISL 66

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
             P+ YP  PP  +F  + + HPN+  S G +CLD+LK + WS +YN+  ++ ++++L  
Sbjct: 67  HFPDSYPYVPPKVKF-ISPMWHPNVDMS-GNICLDILK-DQWSAVYNVQTILLSLQSLFE 123

Query: 126 EPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSR 159
           EP   SPL+   A+L+  D   Y+     RL SR
Sbjct: 124 EPNNSSPLNAVAAELWDKDMVEYKK----RLLSR 153

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (52%), Gaps = 5/135 (3%)

Query: 17  KQIREQLQS--HESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNE 74
           K+I ++L     + I        G  L  W+A   GP ++PYA   F LSI  P  YP +
Sbjct: 4   KRISKELNDLRKDPITSFSAGPVGDDLFHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 75  PPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLD 134
           PP   F    I HPNI  + G +CLD+LK + WSP   L +V+ +I +LL +   D PL 
Sbjct: 64  PPKISF-TTKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLV 120

Query: 135 VDLAKLYSVDKQAYQ 149
            ++A +Y  D+  Y+
Sbjct: 121 PEIAHIYKTDRSKYE 135

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           S+ ++  +F GP++TPY +  + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 29  SMQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSICL 87

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+LL +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 88  DVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKMYE 137

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 3/114 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           S+ ++  +F GP++TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 29  SMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 87

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           D++ + TWSP+Y+LL +VE  +  LL EP    PL+ + A L   DK+ Y+  V
Sbjct: 88  DVI-NSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKV 140

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 85.1 bits (209), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 79/142 (55%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   ++ S+  +  +     +   +  F GP  TPY   TF + I+
Sbjct: 2   SRAKRLMKEIQSVKDDPDANISLAFVSES----DIHHLKGTFLGPPGTPYHGGTFIVDIQ 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+ +WSP+  L   + +++ LL  
Sbjct: 58  VPLEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILKN-SWSPVLTLKTSLISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++AK Y  D+ ++
Sbjct: 116 PEPNDPQDAEVAKHYLSDRASF 137

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 21  CSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 79

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 80  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEA 136

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 21  CSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 79

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 80  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEA 136

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 21  CSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 79

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 80  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEA 136

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 21  CSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 79

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 80  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEA 136

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 85.1 bits (209), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 78/142 (54%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +R+  +++  +  +  A     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEMEAVRDDPEANIDLEFVSEA----DIHHLKGSFLGPPETPYEGGKFIVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D++++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRESF 137

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 70/116 (60%), Gaps = 3/116 (2%)

Query: 37  DGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGE 96
           D   L+ W     GP++TPY+   F +S++ P+ YP  PP  +F  + + HPN+   +G 
Sbjct: 34  DDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKF-LSPMWHPNVD-KSGN 91

Query: 97  VCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           +CLD+LK E WS +YN+  ++ ++++LL EP   SPL+   A+L+  D + Y+  V
Sbjct: 92  ICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEYRKKV 146

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 83.2 bits (204), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  +  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A LY  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKTDRAKYEA 137

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 83.2 bits (204), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  +  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A LY  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKTDRAKYEA 137

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 78/142 (54%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   +H ++  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEIQAVKDDPAAHITLEFVSES----DIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D++++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRESF 137

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 78/142 (54%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   +H ++  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEIQAVKDDPAAHITLEFVSES----DIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D++++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRESF 137

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 78/142 (54%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   +H ++  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEIQAVKDDPAAHITLEFVSES----DIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D++++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRESF 137

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 84.7 bits (208), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 83/154 (53%), Gaps = 8/154 (5%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   ++ ++  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEMQAVKDDPAANITLDFVNES----DIHHLKGSFLGPPGTPYEGGRFMIDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRT 160
           P  + P D ++A+ Y  DK+ +    T RL ++T
Sbjct: 116 PEPNDPQDAEVAQHYLKDKEGFNK--TARLWTQT 147

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 85.1 bits (209), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 70/113 (61%), Gaps = 3/113 (2%)

Query: 38  GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEV 97
             S+ ++  +F GP++TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +
Sbjct: 49  NNSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 107

Query: 98  CLDLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           CLD++ + TWSP+Y+LL +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 108 CLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELRDKKLYE 159

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 83.2 bits (204), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  +  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A LY  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKTDRPKYEA 137

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 84.3 bits (207), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 38  GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEV 97
             S+ ++  +F GP++TPY +  + L +E+P+ YP + P+  F  N I HPNI  ++G +
Sbjct: 25  NDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 83

Query: 98  CLDLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           CLD++ + TWSP+Y+L+ ++E  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 84  CLDVI-NSTWSPLYDLINILEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 135

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 83.2 bits (204), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 63/113 (55%), Gaps = 3/113 (2%)

Query: 38  GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEV 97
           G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI  + G +
Sbjct: 41  GDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN-ANGNI 98

Query: 98  CLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
           CLD+LK + WSP   L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 99  CLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRSKYEA 150

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 84.7 bits (208), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 78/142 (54%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   +H ++  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEIQAVKDDPAAHITLEFVSES----DIHHLKGTFLGPPGTPYEGGKFVVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D++++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRESF 137

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 83.2 bits (204), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 81/154 (52%), Gaps = 14/154 (9%)

Query: 13  LAEYKQIREQLQSHESILMLCPA-------GDGGSLSKWEAQFCGPENTPYADFTFTLSI 65
           L E   + ++LQS    LM+ P         D   L+ W A   GP++TPY    F LS 
Sbjct: 11  LPEGHSVVKRLQSELMQLMMSPTPGLSAFPNDEEDLTHWSAIITGPKDTPYDGLRFKLSF 70

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           +  + YP  PP  +F  + + HPN+  S G +CLD+LK + WS +YN+  ++ +++ LL 
Sbjct: 71  QFSDSYPYAPPLVKF-ISPMWHPNVDMS-GNICLDILK-DQWSAVYNVETILLSLQALLE 127

Query: 126 EPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSR 159
           EP   SPL+   A+L+  D   Y+     RL +R
Sbjct: 128 EPNNSSPLNAVAAELWDDDMNEYKK----RLLAR 157

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 82.4 bits (202), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  +  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 21  CSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAF-TTKIYHPNIN 79

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 80  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEA 136

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 84.3 bits (207), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 79/142 (55%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++  ++  ++  +  +     +   +  F GP  TPY +  F + IE
Sbjct: 2   SRAKRIMKELQAVKDDPEAKITLEFVIES----DIHHLKGSFIGPPGTPYENGAFVVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPQMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D++++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRESF 137

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 82.8 bits (203), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 66/113 (58%), Gaps = 3/113 (2%)

Query: 37  DGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGE 96
           D   L+ W     GP+ TPY+   F +S+  PE YP  PP  +F  + + HPN+   +G 
Sbjct: 34  DDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKF-VSPMWHPNVD-KSGN 91

Query: 97  VCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           +CLD+LK E WS +YN+  ++ ++++LL EP   SPL+   A+L+  +   Y+
Sbjct: 92  ICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAELWDTNMVEYR 143

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 84.3 bits (207), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 79/153 (51%), Gaps = 8/153 (5%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E + ++E  ++   +  +  +     +   +  F GP  TPY    F + I I
Sbjct: 3   RSKRILKEIQAVKEDPEAQIELKFVNES----DIHHMKGSFIGPSGTPYEGGKFVVDINI 58

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127
           P  YP +PP  +F    + HPN+   TG +CLD+LK+  W+P+  L   + +++ LL  P
Sbjct: 59  PVEYPYKPPQMKF-DTKVYHPNVSSVTGAICLDILKN-AWTPVITLKSALISLQALLQSP 116

Query: 128 GVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRT 160
             + P D  +AK Y  DK+++    T  L +RT
Sbjct: 117 EPNDPQDAQVAKHYLTDKKSFDE--TAALWTRT 147

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 84.0 bits (206), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 79/142 (55%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++  ++H ++  +    +   +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEMQAVKDDPEAHITLEFV----NESDIHHLKGTFQGPPETPYDRGQFVVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPN+   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DTKVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D++++
Sbjct: 116 PEPNDPQDAEVAQHYLKDRESF 137

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 82.4 bits (202), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  +  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 21  CSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAF-TTKIYHPNIN 79

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 80  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEA 136

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 82.4 bits (202), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  +  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 22  CSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 80

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 81  -ANGNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEA 137

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 84.0 bits (206), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 33  CPAGD-GGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C AG  G  L  W+A   GP ++PYA   F LSI  P  YP +PP   F    I HPNI 
Sbjct: 110 CSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNIN 168

Query: 92  WSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
            + G +CLD+LK + WSP   + +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 169 -ANGNICLDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEA 225

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 82.8 bits (203), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 68/110 (61%), Gaps = 3/110 (2%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLD 100
           + ++  +F GP++TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CLD
Sbjct: 30  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLD 88

Query: 101 LLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           ++ + TWSP+Y+LL +VE  I  LL EP    PL+ + A L   DK  Y+
Sbjct: 89  VI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYE 137

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 78/142 (54%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   ++ S+  +  +     +   +  F GP  TPY    F + I+
Sbjct: 2   SRAKRLMKEIQSVKDDPDANISLSFVSES----DIHHLKGTFLGPPGTPYHGGKFVVDIQ 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+ +WSP+  L   + +++ LL  
Sbjct: 58  VPLEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILKN-SWSPVLTLKTSLISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++AK Y  D+ ++
Sbjct: 116 PEPNDPQDAEVAKHYLSDRSSF 137

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 70/111 (63%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           S+ ++  +F GP++TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 16  SMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 74

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L+ +VE  I  LL EP    PL+ + A L   +K+ Y+
Sbjct: 75  DVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNKELYE 124

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 79/148 (53%), Gaps = 6/148 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + I++  ++   + ++    +   +   +  F GP  TPY +  F + IE
Sbjct: 2   SRAKRVMKELQAIKDDPEAKVDLQLV----NENDIHLLKGSFLGPPGTPYENGKFIVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPN+   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DTKVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAYQGLVTY 154
           P  + P D ++A+ +  DK ++     +
Sbjct: 116 PEPNDPQDAEVAQHFLRDKASFDKTAAF 143

