Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12333.496ON87873806e-49
TBLA0D029403.496ON71431662e-16
KLTH0F14938g3.496ON229521743e-16
Kwal_55.212483.496ON222521692e-15
Kpol_1017.43.496ON184461654e-15
Suva_16.4793.496ON212441612e-14
YPR151C (SUE1)3.496ON206441612e-14
Smik_16.4033.496ON203441602e-14
ZYRO0D09812g3.496ON185431593e-14
TPHA0D033003.496ON196431593e-14
SAKL0F02618g3.496ON253491613e-14
TDEL0D056403.496ON124601544e-14
Skud_16.4453.496ON215441585e-14
KNAG0A079603.496ON177511575e-14
KLLA0E03983g3.496ON191551569e-14
NDAI0B058903.496ON278431473e-12
AFR315C3.496ON77501375e-12
KAFR0G037103.496ON79411366e-12
NCAS0F035703.496ON230421394e-11
CAGL0L08426g3.496ON140511242e-09
TPHA0G015708.682ON255331001e-05
KLLA0D06061g8.682ON24941982e-05
SAKL0H06380g8.682ON21927982e-05
Kpol_1066.443.62ON47927903e-04
Kpol_1013.98.682ON26153860.001
Kpol_1072.128.682ON22227850.001
YPL159C (PET20)8.682ON25327840.002
ZYRO0C02244g3.62ON46027830.003
Suva_16.1518.682ON25327820.003
ZYRO0F07480g8.682ON23627820.003
TDEL0E007103.62ON47627820.003
Skud_16.1238.682ON25527820.004
YNL295W3.62ON52438810.004
KNAG0J017608.682ON25827810.005
KAFR0H023808.682ON22034800.006
Smik_6.3568.682ON25327800.006
Kwal_26.88288.682ON22340800.007
KLLA0A07447g3.62ON48644790.010
NCAS0A099403.62ON49438790.011
TPHA0D012908.682ON21837760.020
Skud_14.423.62ON52436770.021
TBLA0B038008.682ON32437760.021
KLTH0D11396g8.682ON22528740.042
TDEL0A062708.682ON24268730.061
CAGL0M02101g8.682ON26732710.10
SAKL0C12342g3.62ON55227700.14
TPHA0P012603.62ON49427680.26
NCAS0C013108.682ON25732680.32
TBLA0B027208.798ON50235670.45
Smik_14.363.62ON52427660.62
Suva_14.443.62ON52536650.83
Ecym_35273.62ON48727641.0
Ecym_23908.682ON22727631.1
TBLA0B085103.62ON50127631.5
NDAI0A061103.62ON49027621.8
KNAG0K023503.62ON49127622.2
ABR105C3.404ON31040612.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1233
         (87 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...   150   6e-49
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    69   2e-16
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...    72   3e-16
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...    70   2e-15
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...    68   4e-15
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...    67   2e-14
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...    67   2e-14
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...    66   2e-14
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...    66   3e-14
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...    66   3e-14
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...    67   3e-14
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    64   4e-14
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...    65   5e-14
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...    65   5e-14
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...    65   9e-14
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...    61   3e-12
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    57   5e-12
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    57   6e-12
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    58   4e-11
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    52   2e-09
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    43   1e-05
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    42   2e-05
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    42   2e-05
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    39   3e-04
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    38   0.001
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    37   0.001
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    37   0.002
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    37   0.003
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    36   0.003
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    36   0.003
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    36   0.003
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    36   0.004
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    36   0.004
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    36   0.005
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    35   0.006
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    35   0.006
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    35   0.007
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    35   0.010
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    35   0.011
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    34   0.020
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    34   0.021
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    34   0.021
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    33   0.042
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    33   0.061
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    32   0.10 
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    32   0.14 
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    31   0.26 
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    31   0.32 
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    30   0.45 
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    30   0.62 
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    30   0.83 
Ecym_3527 Chr3 (1001629..1003092) [1464 bp, 487 aa] {ON} similar...    29   1.0  
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    29   1.1  
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    29   1.5  
NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa] ...    28   1.8  
KNAG0K02350 Chr11 complement(468252..469727) [1476 bp, 491 aa] {...    28   2.2  
ABR105C Chr2 complement(575099..576031) [933 bp, 310 aa] {ON} Sy...    28   2.3  

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score =  150 bits (380), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 75/87 (86%)

