Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12323.497ON1204120460380.0
AFR316W3.497ON1191121040010.0
SAKL0F02596g3.497ON1132119829090.0
KLTH0G02442g3.497ON1113116025220.0
Kwal_47.188863.497ON1105116025100.0
ZYRO0D09790g3.497ON1180116620370.0
Suva_7.4223.497ON1127119319410.0
TDEL0D056503.497ON1077117619310.0
NCAS0E007703.497ON1150119318530.0
KAFR0C020003.497ON1066100818360.0
Skud_7.4453.497ON1123118018090.0
Smik_6.2303.497ON1124101417920.0
YGR134W (CAF130)3.497ON112293017710.0
KNAG0B007703.497ON1038119316060.0
TBLA0C045103.497ON1307133316190.0
Kpol_480.123.497ON1114118016000.0
NDAI0G009003.497ON127993015680.0
CAGL0I10428g3.497ON1163102514590.0
TPHA0A056803.497ON107473113301e-163
KLLA0E03961g3.497ON1132119412941e-158
TPHA0C018108.477ON43143753.1
KNAG0E017602.231ON902100763.2
Kpol_1048.328.595ON44372744.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1232
         (1204 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...  2330   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...  1545   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...  1125   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   976   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   971   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   789   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   752   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   748   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   718   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   711   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   701   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   694   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   686   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   623   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   628   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   620   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   608   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   566   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   516   e-163
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   503   e-158
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    33   3.1  
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    34   3.2  
Kpol_1048.32 s1048 complement(92901..94232) [1332 bp, 443 aa] {O...    33   4.8  

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score = 2330 bits (6038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1132/1204 (94%), Positives = 1132/1204 (94%)

Query: 1    MVRKNKTKVDAPVVKGPLTSIFRTYKPDIRSLVEFRLNVGDEHFDALITEKVVVTLFMTR 60
            MVRKNKTKVDAPVVKGPLTSIFRTYKPDIRSLVEFRLNVGDEHFDALITEKVVVTLFMTR
Sbjct: 1    MVRKNKTKVDAPVVKGPLTSIFRTYKPDIRSLVEFRLNVGDEHFDALITEKVVVTLFMTR 60

Query: 61   SGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSRRDILSEFLDFCLRNE 120
            SGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSRRDILSEFLDFCLRNE
Sbjct: 61   SGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSRRDILSEFLDFCLRNE 120

Query: 121  NCALDYIEYASATRKLPLQFLLPEPLRPYLIDDEYNLLLDYMIQSRPMWEMLLTQGIPKF 180
            NCALDYIEYASATRKLPLQFLLPEPLRPYLIDDEYNLLLDYMIQSRPMWEMLLTQGIPKF
Sbjct: 121  NCALDYIEYASATRKLPLQFLLPEPLRPYLIDDEYNLLLDYMIQSRPMWEMLLTQGIPKF 180

Query: 181  LPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKL 240
            LPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKL
Sbjct: 181  LPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKL 240

Query: 241  NVALWSHSWPASYTKQTXXXXXXXXXXXXXXXXXSENDHWPQQKLSSREQVFTFDLNRDG 300
            NVALWSHSWPASYTKQT                 SENDHWPQQKLSSREQVFTFDLNRDG
Sbjct: 241  NVALWSHSWPASYTKQTLLDLSNDDDDHYDQDVDSENDHWPQQKLSSREQVFTFDLNRDG 300

Query: 301  TLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISID 360
            TLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISID
Sbjct: 301  TLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISID 360

Query: 361  LIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDE 420
            LIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDE
Sbjct: 361  LIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDE 420

Query: 421  SVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNL 480
            SVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNL
Sbjct: 421  SVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNL 480

Query: 481  TNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPI 540
            TNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPI
Sbjct: 481  TNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPI 540

Query: 541  NLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDY 600
            NLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDY
Sbjct: 541  NLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDY 600

Query: 601  EYDDYNAIDPEQLYXXXXXXXXXXXXXXXXXXXKDMRGYYKRCHCVFXXXXXXXXXXXGE 660
            EYDDYNAIDPEQLY                   KDMRGYYKRCHCVF           GE
Sbjct: 601  EYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRGYYKRCHCVFDDDELLSDEEEGE 660

Query: 661  TASSNIDRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLN 720
            TASSNIDRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLN
Sbjct: 661  TASSNIDRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLN 720