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 79/147 (53%), Gaps = 6/147 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   ++ ++  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEMQAVKDDPAANINLEFVSES----DIHHLKGSFLGPPETPYQGGRFIVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAYQGLVT 153
           P  + P D ++A+ Y  D++++    T
Sbjct: 116 PEPNDPQDAEVAQHYLRDRESFNKTAT 142

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 82.0 bits (201), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 69/111 (62%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP++TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 28  NMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDVASGSICL 86

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L+ +VE  I  LL EP    PL+ + A L   DK  Y+
Sbjct: 87  DVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKVLYE 136

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 70/111 (63%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP++TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 30  NMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 88

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+LL ++E  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 89  DVI-NSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAGLQLHDKKIYE 138

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 79/148 (53%), Gaps = 6/148 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + I++  ++   + ++    +   +   +  F GP  TPY +  + + IE
Sbjct: 2   SRAKRVMKELQAIKDDPEARVDLQLV----NENDIHLLKGSFLGPPGTPYENGKYIVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPN+   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-QTKVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAYQGLVTY 154
           P  + P D ++A+ Y  DK ++     +
Sbjct: 116 PEPNDPQDAEVAQHYIRDKASFDKTAAF 143

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 82.4 bits (202), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 69/111 (62%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP+ TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 28  NMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 86

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L+ +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 87  DVI-NSTWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAGLQLRDKKLYE 136

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 81.6 bits (200), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 69/111 (62%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP++TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 16  NMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKILHPNIDVASGSICL 74

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L  +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 75  DVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 124

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 81.6 bits (200), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 69/111 (62%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP++TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 30  NMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 88

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L  +VE  I  LL EP    PL+ + A L   DK+ Y+
Sbjct: 89  DVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYE 138

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 80.9 bits (198), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 77/142 (54%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++  ++   +  +    +   +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKELQAVKDDPEARIELEFV----NESDIHHLKGSFLGPPGTPYEGGQFIVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPMMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D++++
Sbjct: 116 PEPNDPQDAEVAQHYLKDRESF 137

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 80.9 bits (198), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 76/142 (53%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   +  ++  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKEMQAVKDDPAAKINLEFVTES----DIHHLKGSFLGPPGTPYDGGLFIVDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPN+   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DTKVYHPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  DK ++
Sbjct: 116 PEPNDPQDAEVAQHYLRDKDSF 137

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 80.1 bits (196), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 77/143 (53%), Gaps = 18/143 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGS-----LSKWEAQFCGPENTPYADFTFTLSI 65
           R++ ++K+++E            P G   S     +  W A   GP  TPY D TF L +
Sbjct: 8   RLMRDFKRMKED----------APPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLL 57

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           E  E YP   P+ +F  + + HPN+ ++ GE+CLD+L++  W+P Y++  ++ +I++L  
Sbjct: 58  EFDEEYPINRPHVKF-LSEMFHPNV-YANGEICLDILQNR-WTPTYDVASILTSIQSLFN 114

Query: 126 EPGVDSPLDVDLAKLYSVDKQAY 148
           +P   SP +V+ A L+   K  Y
Sbjct: 115 DPNPASPANVEAATLFKDHKSQY 137

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 69/111 (62%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP+ TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 28  NMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 86

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L+ +VE  I  LL EP    PL+ + A L   +K+ Y+
Sbjct: 87  DVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNKELYE 136

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 75/142 (52%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E + +++   +   +  +  +     +   +  F GP  TPY    F + IE
Sbjct: 2   SRAKRIMKELQAVKDDPTAKIGLEFVNES----DIHHLKGSFFGPPGTPYEGGQFIIDIE 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ Y  D+ ++
Sbjct: 116 PEPNDPQDAEVAQHYLKDRASF 137

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 68/111 (61%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP+ TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 28  NMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 86

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+LL +VE  I  LL EP    PL+ + A L   + Q Y+
Sbjct: 87  DVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPQMYE 136

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 78.6 bits (192), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 77/142 (54%), Gaps = 6/142 (4%)

Query: 7   NRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIE 66
           +RA R++ E +  ++  +++ ++  +  +     +   +  F GP  TPY    F + I+
Sbjct: 2   SRAKRIIKEIQAAKDDPEANITLSFVSES----DIHHLKGSFYGPPGTPYEGGNFIVDIQ 57

Query: 67  IPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
           +P  YP +PP  +F    + HPNI   TG +CLD+LK+  WSP+  L   + +++ LL  
Sbjct: 58  VPLEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 127 PGVDSPLDVDLAKLYSVDKQAY 148
           P  + P D ++A+ +  DK ++
Sbjct: 116 PEPNDPQDAEVAQHFIRDKSSF 137

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 78.2 bits (191), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 67/111 (60%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP  TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 28  NMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 86

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ + TWSP+Y+L+ +VE  I  LL EP    PL+ + A L   + + Y+
Sbjct: 87  DVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPKMYE 136

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 66/111 (59%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ ++  +F GP  TPY    + L +E+P+ YP + P+  F  N I HPNI  ++G +CL
Sbjct: 16  NMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 74

Query: 100 DLLKHETWSPMYNLLQVVE-AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           D++ +  WSP+Y+LL ++E  I  LL EP    PL+ + A L    K+ Y+
Sbjct: 75  DVI-NSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKELYE 124

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLD 100
           L  WEA   G   T +AD  + +SIE P+ YP++PP  +FP     HPNI + +G VCL 
Sbjct: 38  LQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFPAG-FYHPNI-YPSGTVCLS 95

Query: 101 LL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVT 153
           +L + + W P   L Q+V  ++ LL  P  +SP      + +S +K+ YQ  V 
Sbjct: 96  ILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFSKNKEEYQKKVA 149

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 63/114 (55%), Gaps = 3/114 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L KWEA   G E T + D  F +++E P+ YP++PP  +FP     HPNI + +G VCL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPAG-FYHPNI-YPSGTVCL 94

Query: 100 DLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            +L + + W P   L Q+V  ++ LL  P  +SP      + +S +K  Y+  V
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFSKNKAEYEKKV 148

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 74.7 bits (182), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 37  DGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTG 95
           DG  +L KWEA   G E T + D  + ++IE P+ YP++PP  +FP     HPNI + +G
Sbjct: 33  DGSMNLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFPAG-FYHPNI-YPSG 90

Query: 96  EVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            VCL +L + + W P   + Q++  ++ LL  P  DSP      + Y+ + Q Y+  V
Sbjct: 91  TVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPDSPAQEPAWRAYAKNVQEYEKKV 148

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 73.6 bits (179), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 58/101 (57%), Gaps = 3/101 (2%)

Query: 50  GPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSP 109
           GP ++PYA   F LSI  P  YP +PP   F    I HPNI  + G +CLD+LK + WSP
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQ-WSP 58

Query: 110 MYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
              L +V+ +I +LL +   D PL  ++A +Y  D+  Y+ 
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEA 99

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 10/138 (7%)

Query: 19  IREQLQSHESILMLCPA-------GDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMY 71
           + ++LQS    LM+ P+            L+KW     GP+ TPY    F +++E  + Y
Sbjct: 15  VTKRLQSELVQLMMSPSPGLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTY 74

Query: 72  PNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDS 131
           P   P  RF  + + HPN+  S G +CLD+LK + WS +YN+  ++ ++++LL EP   S
Sbjct: 75  PYTAPKVRFV-SPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSS 131

Query: 132 PLDVDLAKLYSVDKQAYQ 149
           PL+   A+L+  D Q Y+
Sbjct: 132 PLNAVAAELWDTDMQEYK 149

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 10/144 (6%)

Query: 19  IREQLQSHESILMLCPA-------GDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMY 71
           +  +LQS    LML P+        D   L+KW     GP+ TPY    F +++E  + Y
Sbjct: 15  VVSRLQSELMQLMLSPSPGLSAFPEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTY 74

Query: 72  PNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDS 131
           P   P  RF  + + HPN+  S G +CLD+LK + WS +YN+  ++ ++++LL EP   S
Sbjct: 75  PYTAPKVRF-VSPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSS 131

Query: 132 PLDVDLAKLYSVDKQAYQGLVTYR 155
           PL+   A+L+  D + Y+  +  R
Sbjct: 132 PLNAVAAELWDKDMREYKKKLIAR 155

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 80/153 (52%), Gaps = 15/153 (9%)

Query: 16  YKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEP 75
           YK++++ ++     ++  P  D  +L  W+    GP +TPYA   F   +E P+ YP  P
Sbjct: 10  YKELQQLIKDSPPGIVAGPKSDD-NLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSP 68

Query: 76  PNCRFPPNHICHPNIKWSTGEVCLDLL------------KHETWSPMYNLLQVVEAIRTL 123
           P   F P+ I HPNI +  GEVC+ +L              E WSP+ ++ +++ ++ ++
Sbjct: 69  PKLTFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126

Query: 124 LAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRL 156
           L+EP ++S  ++D   L+  ++  ++  V   +
Sbjct: 127 LSEPNIESGANIDACILWRDNRAEFEKQVKLSI 159

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 65/119 (54%), Gaps = 4/119 (3%)

Query: 36  GDGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWST 94
            DG  +L KWEA   G E T + +  + ++IE P+ YP++PP  +FP     HPNI + +
Sbjct: 32  ADGSMNLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFPAG-FYHPNI-YPS 89

Query: 95  GEVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           G VCL +L + + W P   L Q+V  ++ LL  P  DSP      + +S + + Y+  V
Sbjct: 90  GTVCLSILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSPAQEPAWRAFSKNIKEYEKKV 148

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 80/152 (52%), Gaps = 20/152 (13%)

Query: 11  RMLAEYKQ-IREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69
           R+L EY+Q IRE         ++    D  ++ +W+    GP  TPY +  F  ++  P+
Sbjct: 10  RLLKEYQQLIRESPPG-----IVAGPSDENNMFEWDCLISGPPETPYENGVFNATLLFPK 64

Query: 70  MYPNEPPNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQVV 117
            YP  PP   F P+ + HPNI +  GEVC+ +            L  E WSP+ ++ +++
Sbjct: 65  DYPLSPPKLTFTPS-LLHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKIL 122

Query: 118 EAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
            ++ ++L+EP ++S  ++D + LY  ++  ++
Sbjct: 123 LSVMSMLSEPNIESGANIDASILYRDNRPEFE 154