Query: 1  MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILESSI 60
          MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILESSI
Sbjct: 1  MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILESSI 60

Query: 61 GKGLGRDKDKXXXXXXXXXXXXVRGHG 87
          GKGLGRDKDK            VRGHG
Sbjct: 61 GKGLGRDKDKGNAGNGCSGASSVRGHG 87

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 68.6 bits (166), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/43 (69%), Positives = 36/43 (83%)

Query: 9  ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRS 51
          +LR LPRVPTT+YL    L  DIFFSGYRP++YPVK+NPLFR+
Sbjct: 15 VLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
          {ON} weakly similar to uniprot|Q06524 Saccharomyces
          cerevisiae YPR151C SUE1 Mitochondrial protein required
          for degradation of unstable forms of cytochrome c
          Length = 229

 Score = 71.6 bits (174), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 40/52 (76%)

Query: 1  MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSS 52
          M+K K  EI R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLF+ +
Sbjct: 14 MLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEA 65

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa]
          {ON} YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score = 69.7 bits (169), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 40/52 (76%)

Query: 1  MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSS 52
          M+K +  +I R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLF+ +
Sbjct: 14 MLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKET 65

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
          (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score = 68.2 bits (165), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%)

Query: 9  ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKN 54
          I R LPRVPTTQ+L    L  DI FSGYRP+ YPVK+NPLFR++ N
Sbjct: 35 IFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGN 80

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score = 66.6 bits (161), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 10  LRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSK 53
            R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLFR  K
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 105

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
          SUE1Mitochondrial protein required for degradation of
          unstable forms of cytochrome c
          Length = 206

 Score = 66.6 bits (161), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 10 LRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSK 53
           R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLFR  K
Sbjct: 55 FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 98

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa]
          {ON} YPR151C (REAL)
          Length = 203

 Score = 66.2 bits (160), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 10 LRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSK 53
           R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLFR  K
Sbjct: 53 FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 96

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 185

 Score = 65.9 bits (159), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%)

Query: 8  EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFR 50
          +I R +PRVPTTQ+L   EL  DI FSGYRP++YPVK+NPLF+
Sbjct: 23 DIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFK 65

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
          Anc_3.496 YPR151C
          Length = 196

 Score = 65.9 bits (159), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%)

Query: 9  ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRS 51
          I ++LPRVPTT+YL   +L  DI FSGYRP+ YPVK+NPLFR+
Sbjct: 50 IFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRN 92

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar
          to uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
          Mitochondrial protein required for degradation of
          unstable forms of cytochrome c
          Length = 253

 Score = 66.6 bits (161), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%)

Query: 1  MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLF 49
          M+K K  +I R LP+VPTTQ+L   EL  DI FSGYRP+ YPVK+NP F
Sbjct: 14 MIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFF 62

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa]
          {ON} Anc_3.496 YPR151C
          Length = 124

 Score = 63.9 bits (154), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (71%), Gaps = 1/60 (1%)

Query: 8  EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLF-RSSKNILESSIGKGLGR 66
          ++ R LPRVPTT++L  + L +DI FSGYRP++YPV++NPLF R +K    +S+   L R
Sbjct: 29 DLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKTEAPASLESNLPR 88

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score = 65.5 bits (158), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 10  LRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSK 53
            R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLFR  K
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 105

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa]
          {ON} Anc_3.496 YPR151C
          Length = 177

 Score = 65.1 bits (157), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 9  ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILESS 59
          + R LP+VP T+YL   EL  DI +SGYRP++YPV++NPLFR+S  ++  S
Sbjct: 31 MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAIS 81

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 191

 Score = 64.7 bits (156), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 40/55 (72%)

Query: 3  KGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILE 57
          K K  ++ R LPRVPTT++L+ +EL  DI FSGYRP+V P++ NPLF++    LE
Sbjct: 5  KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELE 59

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score = 61.2 bits (147), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%)

Query: 8   EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFR 50
            I R +P+VP T+YL  +EL  D+ +SGYRP++YPVK+NPLFR
Sbjct: 127 NIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFR 169

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 57.4 bits (137), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 8  EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILE 57
          +  R LPRVP+TQ+L  +++R DI FS +RP+ YPV QNPL R    +L 
Sbjct: 5  QFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLS 54

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 57.0 bits (136), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 34/41 (82%)

Query: 9  ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLF 49
          + ++LPRVPTT+YL   +L+ DI ++GYRP++YP+K+NPL 
Sbjct: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 58.2 bits (139), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (80%)