Query: 721  FYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMN 780
            FYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMN
Sbjct: 721  FYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMN 780

Query: 781  GRTDKGSSSNSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRR 840
            GRTDKGSSSNSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRR
Sbjct: 781  GRTDKGSSSNSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRR 840

Query: 841  VLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTI 900
            VLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRN             VTI
Sbjct: 841  VLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTI 900

Query: 901  KIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEY 960
            KIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEY
Sbjct: 901  KIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEY 960

Query: 961  GLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIP 1020
            GLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIP
Sbjct: 961  GLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIP 1020

Query: 1021 EARNLFFKLKSSILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDH 1080
            EARNLFFKLKSSILEA            GTENIRKKSSQSLVTEGEGIEQKIVNIDREDH
Sbjct: 1021 EARNLFFKLKSSILEASSQNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVNIDREDH 1080

Query: 1081 LENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNENTAVTA 1140
            LENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNENTAVTA
Sbjct: 1081 LENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNENTAVTA 1140

Query: 1141 LRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFGIDYNSVVNNEDE 1200
            LRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFGIDYNSVVNNEDE
Sbjct: 1141 LRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFGIDYNSVVNNEDE 1200

Query: 1201 ELST 1204
            ELST
Sbjct: 1201 ELST 1204

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score = 1545 bits (4001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 781/1210 (64%), Positives = 896/1210 (74%), Gaps = 25/1210 (2%)

Query: 1    MVRKNKTKVDAPVVKGPLTSIFRTYKPDIRSLVEFRLNVGDEHFDALITEKVVVTLFMTR 60
            MV+KNK K D P V  PL S+  TYKP I+SL+E  +  GD HF+ +I EKVVVTLFMTR
Sbjct: 1    MVKKNKVKSDTPTVVSPLASVIHTYKPSIQSLLELNVQEGDPHFELMIVEKVVVTLFMTR 60

Query: 61   SGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSRRDILSEFLDFCLRNE 120
             GNS+LH+LYDL CGRIKL+EY+QSLKVRSN   WK+CYK+WGSRRD LS FLDFCLRNE
Sbjct: 61   GGNSILHLLYDLSCGRIKLSEYRQSLKVRSNVHQWKTCYKEWGSRRDTLSRFLDFCLRNE 120

Query: 121  NCALDYIEYASATRKLPLQFLLPEPLRPYLIDDEYNLLLDYMIQSRPMWEMLLTQGIPKF 180
            +CALDY EY    RKLPLQFLLP  L  Y++D+ YNLLLDY+I SR MWE LL QGIP+ 
Sbjct: 121  DCALDYTEYGRVMRKLPLQFLLPAGLHAYVLDEGYNLLLDYIINSRLMWEELLIQGIPRL 180

Query: 181  LPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKL 240
            LPEL+++YNR +EFNGYY WYG    S     +ST+EL+TK  Y LFDKLTV KELLP+L
Sbjct: 181  LPELIEDYNRVFEFNGYYTWYGGAP-SGAGAANSTRELHTKVLYALFDKLTVAKELLPRL 239

Query: 241  NVALWSHSWPASYTKQTXXXXXXXXXXXXXXXXXSENDHWPQQKLSSREQVFTFDLNRDG 300
            N  +WSHSWP  Y K                    E D WPQ K S++EQV+TF+LNRDG
Sbjct: 240  NATVWSHSWPPMYHKHGINEFSNEEEDLYDFDSELEGDSWPQHKSSAKEQVYTFELNRDG 299

Query: 301  TLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISID 360
            +LEFPNVFLH ++RHE LYR+LGLP+ E PLL+AQFMTL ALVDPITQPPPTE HIISID
Sbjct: 300  SLEFPNVFLHTRRRHETLYRILGLPNRECPLLRAQFMTLCALVDPITQPPPTEKHIISID 359

Query: 361  LIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDE 420
            LI+QMF    S         RG+DWRFHVC+N+QKI+LATMKRLNCHD +VLN++NNSDE
Sbjct: 360  LIYQMF--LGSISSLLESSLRGQDWRFHVCHNLQKIILATMKRLNCHDSEVLNSINNSDE 417

Query: 421  SVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNL 480
            +VHWNVN+ KWTPRGLNTQDLELLYMVDML IY +Y+LYS LPVQMNPFLPL+ HLWKNL
Sbjct: 418  TVHWNVNIGKWTPRGLNTQDLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNL 477