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 37  DGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTG 95
           DG  +L KWEA   G E T + D  + ++IE P+ YP++PP  +FP     HPNI + +G
Sbjct: 33  DGSMNLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPAG-FYHPNI-YPSG 90

Query: 96  EVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            VCL +L + + W P   + Q++  ++ LL  P  +SP      + Y+ + Q Y+  V
Sbjct: 91  TVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPNSPAQEPAWRAYAKNLQEYEKKV 148

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 72.0 bits (175), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 64/118 (54%), Gaps = 4/118 (3%)

Query: 37  DGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTG 95
           DG  +L KWEA   G E T + D  F ++IE P+ YP++PP  +FP     HPNI + +G
Sbjct: 33  DGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKFPAG-FYHPNI-YPSG 90

Query: 96  EVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            VCL +L + + W P   L Q+   ++ LL  P  +SP      + +S + + Y+  V
Sbjct: 91  TVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYERKV 148

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 72.0 bits (175), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 81/150 (54%), Gaps = 10/150 (6%)

Query: 13  LAEYKQIREQLQSHESILMLCPA-------GDGGSLSKWEAQFCGPENTPYADFTFTLSI 65
           + E   + ++LQS    LM+ P+        +   L+KW     GP+ TPY    F +S+
Sbjct: 9   VPEGHSVTKRLQSELVQLMMSPSPGLSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISL 68

Query: 66  EIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125
           + P+ YP   P   F  + + HPN+  S G +CLD+LK + WS +YN+  ++ ++++LL 
Sbjct: 69  QFPQSYPYTAPRVTF-VSPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLE 125

Query: 126 EPGVDSPLDVDLAKLYSVDKQAYQGLVTYR 155
           EP   SPL+   A+L+  + + Y+  +  R
Sbjct: 126 EPNNSSPLNAVAAELWDKNMEEYKRKLMAR 155

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 37  DGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTG 95
           DG  +L KWEA   G E T +A+  + ++IE P  YP++PP  + P N   HPN+ + +G
Sbjct: 33  DGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLPAN-FYHPNV-YPSG 90

Query: 96  EVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            +CL +L + + W P   L Q+   I+ LL  P  +SP      + +S +K+ Y+  V
Sbjct: 91  TICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSPAQEPAWRSFSKNKEEYEKKV 148

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 60/113 (53%), Gaps = 3/113 (2%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLD 100
           L KWEA   G E T +A   + +S+E P  YP++PP  +FP     HPN+ + +G +CL 
Sbjct: 38  LQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFPAG-FYHPNV-YPSGTICLS 95

Query: 101 LL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           +L + + W P   L Q+V  ++ LL  P  +SP      + +S +K  Y   V
Sbjct: 96  ILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRSFSRNKTEYDKKV 148

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query: 33  CPAGDGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIK 91
           C   DG  +L KWEA   G E T + D  + ++IE P+ YP++PP  +FP     HPNI 
Sbjct: 29  CKKADGSMNLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFPAG-FYHPNI- 86

Query: 92  WSTGEVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSP 132
           + +G VCL +L + + W P   L Q+   ++ LL  P  +SP
Sbjct: 87  YPSGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (53%), Gaps = 14/125 (11%)

Query: 44  WEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDL-- 101
           W+    GP +TPYAD  F   +E P+ YP  PP   F P+ I HPNI +  GEVC+ +  
Sbjct: 37  WDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILH 94

Query: 102 ----------LKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGL 151
                     L  E WSP+ ++ +++ ++ ++L+EP ++S  ++D   L+  ++  ++  
Sbjct: 95  SPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFEKQ 154

Query: 152 VTYRL 156
           V   +
Sbjct: 155 VKLSI 159

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
            L +WEA   G + T +AD  + L+IE P+ YP++PP  + P N   HPN+ + +G +CL
Sbjct: 37  DLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKLPAN-FYHPNV-YPSGTICL 94

Query: 100 DLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVT 153
            +L + + W P   L Q+   I+ LL  P  +SP      + +S +K  Y+  V 
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSPAQEPAWRAFSRNKAEYEKKVV 149

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 70.1 bits (170), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLD 100
           L +WEA   G   T +A+  + ++IE P+ YP++PP   F P    HPN+ + +G +CL 
Sbjct: 3   LQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICLS 60

Query: 101 LLKHET-WSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVT 153
           +L  E  W P   L Q+V  ++ LL  P  +SP      + +S +K  Y+  V+
Sbjct: 61  ILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFSRNKSEYEKKVS 114

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 61/115 (53%), Gaps = 3/115 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L KWEA   G E T +    + +SIE P+ YP++PP  RFP     HPNI + +G VCL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFPAG-FYHPNI-YPSGTVCL 94

Query: 100 DLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVT 153
            +L + + W P   L Q+V  ++ LL  P  +SP      K +  ++  Y+  V 
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSPAQEPAWKAFQRNRVEYEKKVA 149

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (53%), Gaps = 14/125 (11%)

Query: 44  WEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDL-- 101
           W+    GP +TPYAD  F   +E P+ YP  PP   F P+ I HPNI +  GEVC+ +  
Sbjct: 37  WDCLIQGPPDTPYADGIFNAKLEFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILH 94

Query: 102 ----------LKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGL 151
                     L  E WSP+ ++ +++ ++ ++L+EP ++S  ++D   L+  ++  ++  
Sbjct: 95  SPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFEKQ 154

Query: 152 VTYRL 156
           V   +
Sbjct: 155 VKLSI 159

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (53%), Gaps = 14/125 (11%)

Query: 44  WEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDL-- 101
           W+    GP +TPYAD  F   +E P+ YP  PP   F P+ I HPNI +  GEVC+ +  
Sbjct: 37  WDCLIQGPPDTPYADGVFNTKLEFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILH 94

Query: 102 ----------LKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGL 151
                     L  E WSP+ ++ +++ ++ ++L+EP ++S  ++D   L+  ++  ++  
Sbjct: 95  SPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFERQ 154

Query: 152 VTYRL 156
           V   +
Sbjct: 155 VKLSI 159

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 67/125 (53%), Gaps = 14/125 (11%)

Query: 44  WEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDL-- 101
           W+    GP +TPYAD  F   +E P+ YP  PP   F P+ I HPNI +  GEVC+ +  
Sbjct: 37  WDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILH 94

Query: 102 ----------LKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGL 151
                     L  E WSP+ ++ +++ ++ ++L+EP ++S  ++D   L+  ++  ++  
Sbjct: 95  SPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFERQ 154

Query: 152 VTYRL 156
           V   +
Sbjct: 155 VKLSI 159

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 69.7 bits (169), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L KWEA   G E T + +  F ++IE P+ YP++PP  +FP     HPNI + +G VCL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAG-FYHPNI-YPSGTVCL 59

Query: 100 DLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            +L + + W P   L Q+   ++ LL  P  +SP      + +S + + Y+  V
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYERKV 113

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 36  GDGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWST 94
            DG   L KWEA   G E T +A   + +++E P  YP++PP  +FP     HPN+ + +
Sbjct: 32  ADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPAG-FYHPNV-YPS 89

Query: 95  GEVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           G +CL +L + + W P   L Q+V  ++ LL  P  +SP      + +S +K  Y   V
Sbjct: 90  GTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRSFSRNKAEYDKKV 148

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 61/111 (54%), Gaps = 3/111 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GPE +PY D  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+A+ +  ++Q  + 
Sbjct: 89  DVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKA 138

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 36  GDGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWST 94
            DG   L KWEA   G E T +A   + +++E P  YP++PP  +FP     HPN+ + +
Sbjct: 32  ADGSMDLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKFPAG-FYHPNV-YPS 89

Query: 95  GEVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           G +CL +L + + W P   L Q+V  ++ LL  P  +SP      + +S +K  Y   V
Sbjct: 90  GTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRSFSRNKTEYDKKV 148

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GPE +PY D  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRF-LTRIYHPNID-RLGRICL 78

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 79  DVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 69.3 bits (168), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 63/119 (52%), Gaps = 4/119 (3%)

Query: 36  GDGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWST 94
            DG   L KWEA   G + T +A   + +++E P  YP++PP  +FP     HPN+ + +
Sbjct: 32  ADGSMDLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFPAG-FYHPNV-YPS 89

Query: 95  GEVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           G +CL +L + + W P   L Q+V  ++ LL  P  +SP      + +S +K  Y+  V
Sbjct: 90  GTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRSFSRNKTEYEKKV 148

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 69.3 bits (168), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 79/149 (53%), Gaps = 15/149 (10%)

Query: 16  YKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEP 75
           +K++++ L+     ++  P  +  +L  W+    GP ++PY    F  ++E P+ YP  P
Sbjct: 10  FKELQQLLKDSPEGIVAGPRSED-NLFLWDCLISGPPDSPYQGGVFNATLEFPKDYPLSP 68

Query: 76  PNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQVVEAIRTL 123
           P   F P+ I HPNI +  GEVC+ +            L  E WSP+ ++ +++ ++ ++
Sbjct: 69  PKLLFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 124 LAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           L+EP V+S  ++D   L+   ++ ++  V
Sbjct: 127 LSEPNVESGANIDACILWRDSREEFEKQV 155

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 69.3 bits (168), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GP+ +PY    F L + +P+ YP EPP  RF    I HPNI    G +CL
Sbjct: 31  NLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+AK
Sbjct: 89  DVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GPE +PY D  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 78

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 79  DVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GPE +PY D  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 78

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 79  DVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 69.3 bits (168), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 81/156 (51%), Gaps = 18/156 (11%)

Query: 9   ASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIP 68
           + R+L EY+Q+   ++     ++  P  +  +L  W+    GP +TPY    F   ++ P
Sbjct: 6   SRRLLKEYQQL---IRDPPPGILAAPKSES-NLFLWDCLIQGPPDTPYEGGIFNARLDFP 61

Query: 69  EMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQV 116
           + YP  PP   F P+ I HPNI +  GEVC+ +            L  E WSP+ ++ ++
Sbjct: 62  KDYPLSPPKLTFTPS-ILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 117 VEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           + ++ ++L+EP ++S  +VD   L+  ++  ++  V
Sbjct: 120 LLSVMSMLSEPNIESGANVDACILWRDNRPEFERRV 155