Query: 9   ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFR 50
           I R LP+VP T+YL  ++L  +I F+GY+P++YPV++NPLF+
Sbjct: 117 IFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK 158

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
          to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 52.4 bits (124), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (70%), Gaps = 1/51 (1%)

Query: 8  EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILES 58
          EI R LP+VP T+YL    L  D+ ++GYRP++YP+++NPL   S N+ E+
Sbjct: 6  EIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHS-NVRET 55

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQ 45
           LP+ PTT +L   E  TD+F+SGYRP+   V Q
Sbjct: 106 LPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQ 138

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 3/41 (7%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMVY---PVKQNPLFR 50
           LPRVPTT+++  EE  +D+ +SGYRP+V      K+N L +
Sbjct: 112 LPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQ 152

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 23/27 (85%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LP+ P+T++L L E+ TD+F+SGYRP+
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPI 109

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 23/27 (85%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LPRVP+T+ + +EE++TD  F+GYRP+
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPL 100

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILESSIGKGLG 65
           LP+VP+T+ L+  E+RT   +SGYRP+    K      S KN L  ++  G+ 
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPIYINSKG-----SGKNKLSGTMKNGVN 159

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 23/27 (85%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LP+VP+ + L+ +++ TDIF+SG+RP+
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPL 123

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LPRVP+T +L   ++ T++ +SGYRP+
Sbjct: 103 LPRVPSTSHLKQSDMTTNVLYSGYRPL 129

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 36.6 bits (83), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 13 LPRVPTTQYLSLEELRTDIFFSGYRPM 39
          +PRVP T Y+S  E++T+  F+GYRP+
Sbjct: 58 VPRVPPTDYISAPEIQTEGLFAGYRPL 84

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 36.2 bits (82), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LPRVP+T +L   ++ T++ +SGYRP+
Sbjct: 103 LPRVPSTSHLKHSDMTTNVLYSGYRPI 129

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 36.2 bits (82), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LPRVP+T YL   ++ + I +SGYRP+
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPL 114

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 36.2 bits (82), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LPRVP+T Y+   E++T+  F+GYRP+
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPL 101

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 36.2 bits (82), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LPRVP+T +L   ++ T++ +SGYRP+
Sbjct: 103 LPRVPSTSHLKHTDMTTNVLYSGYRPL 129

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 35.8 bits (81), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 2/38 (5%)

Query: 2   VKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPM 39
           + G  L +L  +PRV +T Y+S +E+ T+  F+GYRP+
Sbjct: 102 ISGSNLHLL--VPRVASTDYISNKEVHTEGLFAGYRPL 137

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 35.8 bits (81), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 21/27 (77%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LP VP+TQ++   ++ T++ +SGYRP+
Sbjct: 96  LPSVPSTQHIEANDMCTELLYSGYRPL 122

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 35.4 bits (80), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQN 46
           LPRVP+T  +  ++L T++ FS YRP+   +K +
Sbjct: 91  LPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 35.4 bits (80), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 21/27 (77%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           LP+VP+T +L   ++ T++ +SGYRP+
Sbjct: 103 LPKVPSTSHLKQSDMTTNVLYSGYRPL 129

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 35.4 bits (80), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 2   VKGKPLEI-LRHLPRVPTTQYLSLEELRTDIFFSGYRPMV 40
           +KGK L+     LP+ P+T +L   ++ T + +SGYRP V
Sbjct: 73  LKGKQLKTDFSWLPKAPSTDHLKQRDVSTTLLYSGYRPFV 112

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 35.0 bits (79), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 30/44 (68%), Gaps = 2/44 (4%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNIL 56
           +P+VP+T YL  E+L T+  F+GY+P+   +  +PL  ++ ++L
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPLESNNNDVL 131

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 35.0 bits (79), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM-----VYPVKQ 45
           +P+VPTT Y+   E++T+  F+GY+P+     V PVK+
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKK 107

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 33.9 bits (76), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLF 49
           LP+VP T  ++  E+ T+  +SGYRP+    K+  L 
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLL 131

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 34.3 bits (77), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 26/36 (72%), Gaps = 2/36 (5%)

Query: 4   GKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPM 39
           G  L +L  +P+V +T+Y+ ++E+ T+  F+GYRP+
Sbjct: 104 GSNLHLL--VPKVASTEYIPIKEVHTEGLFAGYRPL 137