Query: 481  TNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPI 540
            TNVLL GLEIDRFEEDRETF+TPIIVRA IRG+AALRSVVATMIN HFS KEHDFKHEPI
Sbjct: 478  TNVLLLGLEIDRFEEDRETFSTPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPI 537

Query: 541  NLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDY 600
            NLFMSPHGRKLC GALYADVRSHAAAML+LGI+LNDVTDLLSDLQPGDRFDDDVKYMFDY
Sbjct: 538  NLFMSPHGRKLCQGALYADVRSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDY 597

Query: 601  EYDDYNAIDPEQLYXXXXXXXXXXXXXXXXXXXKDMRGYYKRCHCVF---XXXXXXXXXX 657
            EYDDYNAIDPEQLY                   KDMRGYYKRCHCVF             
Sbjct: 598  EYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRGYYKRCHCVFDDDELLSDEEGTD 657

Query: 658  XGETASSNIDRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPR 717
             GE   ++I     S   LNL + + ++   GP  QK A+RSRD V+FDFNGKDWRDIPR
Sbjct: 658  TGEHTDNHITETVQS-APLNLVTGVSTS---GP--QKVAVRSRDYVEFDFNGKDWRDIPR 711

Query: 718  GLNFYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYD 777
            G+NFYY E YVFVNKLHADV++YLMKEAT+KK+E N +SFILRS+ATCIKLEQEK+MV+D
Sbjct: 712  GMNFYYVEDYVFVNKLHADVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVHD 771

Query: 778  VMNGRTDKGSSSNSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSG 837
             +    DK   S S S+  N LTSDFIYEKWCE++LF KMMYYNNDLVWRMMDEMLMCSG
Sbjct: 772  AIFKSKDKSPLSASGSEGSNGLTSDFIYEKWCEDALFEKMMYYNNDLVWRMMDEMLMCSG 831

Query: 838  YRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXX 897
            YRRVLIWFITHLE+SHS+IHYIFELVMGMRGNV Y +  E+ I NRN             
Sbjct: 832  YRRVLIWFITHLELSHSVIHYIFELVMGMRGNVAYKDLEEEYIINRNLDLLDSFSLGSSC 891

Query: 898  VTIKIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDD 957
            +   IPFSRQGPI+LS IE+NMLL EFFINA IYFS+ +++  S E L + Q E +   +
Sbjct: 892  IPASIPFSRQGPIVLSTIEVNMLLQEFFINAAIYFSNYLRDTASYEHLDVEQPEEQTEIE 951

Query: 958  LEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIG 1017
                  E  D + L  S HV+GLMKL+CFMVDML+EKKK DFTDSEY+FELQTLLMNWIG
Sbjct: 952  EGEAEDEIAD-ERLTASSHVLGLMKLLCFMVDMLIEKKKLDFTDSEYLFELQTLLMNWIG 1010

Query: 1018 IIPEARNLFFKLKSSILEAXXXXXXXXXXXXG--TENIRKKSSQSLVTEGEGIEQKIVNI 1075
            ++PEAR LFFKLKS++L +            G    N    S      E  G   K   +
Sbjct: 1011 LVPEARTLFFKLKSTLLNSSALNGSALSHLEGELASNDNDDSEPVDTAEDAGPMDKSNGL 1070

Query: 1076 DREDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNEN 1135
               D L  C   A     P    N       +P   + +N+S  N+MLI+LLP H  +EN
Sbjct: 1071 ---DGLPLCDIGALTNGQPTSAAN------SAPNGMSESNISYCNQMLIKLLPPHSADEN 1121

Query: 1136 TAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFGIDYNSVV 1195
             AVTALRSFI KH LT KTA+FGRRVIYQD+AIMGLYMADKE++QREFLAEFGIDYN+V 
Sbjct: 1122 AAVTALRSFIAKHPLTTKTAIFGRRVIYQDNAIMGLYMADKELQQREFLAEFGIDYNAVA 1181

Query: 1196 -NNEDEELST 1204
             NN D E+S+
Sbjct: 1182 NNNSDAEVSS 1191

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score = 1125 bits (2909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/1198 (51%), Positives = 781/1198 (65%), Gaps = 106/1198 (8%)