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 60/115 (52%), Gaps = 3/115 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L KWEA   G E T +A+  + ++IE P  YP++PP  + P     HPN+ + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPAG-FYHPNV-YPSGTICL 94

Query: 100 DLLKHET-WSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVT 153
            +L  E  W P   L Q+   I+ LL  P  +SP      + +S +K  Y+  V 
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSPAQEPAWRSFSKNKVEYEKKVA 149

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (55%), Gaps = 3/108 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GP+ + Y +  F L + +P+ YP EPP  RF    I HPNI    G +CL
Sbjct: 31  NLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQA 147
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+A+ +  D+ A
Sbjct: 89  DVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAEDWIADEDA 135

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 78/151 (51%), Gaps = 18/151 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+L E +Q+   ++   + ++  P  +   L  W+    GP +TPY    F   +E P+ 
Sbjct: 8   RLLKELQQL---MKDSSTGIVAGPRSEN-DLFVWDCLIQGPPDTPYEGGIFNAKLEFPKD 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQVVE 118
           YP  PP   F P+ I HPNI +  GEVC+ +            L  E WSP+ ++ +++ 
Sbjct: 64  YPLSPPKLTFTPS-ILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILL 121

Query: 119 AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           ++ ++L+EP V+S  +VD   L+  ++  ++
Sbjct: 122 SVMSMLSEPNVESGANVDACILWRDNRPEFE 152

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 80/153 (52%), Gaps = 15/153 (9%)

Query: 16  YKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEP 75
           +K++++ L+     ++  P  +  +L  W+    GP ++PY    F  ++E P+ YP  P
Sbjct: 10  FKELQQLLKDSPEGIVAGPKSED-NLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPLSP 68

Query: 76  PNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQVVEAIRTL 123
           P   F P+ I HPNI +  GEVC+ +            L  E WSP+ ++ +++ ++ ++
Sbjct: 69  PKLLFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 124 LAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRL 156
           L+EP V+S  ++D   L+  ++  ++  V   +
Sbjct: 127 LSEPNVESGANIDACILWRDNRPEFERQVKLSI 159

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 68.6 bits (166), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 64/118 (54%), Gaps = 4/118 (3%)

Query: 37  DGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTG 95
           DG  +L  WEA   G E+T +    + ++IE P+ YP++PP  +FP     HPNI + +G
Sbjct: 33  DGSMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFPAG-FYHPNI-YPSG 90

Query: 96  EVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            VCL +L + + W P   L Q+V  ++ LL  P  +SP      + +S +K  Y+  V
Sbjct: 91  TVCLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSPAQEPAWRAFSKNKSEYEKRV 148

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GP+ +PY +  F L + +PE YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK+  WSP   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 89  DVLKN-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 77/150 (51%), Gaps = 18/150 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+L E +Q+     S E I+    + D  +L  W+    GP ++PY    F   +E P+ 
Sbjct: 8   RLLKELQQLARD--SPEGIVAGPKSED--NLFLWDCLITGPPDSPYEGGVFNAMLEFPKD 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQVVE 118
           YP  PP   F P+ I HPNI +  GEVC+ +            L  E WSP+ ++ +++ 
Sbjct: 64  YPLSPPRLTFTPS-ILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILL 121

Query: 119 AIRTLLAEPGVDSPLDVDLAKLYSVDKQAY 148
           ++ ++L+EP V+S  ++D   L+  ++  Y
Sbjct: 122 SVTSMLSEPNVESGANIDACILWRDNRPEY 151

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (58%), Gaps = 3/90 (3%)

Query: 50  GPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSP 109
           GPE +PY +  F L + +P+ YP E P  RF    I HPNI    G +CLD+LK+  WSP
Sbjct: 41  GPEESPYENGVFELELYLPDDYPMEAPKVRF-LTRIYHPNID-RLGRICLDVLKN-NWSP 97

Query: 110 MYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
              +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 98  ALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 60/108 (55%), Gaps = 3/108 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  +E    GP  +PY +  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQA 147
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+A+ +  D++A
Sbjct: 89  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEEA 135

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (55%), Gaps = 3/108 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  +E    GP+ +PY +  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQA 147
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+A+ +  D+ +
Sbjct: 89  DVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDESS 135

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (55%), Gaps = 3/108 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GP+ +PY +  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRF-LTKIYHPNID-KLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQA 147
           D+LK   WSP   +  V+ +++ LLA P  + PL  D+A+ +  D++ 
Sbjct: 89  DVLKT-NWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKDEEG 135

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 79/154 (51%), Gaps = 18/154 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+L E +Q+    +     ++ CP  +  +L  W+    GP +T Y    F   +E P+ 
Sbjct: 8   RLLKELQQLT---KDSPPGIVACPKNEN-NLFIWDCLVQGPPDTAYEGGIFNARLEFPKD 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQVVE 118
           YP  PP   F P+ I HPNI +  GEVC+ +            L  E WSP+ ++ +++ 
Sbjct: 64  YPLSPPKLTFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILL 121

Query: 119 AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           ++ ++L+EP ++S  ++D   L+  +++ ++  V
Sbjct: 122 SVMSMLSEPNIESGANIDACILWRDNREEFERQV 155

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 78/160 (48%), Gaps = 18/160 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EY+Q+   ++     ++  PA +   L  W+    GP +TPY    F   +  P  
Sbjct: 8   RLFKEYQQL---IRDSPPGIVAGPANEN-DLFLWDCLIQGPPDTPYEHGVFNAQLRFPRD 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQVVE 118
           YP  PP   F P  I HPNI +  GEVC+ +            L  E WSP+ ++ +++ 
Sbjct: 64  YPLSPPTLTFTP-AILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILL 121

Query: 119 AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCS 158
           ++ ++L+EP V+S  ++D   L+  ++  ++  V   + +
Sbjct: 122 SVMSMLSEPNVESGANIDACILWRDNRPEFERQVKRSIVA 161

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 67.8 bits (164), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 7/107 (6%)

Query: 48  FCGPENTPYADFTFTLSIEIPEMYPNEPPN--CRFPPNHICHPNIKWSTGEVCLDLLKHE 105
              P+   Y +  F  S+E  + YP EPP   CR   N I HPNI    G+VCL++L+ E
Sbjct: 74  IISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCR---NRIYHPNIDVQ-GKVCLNILR-E 128

Query: 106 TWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            WSP  +L  ++  +  L  EP    PL+ D A ++S D  A+   V
Sbjct: 129 DWSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSKDSNAFAKFV 175

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 66.6 bits (161), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 63/119 (52%), Gaps = 4/119 (3%)

Query: 37  DGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTG 95
           DG  +L +WEA   G E T + +  + L+IE P+ YP++PP  + P     HPN+ + +G
Sbjct: 33  DGSLNLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLPAG-FYHPNV-YPSG 90

Query: 96  EVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVT 153
            +CL +L + + W P   L Q+   I+ LL  P  +SP      + +S +K  Y+  + 
Sbjct: 91  TICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSPAQEPAWRAFSKNKAEYEKKIA 149

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 66.6 bits (161), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GP  +PY    F L + +PE YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDK 145
           D+LK   WSP   +  V+ +I+ LLA P  + PL  D+A+ +  D+
Sbjct: 89  DVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDE 133

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GP+ +PY +  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK+  WSP   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 89  DVLKN-NWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GPE +PY    F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 27  NLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 84

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK   WSP   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 85  DILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 123

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 37  DGG-SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTG 95
           DG  +L KWEA   G + T + +  + L+IE P+ YP++PP  +FP     HPN+ + +G
Sbjct: 33  DGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPAG-FYHPNV-YPSG 90

Query: 96  EVCLDLL-KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVT 153
            +CL +L + + W P   L Q++  ++ LL  P  +SP      + +S + + Y+  V+
Sbjct: 91  TICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSPAQEPAWRAFSKNIKEYERKVS 149

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GP+ +PY +  F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK   WSP   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 89  DVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 50  GPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSP 109
           GP  +PY +  F L + +P+ YP E P  RF    I HPNI    G +CLD+LK   WSP
Sbjct: 41  GPTQSPYENGIFKLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICLDVLK-TNWSP 97

Query: 110 MYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQG 150
              +  V+ +I+ LLA P  + PL  D+A+ +  +++A + 
Sbjct: 98  ALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEAAKA 138

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           +L  ++    GP+ +PY    F L + +P+ YP E P  RF    I HPNI    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
           D+LK   WSP   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 89  DVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 50  GPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSP 109
           GPE +PY    F L + +P+ YP E P  RF    I HPNI    G +CLD+LK   WSP
Sbjct: 41  GPEGSPYEHGIFDLELFLPDDYPMESPKVRF-LTKIYHPNID-RLGRICLDVLK-TNWSP 97

Query: 110 MYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
              +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 98  ALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 69/129 (53%), Gaps = 14/129 (10%)

Query: 40  SLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL 99
           ++ +W+    GP ++PY    F   ++ P+ YP  PP   F P+ I HPNI +  GEVC+
Sbjct: 33  NIFQWDCLVQGPPDSPYEGGVFNAQLDFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCI 90

Query: 100 DL------------LKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQA 147
            +            L  E WSP+ ++ +++ ++ ++L+EP ++S  ++D   L+  +++ 
Sbjct: 91  SILHSPGEDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRKE 150

Query: 148 YQGLVTYRL 156
           ++  V   +
Sbjct: 151 FERQVKLNI 159

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 66.6 bits (161), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 80/164 (48%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R N  AS +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSNRKNTAASLLLRQYRELTDPKKAIPSFHIEL--DDDSNIFLWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   ++ PE +P  PPN RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRV 160

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 64.7 bits (156), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 14/124 (11%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLD 100
           L  W+    GP +TPYA   F   ++ P  YP  PP   F P+ I HPN+ +  GEVC+ 
Sbjct: 34  LFTWDCLVAGPPDTPYAGGLFNCQLQFPTDYPLSPPTLTFTPS-ILHPNV-YPNGEVCIS 91

Query: 101 LLK------------HETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAY 148
           +L              E WSP+ ++ +++ ++ ++L+EP V+S  ++D   L+   +  +
Sbjct: 92  ILHAPGSDPNMYELPEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACILWRDHRDDF 151