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 33.9 bits (76), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 3   KGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPM 39
           K KP++    LP+VPT + L   ++ T++ +SGYRP+
Sbjct: 158 KIKPID-YSWLPKVPTLKNLKQRDVMTNVLYSGYRPL 193

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 33.1 bits (74), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMV 40
           LP+ P+T +L   ++ T + +SGYRP V
Sbjct: 85  LPKAPSTDHLKHRDVSTTLLYSGYRPFV 112

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 32.7 bits (73), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 13/68 (19%)

Query: 2   VKGKPLEILRH----LPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILE 57
           + G+  +  RH    LPRVP+T  L   ++   + +SGYR         PLF +   I  
Sbjct: 81  ISGRGRKQQRHDYSWLPRVPSTGNLKPRDMSMKVLYSGYR---------PLFINPDEIKT 131

Query: 58  SSIGKGLG 65
           SS G G G
Sbjct: 132 SSEGSGTG 139

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 32.0 bits (71), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMVYPVK 44
           LPRV       L+ + T++ +SGYRP+ + V+
Sbjct: 116 LPRVEQISDTKLKNMSTEVLYSGYRPLFFDVE 147

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 31.6 bits (70), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           +P VP T Y+   E++T+  F+GY+P+
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPL 187

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 30.8 bits (68), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           +P+V +T  LS  E++T+  F+GYRP+
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPL 115

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 30.8 bits (68), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPMVYPVK 44
           LP+V     L   E+ TDI +SGYRP+    K
Sbjct: 90  LPKVEPITNLRHNEISTDILYSGYRPLFLNFK 121

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 30.4 bits (67), Expect = 0.45,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 9   ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPV 43
           I  HLP +P T YL+ + L  DI  SG  P+  P+
Sbjct: 272 IYNHLPSLPDTLYLNAKNLGQDIISSG--PLYSPI 304

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 30.0 bits (66), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 20/27 (74%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           +P+V +T ++  +E+ T+  F+GYRP+
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPL 137

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 29.6 bits (65), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 4   GKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPM 39
           G  L +L  +P+V +T ++  +E+ T+  F+GYRP+
Sbjct: 105 GSNLHLL--VPKVASTDHIPKKEVNTEGLFAGYRPL 138

>Ecym_3527 Chr3 (1001629..1003092) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii AEL203W
          Length = 487

 Score = 29.3 bits (64), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           +P V +T ++ LEE+ T+  F+ YRP+
Sbjct: 94  VPTVASTDHVPLEEIATEELFARYRPL 120

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 28.9 bits (63), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
            P  P T++L   ++  D+ +SGYRP+
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRPL 115

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 28.9 bits (63), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           +PRV +T+ +   E++ D  F+GYRP+
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPL 116

>NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa]
          {ON} Anc_3.62 YNL295W
          Length = 490

 Score = 28.5 bits (62), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 20/27 (74%)

Query: 13 LPRVPTTQYLSLEELRTDIFFSGYRPM 39
          +PRV  T ++ + E++T+  F+GY+P+
Sbjct: 67 VPRVGETDHIPVNEVQTEGLFAGYKPL 93

>KNAG0K02350 Chr11 complement(468252..469727) [1476 bp, 491 aa] {ON}
           Anc_3.62 YNL295W
          Length = 491

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 13  LPRVPTTQYLSLEELRTDIFFSGYRPM 39
           +PRV  T ++  + + T+  F+GYRP+
Sbjct: 120 VPRVQPTDHIGADTIHTEGLFAGYRPL 146

>ABR105C Chr2 complement(575099..576031) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR080W
           (TWF1)
          Length = 310

 Score = 28.1 bits (61), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 29  TDIF-FSGYRPMVYPVKQNPLFRSSKNILESSIGKG-LGR 66
           +DI+ F  Y P   PV++  L+ SSKN L   +G   +GR
Sbjct: 69  SDIWQFVSYTPDTAPVREKMLYASSKNTLLRQVGTNKIGR 108

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.141    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,806,719
Number of extensions: 259257
Number of successful extensions: 683
Number of sequences better than 10.0: 59
Number of HSP's gapped: 683
Number of HSP's successfully gapped: 59
Length of query: 87
Length of database: 53,481,399
Length adjustment: 59
Effective length of query: 28
Effective length of database: 46,716,105
Effective search space: 1308050940
Effective search space used: 1308050940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)