Query: 18   LTSIFRTYKPDIRSLVEFRLNVGDEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRI 77
            L+ + + Y PD R+L    +   +E  DA++ E ++++LF+T  G+S+L + YDL CGR+
Sbjct: 22   LSRLCKDYYPDQRNLT---IPHVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRV 78

Query: 78   KLTEYKQ--SLKVRSNHSYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRK 135
             L+ YKQ    +VRS   Y K   K W +   +L  F D  L+N+N  L+Y ++ +A  K
Sbjct: 79   DLSSYKQWQHSQVRSTDGY-KKLVKRWSTSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYK 137

Query: 136  LPLQFLLPEPLRPYLIDDEYNLLLDYMIQSRPMWEMLLTQGIPKFLPELVDEYNRSYEFN 195
            L L FLL +     ++D +YNLLLDY++ ++PM E +L   IP  L  LV +YN+  EFN
Sbjct: 138  LSLIFLLDKQNEFLILDPDYNLLLDYLLHAKPMIESILLGNIPGLLKALVYQYNKLPEFN 197

Query: 196  GYYVWYGNVTCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTK 255
            G + WY   T         T+E++ KFF  L DK T +KE++P+L    W    P S   
Sbjct: 198  GCHTWYTFRTHYH-----GTQEIFHKFFIALTDKFTASKEIMPELEG--WFVEGPVSRDS 250

Query: 256  QTXXXXXXXXXXXXXXXXXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRH 315
                                  D+W QQK +++EQV++F+LN DGTLE PNVF H K+RH
Sbjct: 251  GCIKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRH 310

Query: 316  EILYRVLGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLG-----ST 370
            + LY+VLGL D   PLLK+ F+T   L DP+TQPPP + HI+S+DL+  MFLG      T
Sbjct: 311  DALYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEIT 370

Query: 371  SNLIENMLISRGRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDK 430
            ++L++ +       W  H+C+N+QKI+ AT+ RLNC D   LN +NNSD+SV W  NL K
Sbjct: 371  ADLVQPL---NKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYK 427

Query: 431  WTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEI 490
            W P+GLNTQDLEL+YMVD+L+ Y +Y+LYS  P+QMNPFL   + LWKNLT V+L GLEI
Sbjct: 428  WLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEI 487

Query: 491  DRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRK 550
            DR EE++ETFNTP++VRA IRG +ALRSV+AT+IN H   K HDFKHEPINLFMSPHGRK
Sbjct: 488  DRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRK 547

Query: 551  LCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDP 610
            LC+GALYAD+RSHAA ML+LGI+L  +TDLLSDLQPGDRFD+DVKYMFDYE+DDYN +D 
Sbjct: 548  LCNGALYADLRSHAATMLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDT 607

Query: 611  EQLYXXXXXXXXXXXXXXXXXXXKDMRGYYKRCHCVFXXXXXXXXXXXGETASSNIDRPK 670
            E +                    K++RGYYKRCHCVF           G     + +  K
Sbjct: 608  ELM------ADDELEDIESRERIKEVRGYYKRCHCVFDDDSLVPENEDGGGEEGDQEDTK 661

Query: 671  Y----SHNSLNLPSS--MLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYT 724
                 SH     P    ++STT     S+  A+RSRD V+FDFNG+DWRDIPRGLNFYYT
Sbjct: 662  KHLQDSHEDQLPPQQNVVMSTT-----SKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYT 716

Query: 725  EHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTD 784
            + Y+FV KLHADVV+YLMKEAT KK+E NHASFILRSIATC+KLEQE+++V   + G  D
Sbjct: 717  DAYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRAL-GNQD 775

Query: 785  KGSSSNSNSDRV-NELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLI 843
               SSN+ + +  NELTSDFIYEKWCE+SLF KMMY+N+DLVWRMMDEMLMCSGYRRVLI
Sbjct: 776  GDKSSNATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLI 835

Query: 844  WFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIP 903
            WFITHLEI+HS+IHYIFELVMG+RGN+ Y+++ E   K++N               + +P
Sbjct: 836  WFITHLEINHSVIHYIFELVMGLRGNITYEDDEE---KSKNLDALDGLAQGSSTSELTLP 892

Query: 904  FSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLC 963
            FSRQGPIILS IE+NMLL EFF NA I+FS  ++            SENE  D+      
Sbjct: 893  FSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRE--------SFDSENEELDE------ 938