Query: 149 QGLV 152
              V
Sbjct: 152 NKKV 155

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 64.7 bits (156), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 76/148 (51%), Gaps = 15/148 (10%)

Query: 17  KQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPP 76
           K++++ L+     ++  P  +  +L  W+    GP ++PY    F   ++ P  YP  PP
Sbjct: 11  KELQQLLRDSPDGIVAGPVSED-NLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPLSPP 69

Query: 77  NCRFPPNHICHPNIKWSTGEVCLDLL------------KHETWSPMYNLLQVVEAIRTLL 124
              F P+ I HPN+ +  GEVC+ +L              E WSP+ ++ +++ ++ ++L
Sbjct: 70  KLTFTPS-ILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSML 127

Query: 125 AEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           +EP V+S  ++D   L+  ++  ++  V
Sbjct: 128 SEPNVESGANIDACILWRDNRADFERQV 155

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 64.3 bits (155), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 78/151 (51%), Gaps = 18/151 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+L E +Q+    +     ++  PA +  +L  W+    GP +T Y    F   ++ P+ 
Sbjct: 8   RLLKELQQLN---KDSPPGIVAGPANEN-NLFVWDCLVQGPPDTAYEGGIFNARLDFPKD 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDL------------LKHETWSPMYNLLQVVE 118
           YP  PP   F P+ I HPNI +  GEVC+ +            L  E WSP+ ++ +++ 
Sbjct: 64  YPLSPPKLTFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILL 121

Query: 119 AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           ++ ++L+EP ++S  ++D   L+  +++ ++
Sbjct: 122 SVMSMLSEPNIESGANIDACILWRDNRKEFE 152

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 63.9 bits (154), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 50  GPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSP 109
           GP  +PY +  F L + +P+ YP E P  RF    I HPNI    G +CLD+LK   WSP
Sbjct: 41  GPAGSPYENGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICLDVLK-TNWSP 97

Query: 110 MYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
              +  V+ +++ LLA P  + PL  D+A+
Sbjct: 98  ALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 63.9 bits (154), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (58%), Gaps = 3/90 (3%)

Query: 50  GPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSP 109
           GP+++ Y +  F L + +P+ YP E P  RF    I HPNI    G +CLD+LK+  WSP
Sbjct: 41  GPKDSAYENGVFELELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICLDVLKN-NWSP 97

Query: 110 MYNLLQVVEAIRTLLAEPGVDSPLDVDLAK 139
              +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 98  ALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 63.9 bits (154), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 79/158 (50%), Gaps = 18/158 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+L E +++ +   S E IL      D  +L +W+    GP ++ Y    F   ++ P+ 
Sbjct: 8   RLLKELEKLTKD--SPEGIL--ASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKD 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH------------ETWSPMYNLLQVVE 118
           YP  PP   F P+ I HPNI +  GEVC+ +L              E WSP+ ++  ++ 
Sbjct: 64  YPLNPPKLTFQPS-ILHPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILL 121

Query: 119 AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRL 156
           ++ ++L+EP ++S  ++D   L+  ++  ++  V   L
Sbjct: 122 SVMSILSEPNIESGANIDACILWRDNRPEFERQVKLNL 159

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 73/147 (49%), Gaps = 20/147 (13%)

Query: 20  REQLQSHESILMLCPAG------DGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPN 73
           +  ++  + +L  CP G      +  ++  W+    GP ++PY    F   ++ P  YP 
Sbjct: 7   KRLMKEMQQLLKDCPEGIVAGPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPTDYPL 66

Query: 74  EPPNCRFPPNHICHPNIKWSTGEVCLDLL------------KHETWSPMYNLLQVVEAIR 121
            PP   F P+ I HPN+ +  GEVC+ +L              E WSP+ ++ +++ ++ 
Sbjct: 67  SPPKLTFTPS-ILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVM 124

Query: 122 TLLAEPGVDSPLDVDLAKLYSVDKQAY 148
           ++L+EP V+S  ++D   L+  ++  +
Sbjct: 125 SMLSEPNVESGANIDACILWRDNRPDF 151

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 79/164 (48%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R N  AS +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSNRKNTAASLLLRQYRELTDPKKAIPSFHIEL--DDDSNIFSWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP+ RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRV 160

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 79/164 (48%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R N  AS +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSNRKNTAASLLLRQYRELTDPKKAIPSFHIEL--DDDSNIFLWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP+ RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRV 160

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 77/164 (46%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQ-FCGPENTPYADF 59
           M +R N  AS +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSNRKNTAASLLLRQYRELTDAKKAIPSFHIEL--DDDSNIFLWNVGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLL-----------KHETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  +   Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNADQYRQRV 160

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 14/125 (11%)

Query: 37  DGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGE 96
           D   L  W+    GP ++PY    F   +  P  YP  PP   F P+ + HPN+ +  GE
Sbjct: 30  DESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTFVPS-VLHPNV-YPNGE 87

Query: 97  VCLDL------------LKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVD 144
           VC+ +            L  E WSP+ ++ +++ ++ ++L+EP V+S  ++D   L+  +
Sbjct: 88  VCISILHAPGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACVLWRDN 147

Query: 145 KQAYQ 149
           +  ++
Sbjct: 148 RPEFE 152

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 63.2 bits (152), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 78/164 (47%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R N  AS +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSNRKNTAASLLLRQYRELTDAKKAIPSFHIEL--DDDSNIFLWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLL-----------KHETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNIEQYKQRV 160

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 63.2 bits (152), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 79/164 (48%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R +  AS +L +Y+++ +  ++  S  +     D  +L  W        E++ Y   
Sbjct: 1   MSNRKSTAASLLLRQYRELTDPKKAIPSFHIEL--DDDSNLFVWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  +++ Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNQEQYKQRV 160

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 78/164 (47%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R +  AS +L +Y+++ +  ++  S  +     D  +L  W        E++ Y   
Sbjct: 1   MSNRKSTAASLLLRQYRELTDPKKAIPSFHIEL--DDDSNLFVWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRV 160

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 59.7 bits (143), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 5/109 (4%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           P+   Y D  F  S+   + YP EPP  +F    I HPNI  + G++CL++L+ E WSP+
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFL-KKIYHPNIDLN-GKICLNILR-EDWSPV 131

Query: 111 YNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSR 159
            +L  ++  +  L  EP    PL++   +L   +KQ +  +V  RL  R
Sbjct: 132 LDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKENKQEFIDIV--RLTMR 178

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 59.3 bits (142), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 49  CGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWS 108
             P+   Y   +   S++  E+YP EPP        I HPNI +  G VCL++L+ E WS
Sbjct: 67  VNPDEGYYTHGSINFSLDFNEVYPIEPPKVACL-KRIFHPNIDFK-GNVCLNILR-EDWS 123

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P  +L  +V  +  L  EP  + PL+ D AKL   D++ +   V
Sbjct: 124 PALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLLCQDEKEFAEAV 167

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 60.5 bits (145), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M  R +  +S +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSSRKSTASSLLLRQYRELTDPKKAIPSFHIEL--EDDSNIFTWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  FFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P ++SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRV 160

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 60.5 bits (145), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M  R +  +S +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSSRKSTASSLLLRQYRELTDPKKAIPSFHIEL--EDDSNIFTWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  FFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P ++SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRV 160

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M  R +  +S +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSSRKSTASSLLLRQYRELTDPKKAIPSFHIEL--EDDSNIFTWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  FFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P ++SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRV 160

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 49  CGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWS 108
             P+   Y   + + S++  E+YP EPP        I HPNI  + G VCL++L+ E WS
Sbjct: 67  VSPDEGYYNHGSISFSLDFNEVYPIEPPKVTCL-KKIFHPNIDLN-GNVCLNILR-EDWS 123

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
           P  +L  ++  +  L  EP  + PL+ D AKL+  D++ +   V   +   ++
Sbjct: 124 PALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLFCQDQKKFAETVILAMSGGSV 176

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 77/161 (47%), Gaps = 16/161 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R +  AS +L +Y+++ +  +S  S  +     D  ++  W        E + Y   
Sbjct: 1   MSNRKSTAASLLLRQYRELTDPKKSIPSFHINLE--DDSNIFVWNIGVMVLNEESIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL-----------DLLKHETWS 108
            F   +  P+ +P  PP  RF P  I HPN+ +  G +C+           D L  ETWS
Sbjct: 59  YFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
           P+ ++  V+ +I +LL +P + SP +VD A  Y  + + Y+
Sbjct: 117 PVQSVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYK 157

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M  R +  +S +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSSRKSTASSLLLRQYRELTDPKKAIPSFHIEL--EDDSNIFIWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  FFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P ++SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRV 160

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 76/164 (46%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R +  AS +L +Y+++ +  ++  S  +     D  ++  W        E + Y   
Sbjct: 1   MSNRKSTAASLLLRQYRELTDPKKAIPSFHIELE--DDSNIFVWNIGVMVLNEESIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  +   Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRV 160

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 58.9 bits (141), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 76/164 (46%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M  R N  A+ +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSGRRNTAANLLLRQYRELTDPKKAIPSFHIELE--DDSNIFVWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  FFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  +   Y+  +
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRI 160

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M +R +  AS +L +Y+++    ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSNRKSTAASLLLRQYRELTNPKKAIPSFHINLE--DDSNIFVWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCL-----------DLLKHETWS 108
            F   +  P+ +P  PP  RF P  I HPN+ +  G +C+           D L  ETWS
Sbjct: 59  YFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  + + Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRV 160

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 76/164 (46%), Gaps = 16/164 (9%)

Query: 1   MVHRANNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADF 59
           M  R +  AS +L +Y+++ +  ++  S  +     D  ++  W        E++ Y   
Sbjct: 1   MSSRKSTAASLLLRQYRELTDPKKAIPSFNIEL--DDDSNIFVWNIGVMVLNEDSIYHGG 58

Query: 60  TFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-----------ETWS 108
            F   +  P+ +P  PP  RF P  I HPN+ +  G +C+ +L             ETWS
Sbjct: 59  YFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWS 116

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+  +  V+ +I +LL +P + SP +VD A  Y  +   Y+  V
Sbjct: 117 PVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRV 160

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 13/112 (11%)

Query: 52  ENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH------- 104
           E++ Y    F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L         
Sbjct: 51  EDSLYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTD 108