Query: 964  EDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEAR 1023
               D+D   V PHVIGLMKLVCFMVD LM+KKKFDFTDSEYIFELQTLLMNWIGI+PEAR
Sbjct: 939  NFEDEDEFSVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEAR 998

Query: 1024 NLFFKLKSSILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLEN 1083
            +LFFKLKS I+                      +SQ    +G  ++            E+
Sbjct: 999  DLFFKLKSQIV---------------------ATSQDTQEQGTPVK------------ES 1025

Query: 1084 CLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNENTAVTALRS 1143
               D D P T                ++ N+ +S++NK L+ L+P    NE  A+TALR 
Sbjct: 1026 EKDDIDAPDT----------------LEMNDTMSEHNKKLMMLIPPGTTNERNALTALRG 1069

Query: 1144 FITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFGIDYNSVVNNEDEE 1201
            FI K+SLTNKTAVFGR++IYQD  IMG+YM DKEM  REFLAEFGIDYN +V    EE
Sbjct: 1070 FIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYNDIVEGVYEE 1127

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1160 (46%), Positives = 709/1160 (61%), Gaps = 118/1160 (10%)

Query: 50   EKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYK---QSLKVRSNHSYWKSCYKDWGSRR 106
            EK+V+ LF TR G S L + Y+L CGR+ L  YK   QS   R + + +K   K W S  
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVKRWTSST 110

Query: 107  DILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRPYLIDDEYNLLLDYMIQSR 166
            + +   +D  LRN+N ALDY  + S   KL + FLL       +IDDEYNLLLD+ +Q R
Sbjct: 111  EHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEVLVIDDEYNLLLDFALQCR 170

Query: 167  PMWEMLLTQ-GIPKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFFYT 225
             + E LL Q  +P  L +    + R ++  G YVWY   T S  Q   +    Y K+   
Sbjct: 171  ALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWY---TFSAEQFDEAQDICY-KYLSV 226

Query: 226  LFDKLTVTKELLPKLN--VALWSHSWPASYTKQTXXXXXXXXXXXXXXXXXSENDHWPQQ 283
            L DKLT  ++L+P++     + S S  + +                     S++DHWPQ+
Sbjct: 227  LTDKLTAQQDLIPQIQPLFEIISSSKASHWV-----YGDGLFTENPESDSNSDSDHWPQK 281

Query: 284  KLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAE-GPLLKAQFMTLAAL 342
            +LS++E+V++FDL  DGTLE  NVF   ++RH+ LY+VL L      PLL +QF TL AL
Sbjct: 282  RLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFTLCAL 341

Query: 343  VDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATMK 402
            VDP+TQP P + HI+SIDL+  MFLG   + I  + I    DWRFHVC+N+QKIV AT+ 
Sbjct: 342  VDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINELHI----DWRFHVCFNLQKIVQATLP 397

Query: 403  RLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYL 462
            RLNCHD   LN+VNNSD+S+ W  NL KW P+GLNTQDLEL+YM+D+L+IY +++LY  L
Sbjct: 398  RLNCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAIYIIHKLYRDL 457

Query: 463  PVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVAT 522
            P QMNPFL   + LWKNLT V+L GLEIDRFEE++ETF+TP++VRAAIRG++ALRSVVAT
Sbjct: 458  PAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVAT 517

Query: 523  MINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLS 582
            ++N H   K HDF+HEPIN+FMSPHGRKLCHGALY DVRSHAAAML+LGI+L DVT+LLS
Sbjct: 518  ILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLS 577

Query: 583  DLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXXXXXXXXXXXXXXXXKDMRGYYKR 642
            DLQPGDRFD+DVKYMFDYEYD+YN +                         K+MR YYKR
Sbjct: 578  DLQPGDRFDEDVKYMFDYEYDNYNEV------DTEELDEDELEDVESRERIKEMRAYYKR 631

Query: 643  CHCVF---XXXXXXXXXXXGETASSNIDRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRS 699
            CHC F               + +   + R     N++ L ++          S+  A+RS
Sbjct: 632  CHCQFDDDELLPEDEEDGRPDASPYRVTRDAPPDNNVKLSNT----------SKPMALRS 681

Query: 700  -RDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFI 758
             +D V+FDFNG+DWR IPRGLNFY+ E+Y F   L +   + LM  A  KK+     + +
Sbjct: 682  QKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLEEGTQL 741

Query: 759  LRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNSNSDRVNELTSDFIYEKWCEESLFTKMM 818
            LR IATC+  EQE +++   +       S ++S      +LT+DF+YEKWCE S+F K++
Sbjct: 742  LRVIATCVAKEQELTVLRSALLLGETPESENHSTLVADGDLTTDFVYEKWCENSMFEKIL 801

Query: 819  YYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAED 878
            ++N  LVWRMMDEMLMCSGYRRVLIWFITHLE+S+S+I YI+ LV+G RG     E+A  
Sbjct: 802  FHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRG-----EKAAS 856

Query: 879  DIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMK- 937
            D                     K+PFSRQG I+LS IEI MLL EFF NA I+FS  ++ 
Sbjct: 857  DGD-----------------YAKVPFSRQGAIVLSDIEIKMLLQEFFTNAAIFFSKQLRE 899

Query: 938  NLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKF 997
            +L   E+      + +GS                G+SPHV+GLMKLVC+MV  LM+K+ F
Sbjct: 900  SLGDGEDDEDQGDDEKGS----------------GISPHVVGLMKLVCYMVKSLMQKEMF 943

Query: 998  DFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEAXXXXXXXXXXXXGTENIRKKS 1057
            DF D +YIFELQTLLM+WI I+PEAR+LFF L+S + E                      
Sbjct: 944  DFKDPDYIFELQTLLMSWICILPEARDLFFALRSLVDE---------------------Q 982

Query: 1058 SQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLS 1117
            SQ++  E E I               C  D+   P      + +LE    PE    + +S
Sbjct: 983  SQNIKLESESIASA------------CEPDSQSEPQLPQGTHAELE----PEA--THAVS 1024

Query: 1118 KYNKMLIELLPLHVDNENTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKE 1177
             YNK L+ LLP     EN+A+TALRSFI+KHSLT KTA+FGRRVI QD  IM +YM+D+E
Sbjct: 1025 IYNKKLMSLLPPAAGTENSAITALRSFISKHSLTTKTALFGRRVISQDDTIMPMYMSDRE 1084

Query: 1178 MRQREFLAEFGIDYNSVVNN 1197
            M  R+FLAEFGIDYN  V+ 
Sbjct: 1085 MDNRQFLAEFGIDYNDFVDG 1104

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/1160 (46%), Positives = 718/1160 (61%), Gaps = 117/1160 (10%)

Query: 48   ITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYK--QSLKVRS-NHSYWKSCYKDWGS 104
            I EK+V+ LF T+ G S+L + Y+L CGRI L  YK  Q  K +S   + +K   K W  
Sbjct: 46   IQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTG 105

Query: 105  RRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRPYLIDDEYNLLLDYMIQ 164
              D +S  +++ LRN++ +LDY+ + SA  KL + FLL +     +IDDEYNLLLD+++Q
Sbjct: 106  SSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFLLQ 165

Query: 165  SRPMWEMLLTQG-IPKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFF 223
            +R   E LL+Q  +P  + +    ++R ++ +G YVWY   T S  +  +  +++  K+ 
Sbjct: 166  TRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWY---TFSDERF-AEAQDICYKYL 221

Query: 224  YTLFDKLTVTKELLPKLNVALWS-HSWPASYTKQTXXXXXXXXXXXXXXXXXSENDHWPQ 282
              L DKLT  ++L+P++     S +S   ++  Q                  S++DHWPQ
Sbjct: 222  SVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSN----SDSDHWPQ 277

Query: 283  QKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDA-EGPLLKAQFMTLAA 341
            +KLS+ E++++FDL  DGTLE PNVF   ++RH+ LY+VL L      P LKAQF TL A
Sbjct: 278  KKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCA 337

Query: 342  LVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATM 401
            LVDP+TQP P + HIISIDL+  MF+G   + I+ +      +WRFH+C+N+QKI+ +T+
Sbjct: 338  LVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLPF----NWRFHICFNLQKILQSTL 393

Query: 402  KRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSY 461
             RLNCHD   LN+VNNSD+S+ W  NL KW P+GLNTQDLEL+YM+D+L+IY +++LY  
Sbjct: 394  PRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRD 453

Query: 462  LPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVA 521
             PVQMNPFL   + LWKNLT V+L GLEIDRFEE++ETF+TP++VRAAIRG++ALRSVVA
Sbjct: 454  RPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVA 513