Query: 105 ----ETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
               ETWSP+  +  V+ +I +LL +P + SP +VD A  Y  +   Y+  V
Sbjct: 109 EPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPDQYRQRV 160

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 56.6 bits (135), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 3/102 (2%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           P   PY    F  +++  EMYP EPP+     N I HPNI  + G++CL++L+ E WSP 
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPPSA-ICLNKIFHPNIDLN-GKICLNILR-EDWSPA 133

Query: 111 YNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            +L  +V  +  L  +     PL+   A++ + D+  +  LV
Sbjct: 134 LDLTSIVIGLLYLFLDFTSTDPLNQQAAEVLANDRNRFCELV 175

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 56.6 bits (135), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 49  CGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWS 108
             P+   Y   +    ++  E+YP EPP        I HPNI    G VCL++L+ E WS
Sbjct: 67  VSPDEGYYNHGSINFGLDFNEVYPIEPPKVACL-KKIFHPNIDLK-GNVCLNILR-EDWS 123

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P  +L  ++  +  L  EP  + PL+ D AKL+  +++ +  +V
Sbjct: 124 PALDLQSIITGLLFLFLEPNPNDPLNKDAAKLFCQNEKKFAEIV 167

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 57.8 bits (138), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 13/109 (11%)

Query: 52  ENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH------- 104
           E++ Y    F   +  PE +P  PP  RF P  I HPN+ +  G +C+ +L         
Sbjct: 51  EDSIYHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTD 108

Query: 105 ----ETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQ 149
               ETWSP+  +  V+ +I +LL +P + SP +VD A  Y  + + Y+
Sbjct: 109 EPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYK 157

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 74/159 (46%), Gaps = 16/159 (10%)

Query: 6   NNRASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWE-AQFCGPENTPYADFTFTLS 64
           N  AS +L +Y+++ +  ++  S  +     D  ++  W        E + Y    F   
Sbjct: 5   NTAASLLLRQYRELTDPKKAIPSFHIALE--DDSNIFLWNIGVMVLNEESIYHGGYFKAQ 62

Query: 65  IEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLL-----------KHETWSPMYNL 113
           ++ P+ +P  PP  RF P  I HPN+ +  G +C+ +L             ETWSP+  +
Sbjct: 63  MKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDEETWSPVQTV 120

Query: 114 LQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
             V+ +I +LL +P + SP +VD A  Y  +   Y+  V
Sbjct: 121 ESVLISIVSLLEDPNISSPANVDAAVDYKKNPDQYKQKV 159

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 13/112 (11%)

Query: 52  ENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH------- 104
           E++ Y    F   +  P+ +P  PP  RF P  I HPN+ +  G +C+ +L         
Sbjct: 51  EDSIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTD 108

Query: 105 ----ETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
               ETWSP+  +  V+ +I +LL +P + SP +VD A  +  + + Y+  V
Sbjct: 109 EPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKNPEQYKQRV 160

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 51/114 (44%), Gaps = 3/114 (2%)

Query: 48  FCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETW 107
              P+   Y    FT  +   E YP EPP  R   N I HPNI    G++CL++L+ E W
Sbjct: 67  IVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRCM-NQIFHPNIDLQ-GKICLNILR-EDW 123

Query: 108 SPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
           SP  +L  V+  I  L  E     PL+   A L   +   +  LV   +   +L
Sbjct: 124 SPALDLQSVIIGILFLFLEVSGRDPLNKQAASLLDENPNKFSRLVQQTMAGYSL 177

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 13/112 (11%)

Query: 52  ENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLL--------- 102
           E++ Y    F   ++ P  +P  PP+ +F P  I HPN+ +  G++C+ +L         
Sbjct: 52  EDSIYNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTS 109

Query: 103 --KHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
              +ETWSP+ ++  V+ +I +LL +P + SP +VD +  Y  + Q Y+  V
Sbjct: 110 EPDNETWSPVQSVESVLISIISLLEDPNISSPANVDASVEYRKNFQEYKRKV 161

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           P+   YA  T+  ++ I + YP EPP  +   + I HPNI    G VCL+LL+ E W+P 
Sbjct: 67  PDIGYYAGGTYYFNVFIKDTYPMEPPVVKCM-HRIYHPNIDID-GNVCLNLLR-EDWTPA 123

Query: 111 YNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRL 156
            ++  ++  I  L  EP    PL+ D AK    D   ++  V + L
Sbjct: 124 LDIQSIIIGILFLFHEPNGRDPLNKDAAKTLIEDPLRFENKVNHSL 169

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (51%), Gaps = 3/102 (2%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           P+   Y    F  +    E YP +PP      N I HPNI    G++CL++L+ E WSP 
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPPKV-ICNNKIFHPNID-PHGKICLNILR-EDWSPA 127

Query: 111 YNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
            +L  +V  + +L  EP  + PL+ + A++ + DK  +  LV
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLV 169

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 54.7 bits (130), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 56/104 (53%), Gaps = 15/104 (14%)

Query: 61  FTLSIEIPEMYPNEPPNCRF-PPNHICHPNIKWSTGEVCLDLL-----------KHETWS 108
           F   ++ P+ +P  PP  +F PP  I HPN+ +  G++C+ +L            +ETWS
Sbjct: 67  FQSQMKFPKDFPFSPPQFKFIPP--IYHPNV-YRDGKLCISILHQSGDAMTSEPDNETWS 123

Query: 109 PMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLV 152
           P+ ++  V+ +I +LL +P V SP +VD A  Y  +   Y+  V
Sbjct: 124 PVQSVESVLISIVSLLEDPNVSSPANVDAAVEYRKNYNEYKKKV 167

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           P+   Y    FT  +   E YP EPP  +   N I HPNI  + G VCL++L+ + W+P 
Sbjct: 61  PDEGYYKGGNFTFELLFNEQYPMEPPKVKC-LNRIYHPNID-TDGRVCLNILRQD-WTPA 117

Query: 111 YNLLQVVEAIRTLLAE-PGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
            +L  V+  +  L  E  GVD PL+   A+ ++ ++Q +   V   +   T+
Sbjct: 118 LDLQSVIIGLLFLFLEISGVD-PLNKQAAETFNRNRQNFAHAVRQSMGGNTI 168

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 37  DGGSLSKWEAQF-CGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTG 95
           +  ++ +WE  F    E++ Y     T  +  P  +P  PP   F P  I HPN+ +S G
Sbjct: 36  EKSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFPRNFPFSPPTFLFCP-PIYHPNV-FSNG 93

Query: 96  EVCLDLLKH-----------ETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVD 144
            +C+ +L             ETWSP+  +  V+ +I +LL +P V SP +VD A  Y   
Sbjct: 94  SLCISILHECGDDTNEEPDSETWSPVQTVETVLISIISLLDDPNVSSPANVDAAVEYKNA 153

Query: 145 KQAYQGLV 152
           +Q Y   V
Sbjct: 154 RQEYNKRV 161

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           P+   Y    FT  +E  + YP EPP      + + HPNI    G+VCL++L+ E WSP 
Sbjct: 73  PDEGFYKGGHFTFKLEFNDAYPIEPPTV-ICTSKLYHPNIDID-GKVCLNILR-EDWSPA 129

Query: 111 YNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
            ++  ++  +  LL EP    PL+ D A + S D   +  LV   +   ++
Sbjct: 130 LDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLSTDTARFASLVNRSMAGYSI 180

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 3/114 (2%)

Query: 48  FCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETW 107
              P+   Y    F   ++  E YP EPP      N I HPNI    G++CL++L+ E W
Sbjct: 73  LISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-EDW 129

Query: 108 SPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
           SP  +L  ++  +  L  E     PL+ + A +   D+  ++  V   +  + L
Sbjct: 130 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDEDMFRKYVRDSMAGKKL 183

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 3/114 (2%)

Query: 48  FCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETW 107
              P+   Y    F   ++  E YP EPP      N I HPNI    G++CL++L+ E W
Sbjct: 74  LISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-EDW 130

Query: 108 SPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
           SP  +L  ++  +  L  E     PL+ + A +   D+  ++  V   +  + L
Sbjct: 131 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDEDMFRKYVRDSMAGKKL 184

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 56  YADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQ 115
           Y    F L     E+YP EPP        I HPNI    G VCL++L+ E WSP  +L  
Sbjct: 77  YGSINFNLDFN--EVYPIEPPKV-VCLKKIFHPNIDLK-GNVCLNILR-EDWSPALDLQS 131

Query: 116 VVEAIRTLLAEPGVDSPLDVDLAKL 140
           ++  +  L  EP  + PL+ D AKL
Sbjct: 132 IITGLLFLFLEPNPNDPLNKDAAKL 156

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           P+   Y    F  S+   + YP EPP  +   N I HPNI  + G VCL++L+ E WSP+
Sbjct: 68  PDEGYYKPGYFRFSLFFKDTYPIEPPAVKCV-NKIYHPNID-TQGNVCLNILR-EDWSPV 124

Query: 111 YNLLQVVEAIRTLLAEPGVDSPLD 134
            +L  VV  +  L  EP    PL+
Sbjct: 125 LDLQSVVIGLLFLFLEPNDKDPLN 148

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 7/103 (6%)

Query: 61  FTLSIEIPEMYPNEPPN--CRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVE 118
           F     I E YP EPP   C      I HPNI   TGE+CL++L+ E WSP  +L  V+ 
Sbjct: 91  FRFQFTINENYPIEPPKVVCL---TKIYHPNIN-RTGEICLNILR-EDWSPALDLQSVII 145

Query: 119 AIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
            +  L  EP    PL+   A     D   ++ +V   +   ++
Sbjct: 146 GLLFLFIEPNPKDPLNKQAADTLLHDPAVFKHIVQKSMAGESI 188

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  + L        L  A D  ++++W     GP ++ + +  +++SIE 
Sbjct: 6   RSFRLLEELEKGEKGLGPESCSYGLADADDI-TMTRWNGTILGPPHSNHENRIYSVSIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLAE 126
              YP+EPP   F  + I  P +  STGEV  +     + W  +YN+  ++  +R  +A 
Sbjct: 65  GPKYPDEPPTITF-ISKINLPCVDQSTGEVNKEKFNTLKDWKRLYNMETILLDLRKEMAS 123