Query: 522  TMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLL 581
            T++N H   K HDF+HEPIN+FMSPHGRKLCHGALY DVRSHAAAML+LGI+L DVT+LL
Sbjct: 514  TVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLL 573

Query: 582  SDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXXXXXXXXXXXXXXXXKDMRGYYK 641
            SDLQPGDRFD+DVKYMFDYEYD+YN +                         K+MR YYK
Sbjct: 574  SDLQPGDRFDEDVKYMFDYEYDNYNEVG------TEDMDEEELEDVESRERIKEMRAYYK 627

Query: 642  RCHCVFXXXXXXXXXXXGETASSNIDRPKYSHNSLN--LPSSMLSTTFNGPNSQK-FAIR 698
            RCHC F            E   S I     SH  ++  LP     T     N+ K  A+R
Sbjct: 628  RCHCQFDDDELLPE----EEEESGI---PISHTRISKELPP---DTNVKLSNTAKPVALR 677

Query: 699  S-RDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASF 757
            + +D ++FDFNG+DWRDIPRGLNFY+ E+Y F   +     + LM  A  +++    A  
Sbjct: 678  NKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVH 737

Query: 758  ILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNSNSDRVNELTSDFIYEKWCEESLFTKM 817
            +LR ++TC+  EQE +++         +  S  S      +LT+D+IYE WC++SLF KM
Sbjct: 738  LLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKM 797

Query: 818  MYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAE 877
            +++N  LVWR+MDEMLMCSGYRRVLIWFITHLE++ S+I YI+ LVMG RG    +EE  
Sbjct: 798  LFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKLANEETP 857

Query: 878  DDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMK 937
                                   K+PFSRQG I+LS IEI MLL EFF NA I+FS  ++
Sbjct: 858  FG---------------------KLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLR 896

Query: 938  NLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKF 997
                                   G  E+ + + LG+SP+++GLM+LVCFMV  L++++ F
Sbjct: 897  E--------------------SLGDEEEEETENLGISPYIVGLMRLVCFMVKSLIQEEMF 936

Query: 998  DFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEAXXXXXXXXXXXXGTENIRKKS 1057
            DF D +YIFEL+TLLM+WI I+PEAR+LFF L+S + +              +    K+ 
Sbjct: 937  DFKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQ-------------SRKPAKRD 983

Query: 1058 SQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLS 1117
              ++ T        +VN+             DF  T         EN GS + +  N++S
Sbjct: 984  PDAMATAS------VVNL-----------SPDFRTTD--------ENDGSSDSEETNSVS 1018

Query: 1118 KYNKMLIELLPLHVDNENTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKE 1177
             YNK LI LLP  V  ENTAVTALRSFI+KHSLT  TAVFGRRVI  D  IM +YM+DK+
Sbjct: 1019 IYNKKLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKD 1078

Query: 1178 MRQREFLAEFGIDYNSVVNN 1197
            +  R FLAEFGIDYN  V+ 
Sbjct: 1079 IDNRNFLAEFGIDYNDFVDG 1098

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1166 (39%), Positives = 653/1166 (56%), Gaps = 106/1166 (9%)

Query: 46   ALITEKVVVTLFMTRSGNSMLHML----YDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKD 101
            +L+ E V+V L  TR+G S+L +L     +    +    + K   +V             
Sbjct: 86   SLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQ 145

Query: 102  WGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRP--YLIDDEYNLLL 159
            W S  DI  +FL F L+NE+  L          K+PL FL+    R    ++D  YNLL+
Sbjct: 146  WQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLLV 205

Query: 160  DYMIQSRPMWEMLLTQGIP----KFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSST 215
            DY +   P+ E  L + I       L   V  YNR Y+F+GY+ WY       +Q + S 
Sbjct: 206  DYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWY------TLQTRGSN 259

Query: 216  KELYTK-FFYTLFDKLTVTKELLP---------KLNVALWSHSWPASYTKQTXXXXXXXX 265
                ++   + L D      E +          ++ +     S     +  +        
Sbjct: 260  HPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQIRSAIQDISSASLNSGFYGD 319

Query: 266  XXXXXXXXXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLP 325
                     S+N H    +++  EQVF+FDLN+DG+LE PN+  HA  RHEIL +VL L 
Sbjct: 320  EDRSALEEYSDNYH---HQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVLKLN 376