Query: 127 PG 128
           P 
Sbjct: 124 PA 125

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (44%), Gaps = 8/127 (6%)

Query: 28  SILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPN--CRFPPNHI 85
           S+  L P  D       +   C P+   Y    F  ++   E YP +PP+  C      I
Sbjct: 31  SLTTLVPPEDTSRSPLLQITIC-PDEGFYNGGRFKFNLTTSESYPIDPPSVVCL---QKI 86

Query: 86  CHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDK 145
            HPNI  + G++CL++L+ E WSP  ++  V+  +  L  EP    PL+ D A     + 
Sbjct: 87  YHPNIDLN-GKICLNILR-EDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTLIRNS 144

Query: 146 QAYQGLV 152
             +  LV
Sbjct: 145 HDFARLV 151

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 3/88 (3%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           PE   Y    F  S+   + YP EPP  +   N I HPNI +S G +CL++L+ E WSP+
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCL-NTIYHPNIDYS-GNICLNVLR-EDWSPV 139

Query: 111 YNLLQVVEAIRTLLAEPGVDSPLDVDLA 138
            +L  VV  +  L  EP    PL+   A
Sbjct: 140 MDLQTVVLGLLFLFLEPNGSDPLNRQAA 167

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 55/121 (45%), Gaps = 2/121 (1%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R  R+L E ++  E+    ES        D  +++KW     GP ++ + +  ++LSIE 
Sbjct: 6   RNFRLLEELEK-GEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127
              YP+ PP   F  + I  P +  +TGE+  D      W   Y +  ++  +R  +A P
Sbjct: 65  GPNYPDSPPKVTF-ISKINLPCVNQTTGEIQTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

Query: 128 G 128
            
Sbjct: 124 A 124

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLD 100
           ++KW     GP ++ + +  ++LSIE    YP+ PPN  F  + I  P +  +TGEV  +
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTF-ISKINLPCVSQTTGEVQTN 59

Query: 101 LLKHETWSPMYNLLQVVEAIRTLLAEPG 128
                 W   Y +  ++  +R  +A P 
Sbjct: 60  FHTLRDWKRAYTMETLLLDLRKEMATPA 87

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 57/120 (47%), Gaps = 2/120 (1%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  E+    ES        D  S++ W     GP ++ +++  ++LSIE 
Sbjct: 6   RSFRLLEELEK-GEKGMGPESCSYGLADSDDISMTNWNGTILGPPHSNHSNRIYSLSIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127
              YP+EPP  +F  + I    +  +TG V  D    + W   Y +  ++  +R  +A P
Sbjct: 65  GPSYPDEPPTLKF-ISKINLNCVDSATGVVKPDFNPIKNWKRSYTMETILLELRKEMAHP 123

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 55/121 (45%), Gaps = 2/121 (1%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R  R+L E ++  E+    ES        D  +++KW     GP ++ + +  ++LSI+ 
Sbjct: 6   RNFRLLEELEK-GEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127
              YP+ PP   F  + I  P +  +TGEV  D      W   Y +  ++  +R  +A P
Sbjct: 65  GPNYPDSPPKVTF-ISKINLPCVNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

Query: 128 G 128
            
Sbjct: 124 A 124

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLD 100
           ++KW     GP ++ + +  ++LSIE    YP+ PP   F  + I  P +  +TGEV  D
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTF-ISKINLPCVNPTTGEVQTD 59

Query: 101 LLKHETWSPMYNLLQVVEAIRTLLAEPG 128
                 W   Y +  ++  +R  +A P 
Sbjct: 60  FHTLRGWKRAYTMETLLLDLRKEMATPA 87

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 3/106 (2%)

Query: 51  PENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPM 110
           P+   Y    F       + YP EPP      + I HPNI    G VCL++L+ E WSP+
Sbjct: 68  PDEGYYKCGHFKFCATFKDTYPIEPPKVTLL-SKIFHPNIDLQ-GNVCLNILR-EDWSPV 124

Query: 111 YNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRL 156
            ++  ++  +  L  EP    PL+   A + + +   ++  V   L
Sbjct: 125 LDVQSILIGLLMLFLEPNATDPLNKVAADVLAANPHQFRRDVATSL 170

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 58/121 (47%), Gaps = 3/121 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  + L   ES        D  +++KW     GP ++ + +  +++ IE 
Sbjct: 6   RSFRLLEELEKGEKGL-GPESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSVLIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLAE 126
              YP+EPP  +F  + I  P +  +TGEV  +     + W   Y +  V+  +R  +A 
Sbjct: 65  GPSYPDEPPKVKF-VSKINLPCVNSTTGEVVKEKFHTLKEWKRSYTMETVLLELRKEMAT 123

Query: 127 P 127
           P
Sbjct: 124 P 124

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 3/112 (2%)

Query: 50  GPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSP 109
            P+   Y    F  S+   + YP +PP  +     I HPNI ++ G +CL++L+ E W+P
Sbjct: 149 SPDEGFYKHGHFGFSVSFKDSYPIDPPIVKCLTT-IYHPNIDYN-GNICLNVLR-EDWTP 205

Query: 110 MYNLLQVVEAIRTLLAEPGVDSPLDVDLAKLYSVDKQAYQGLVTYRLCSRTL 161
           + +L  +V  +  L  EP    PL+   A     D   ++  V   +   T+
Sbjct: 206 VLDLQTIVIGLLFLFLEPNPKDPLNKHAAHTMVKDPFRFERNVLASMKGATI 257

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 3/121 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  + L   ES       GD  +++ W     GP ++ + +  ++++IE 
Sbjct: 8   RSFRLLEELEKGEKGL-GPESCSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAIEC 66

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLAE 126
              YP+EPP  +F  + I  P +  +TGEV  D       W   Y +  ++  +R  +  
Sbjct: 67  GANYPDEPPLIKF-VSKINLPCVDQTTGEVKHDQFHTLRDWKRSYTMETLLLDLRKEMGT 125

Query: 127 P 127
           P
Sbjct: 126 P 126

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 3/122 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  + L   ES        D  S++ W     GP ++ + +  ++LSIE 
Sbjct: 6   RSFRLLEELEKGEKGL-GPESCSYGLADSDDISMTTWNGTILGPPHSNHENRIYSLSIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLAE 126
              YP+ PP  +F  + I  P +   TG+V          W   YN+  ++  +R  +A 
Sbjct: 65  GPNYPDHPPTIKF-ISKINLPCVDSKTGQVTPSTFHTLRDWKRAYNMETILLELRKEMAT 123

Query: 127 PG 128
           P 
Sbjct: 124 PA 125

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL087C
           (MMS2); 1-intron
          Length = 138

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  E+    ES       GD  S++ W     GP ++ + +  +++ IE 
Sbjct: 6   RSFRLLEELEK-GEKGMGPESCSYGLADGDDISMTHWNGTILGPPHSSHENRIYSVVIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLA 125
              YP+ PP  RF  + I  P +  STGEV  +       W    N+  +++ +R  +A
Sbjct: 65  GAEYPDRPPKVRF-ISRINLPCVDPSTGEVRPEAFHALRDWKRSSNMETLLQDLRKEMA 122

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 58/121 (47%), Gaps = 3/121 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  E+    ES        D  +++ W     GP ++ + +  ++++IE 
Sbjct: 6   RSFRLLEELEK-GEKGMGPESCSYGLAHSDDITMTHWNGTILGPPHSNHENRIYSVAIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLAE 126
            E YP++PP  RF  + +  P +  +TGEV  +       W   Y +  ++  +R  +A 
Sbjct: 65  GEAYPDQPPKIRF-LSKVNLPCVDQNTGEVKKEQFSTLRDWKRSYTMETLLLDLRKEMAL 123

Query: 127 P 127
           P
Sbjct: 124 P 124

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 2/89 (2%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLD 100
           ++ W     GP ++ + +  +++++E    YP+EPP  +F  + I  P +  +TGEV  D
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKF-ISKINLPCVNQTTGEVKRD 59

Query: 101 LLKH-ETWSPMYNLLQVVEAIRTLLAEPG 128
                  W   YN+  ++  +R  +A P 
Sbjct: 60  QFSTLRDWKRSYNMETLLLDLRKEMALPA 88

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 3/122 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R  R+L E ++  + L   ES        D  +++ W     GP ++ + +  +++SIE 
Sbjct: 6   RNFRLLEELEKGEKGL-GPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSVSIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLAE 126
              YP+EPP  +F  + +  P +  +TGEV   +      W   Y +  ++  +R  +A 
Sbjct: 65  GPNYPDEPPKIKF-VSKVNVPCVDSTTGEVKSSVFHTLRDWKRAYTMETLLLDLRKEMAT 123

Query: 127 PG 128
           P 
Sbjct: 124 PA 125

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
           (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 2/89 (2%)

Query: 41  LSKWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVC-L 99
           ++ W     GP ++ +A+  ++LSIE    YP+EPP  +F  + +  P +  +TGEV   
Sbjct: 1   MTYWNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKF-ISRVNLPCVDVNTGEVKPT 59

Query: 100 DLLKHETWSPMYNLLQVVEAIRTLLAEPG 128
           +      W   Y +  ++  +R  +A P 
Sbjct: 60  EFHTLRDWKRSYTMETILLELRKEMALPA 88

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 66/148 (44%), Gaps = 19/148 (12%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK +   ++S    ++  P  D  ++ +W     GP +TPY    +  ++  P  
Sbjct: 9   RLTKEYKLL---VESSPPFILARPNED--NILEWHYIITGPPDTPYDGGQYHGTLTFPND 63

Query: 71  YPNEPPNCR-FPPNHICHPNIKWSTGEVCLDLLKH--ETWSPMYNLLQVVEAIRTLL--- 124
           YP +PP  R   PN     N +     +CL +  +  +TW+P +++  ++  + + +   
Sbjct: 64  YPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMTGN 118

Query: 125 -AEPGVDSPLDVDLAKL--YSVDKQAYQ 149
            A  G  +  D    KL   SV+   YQ
Sbjct: 119 EATTGSITTTDAQKRKLASQSVNFNTYQ 146

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 13/118 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK + E    +   ++  P  D  ++ +W     GP +TPY    +  ++  P  
Sbjct: 9   RLTKEYKLMVENPPPY---ILARPNED--NILEWHYIITGPADTPYKGGQYHGTLTFPSD 63

Query: 71  YPNEPPNCR-FPPNHICHPNIKWSTGEVCLDLLKH--ETWSPMYNLLQVVEAIRTLLA 125
           YP +PP  R   PN    PN +     +CL +  +  +TW+P +++  ++  + + + 
Sbjct: 64  YPYKPPAIRMITPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  E+    ES        D  +++KW     GP ++ + +  ++L I  
Sbjct: 6   RSFRLLEELEK-GEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLEIVC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLAE 126
            + YP+EPP  +F  + +  P +  +TG V  +       W   Y +  V+  +R  +  
Sbjct: 65  GDRYPDEPPLVKF-ISKVNLPCVDQTTGVVSAEKFHTLRDWKRSYTMQTVLLDLRKEMGT 123

Query: 127 P 127
           P
Sbjct: 124 P 124

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 13/118 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK + E    +   ++  P  D  ++ +W     GP +TPY    +  ++  P  
Sbjct: 9   RLTKEYKLMVENPPPY---ILARPNED--NILEWHYIITGPADTPYKGGQYHGTLTFPSD 63

Query: 71  YPNEPPNCRF-PPNHICHPNIKWSTGEVCLDLLKH--ETWSPMYNLLQVVEAIRTLLA 125
           YP +PP  R   PN    PN +     +CL +  +  +TW+P +++  ++  + + + 
Sbjct: 64  YPYKPPAIRMVTPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 58/119 (48%), Gaps = 3/119 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  + L   ES       G+  +++ W     GP ++ + +  +++ I+ 
Sbjct: 6   RSFRLLEELEKGEKGL-GPESCSYGLANGEDITMTTWNGTILGPPHSNHENRIYSVVIKC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKH-ETWSPMYNLLQVVEAIRTLLA 125
            + YP++PP  +F  + I  P +  +TGEV  ++      W   Y +  ++  +R  +A
Sbjct: 65  GDEYPDKPPTVKF-ISKINLPCVDQATGEVETNMFHTLRDWKRSYTMETLLLDLRKEMA 122

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 55/117 (47%), Gaps = 13/117 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK I   + +    ++  P  D  ++ +W     GP +TPY +  +  ++  P  
Sbjct: 9   RLTKEYKNI---VNNPPPFIIAAPHED--NILEWHYVITGPPSTPYENGQYHGTLTFPSD 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTG-EVCLDLLKH--ETWSPMYNLLQVVEAIRTLL 124
           YP  PP  R     +  PN ++     +CL +  +  E W+P ++++ ++  + + +
Sbjct: 64  YPFNPPAIR-----MITPNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFM 115

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 13/118 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK + E    +   ++  P  D  ++ +W     GP +TPY    +  ++  P  
Sbjct: 9   RLTKEYKLMVENPPPY---ILARPNED--NILEWHYIITGPADTPYKAGQYHGTLTFPSD 63

Query: 71  YPNEPPNCR-FPPNHICHPNIKWSTGEVCLDLLKH--ETWSPMYNLLQVVEAIRTLLA 125
           YP +PP  R   PN    PN +     +CL +  +  +TW+P +++  ++  + + + 
Sbjct: 64  YPYKPPAIRMITPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 55/118 (46%), Gaps = 13/118 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK I E    +   ++  P  +  ++ +W     GP +TPY    +  ++  P  
Sbjct: 9   RLSKEYKMIMENTPPY---IIAVPNDE--NILEWHYVITGPPDTPYEGGQYHGTLHFPPE 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWST-GEVCLDLLKH--ETWSPMYNLLQVVEAIRTLLA 125
           YP +PP  R     I  PN ++     +CL +  +  +TW+P +++  ++  + + + 
Sbjct: 64  YPFKPPAIR-----ISTPNGRFKQHTRLCLSMSDYHPDTWNPSWSVATILNGLLSFMT 116

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK + E    +   ++  P  D  ++ +W     GP  TPY    +  ++  P  
Sbjct: 9   RLTKEYKLMVENPPPY---ILARPNED--NILEWHYIITGPAETPYKGGQYHGTLTFPSD 63

Query: 71  YPNEPPNCRF-PPNHICHPNIKWSTGEVCLDLLKH--ETWSPMYNLLQVVEAIRTLL 124
           YP +PP  R   PN    PN +     +CL +  +  +TW+P +++  ++  + + +
Sbjct: 64  YPYKPPAIRMVTPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 55/118 (46%), Gaps = 13/118 (11%)

Query: 10  SRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPE 69
            R+  EYK I   +++    +   P  D  ++ +W     GP +TPY D  +  ++  P 
Sbjct: 8   KRLTKEYKAI---IENPPQFINAQPNED--NILEWHYIITGPPDTPYTDGQYHGTLVFPA 62

Query: 70  MYPNEPPNCR-FPPNHICHPNIKWSTGEVCLDLLKH--ETWSPMYNLLQVVEAIRTLL 124
            YP +PP  R   PN     N +     +C+ +  +  +TW+P +++  ++  + + +
Sbjct: 63  DYPFKPPAIRMITPNGRFKENTR-----LCMTMSDYHPDTWNPAWSVATILMGLLSFM 115

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 41/86 (47%), Gaps = 8/86 (9%)

Query: 43  KWEAQFCGPENTPYADFTFTLSIEIPEMYPNEPPNCR-FPPNHICHPNIKWSTGEVCLDL 101
           +W     GP++TPY    +  ++  P  YP +PP  R   PN     N +     +CL +
Sbjct: 36  EWHYIIIGPQDTPYDGGQYHGTLTFPSDYPYKPPAIRMITPNGRFKENTR-----LCLSM 90

Query: 102 LKH--ETWSPMYNLLQVVEAIRTLLA 125
             +  +TW+P +++  ++  + + + 
Sbjct: 91  SDYHPDTWNPGWSVATILNGLLSFMT 116

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 13/118 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK + E    +   ++  P  D  ++  W     GP  TPY D  +  ++  P  
Sbjct: 9   RLSKEYKMMTENPPPY---IVAAPKED--NILVWHYVITGPPETPYEDGQYHGTLVFPND 63

Query: 71  YPNEPPNCR-FPPNHICHPNIKWSTGEVCLDLLKH--ETWSPMYNLLQVVEAIRTLLA 125
           YP  PP  R   PN     N +     +CL +  +  +TW+P +++  ++  + + + 
Sbjct: 64  YPFNPPAIRMLTPNGRFRENTR-----LCLSMSDYHPDTWNPSWSVATILTGLLSFMT 116

>TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 bp,
           139 aa] {ON} Anc_6.187 YGL087C
          Length = 139

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 7/123 (5%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  E+    ES       GD  ++++W     GP ++ + +  ++LSIE 
Sbjct: 6   RSFRLLEELEK-GEKGMGPESCSYGLADGDDITMTRWNGTILGPPHSNHENRIYSLSIEC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVC---LDLLKHETWSPMYNLLQVVEAIRTLL 124
              YP+ PP   F  + I  P +   TG+V      LL+   W     + +++  +R  +
Sbjct: 65  GPNYPDAPPVLFF-ISKINLPCVSPKTGQVMPSEFHLLRD--WKRSCTMEKILLELRKEM 121

Query: 125 AEP 127
           A P
Sbjct: 122 ASP 124

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 54/118 (45%), Gaps = 13/118 (11%)

Query: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70
           R+  EYK + E    +     +    +  ++ +W     GP ++PY D  +  ++  P  
Sbjct: 9   RLTKEYKMMMENPTPY-----IIARPNESNILEWHYVITGPPDSPYHDGQYHGTLTFPSD 63

Query: 71  YPNEPPNCRFPPNHICHPNIKWSTG-EVCLDLLKH--ETWSPMYNLLQVVEAIRTLLA 125
           YP +PP  R     +  PN ++     +CL +  +  +TW+P +++  ++  + + + 
Sbjct: 64  YPYKPPAIR-----MVTPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMT 116

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 36.2 bits (82), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 3/122 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  E+    ES        D  +++ W     GP ++ + +  ++L I  
Sbjct: 6   RSFRLLEELEK-GEKGFGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSLEIVC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVC-LDLLKHETWSPMYNLLQVVEAIRTLLAE 126
              YP+EPP  +F  + +  P I   TGE+   +      W   Y +  V+  +R  +A 
Sbjct: 65  GPNYPDEPPKVKF-VSKVNLPCIDDKTGEIKEKEFHTLRDWKRSYTMQTVLLELRKEMAL 123

Query: 127 PG 128
           P 
Sbjct: 124 PA 125

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 35.8 bits (81), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R  R+L E ++  + L   ES        D  +++KW     GP ++ + +  ++++I  
Sbjct: 6   RNFRLLEELEKGEKGLGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSVAIHC 64

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVC-LDLLKHETWSPMYNLLQVVEAIRTLLAE 126
              YP+ PP  +F  + I  P +   TGEV          W   Y +  ++  +R  +A 
Sbjct: 65  GPHYPDAPPTIKF-VSKINLPCVDEKTGEVKQASFHTLRDWKRSYTMETLLLDLRKEMAS 123

Query: 127 PG 128
           P 
Sbjct: 124 PA 125

>NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa]
           {ON} Anc_6.187 YGL087C
          Length = 157

 Score = 35.8 bits (81), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 8   RASRMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67
           R+ R+L E ++  E+ +  ES       GD  +++ W     GP ++ + +  ++++I  
Sbjct: 25  RSFRLLEELEK-GEKGKGPESCSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAITC 83

Query: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEV-CLDLLKHETWSPMYNLLQVVEAIRTLLAE 126
              YP+ PP  +F  + I  P +   TGEV          W   + +  ++  +R  +A 
Sbjct: 84  GPNYPDVPPTIKF-ISKINLPCVDDVTGEVKASSFHTLRDWKRSFTMENLLLDLRKEMAT 142

Query: 127 P 127
           P
Sbjct: 143 P 143

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,233,143
Number of extensions: 742677
Number of successful extensions: 2114
Number of sequences better than 10.0: 268
Number of HSP's gapped: 1778
Number of HSP's successfully gapped: 268
Length of query: 161
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 60
Effective length of database: 41,900,133
Effective search space: 2514007980
Effective search space used: 2514007980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)