Query: 326  DAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENML-ISRGRD 384
            ++  PLL+ QF  +A LVDP+TQP P + H+IS+DL++QMFLG  +  I+  L    G D
Sbjct: 377  NSSSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCD 436

Query: 385  WRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELL 444
            WRFHVC+NMQKI+ A++ RLN  D + LN++NNSD++V W   LDKW P G NTQDLEL+
Sbjct: 437  WRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELI 496

Query: 445  YMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPI 504
             MVD++++Y +Y+LY +LP+Q+NPFL   + LWKNLT V+L GLEIDR EE+ ETF+TP+
Sbjct: 497  CMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPL 556

Query: 505  IVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHA 564
            +VRA IRG AALR++VAT++N H  + +HD KHE +N FMSPHGRKLC GALYA++RSHA
Sbjct: 557  MVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYAELRSHA 616

Query: 565  AAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDP-EQLYXXXXXXXXX 623
            AA+L+LG +L DVT L SDLQPGDRFD+DV+YMF+YE++DYN +   E+ Y         
Sbjct: 617  AALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDY 676

Query: 624  XXXXXXXXXXKDMRGYYKRCHCVFXXXXXXXXXXXGETASSNIDRPKYSHNSLNLPSSML 683
                         +G+ +RC+C+F                 +   PK      N  +S+ 
Sbjct: 677  TDSSKTHAR----KGFGRRCNCIFDDDEMLEDEDYENEYEGH-KAPKQILPQQNPTTSVS 731

Query: 684  STTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMK 743
             +T   P+    AIRS    +FD++GKDWRDIPR  N YY+ +Y FV  L  + +  L  
Sbjct: 732  MSTTGKPH----AIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTN 787

Query: 744  EATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNSNSDRVNELTSDF 803
            +AT + +    +  +L S+ATC+K EQ++ ++ ++       GS  +   D++ +++ D 
Sbjct: 788  KATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDD 847

Query: 804  IYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELV 863
            IYE WC++S F KM+Y N+++ WR+MDEMLMCSG+RRVLIWFITH+E++HSLIHYIFELV
Sbjct: 848  IYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELV 907

Query: 864  MGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPIILSIIEINMLLLE 923
            MG+R +  +DE  E+D  + +             V   +PFSRQG I LS IE  MLL E
Sbjct: 908  MGLRKS--FDENNENDNGDES---ISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQE 962

Query: 924  FFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMKL 983
            FF NA I+ ++  K    +E +    + N+G         E+G+     VS + +GLMKL
Sbjct: 963  FFTNAAIFLTEKSKEWIGEEPMEDEATINDG---------ENGN-----VSLYAVGLMKL 1008

Query: 984  VCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEAXXXXXXX 1043
            +C MV   ++K KFDF +SE +FELQTLLMNWI IIPEA++LFF+LK+ + E        
Sbjct: 1009 ICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVH------ 1062

Query: 1044 XXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINNLKLE 1103
                                                   + + D +    P D N     
Sbjct: 1063 --------------------------------------SDPMDDEELSNNPPDSNKKLSS 1084

Query: 1104 NVGSPEIDNNNNL-SKYNKMLIELLP--LHVDNENTAVTALRSFITKHSLTNKTAVFGRR 1160
             V +  I+ N  + S+YN+ LI LL   +H   EN AV ALR+FI K+S      + GR+
Sbjct: 1085 MVENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRK 1144

Query: 1161 VIYQDHAIMGLYMADKEMRQREFLAE 1186
            V+Y+ + I+ L  ++  M   ++L +
Sbjct: 1145 VVYEGNEILPLPESETPMSLLDYLVD 1170

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1193 (37%), Positives = 638/1193 (53%), Gaps = 148/1193 (12%)

Query: 23   RTYKPDIRSLV-----EFRLNVGDEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRI 77
            R Y P + +L      E  LN  +  F  L+ E + VTLF T+SG S+L  +        
Sbjct: 43   RHYTPSVENLEKLLYDETILNDQEIRF-PLLFEALSVTLFTTKSGKSILQTMKASTSKER 101

Query: 78   KLTEYKQSLKVRSNH-SYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKL 136
            K  E     K   NH S + S  + W     +L +FL F L N+   L    Y     KL
Sbjct: 102  KAWE-----KSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKL 156

Query: 137  PLQFLLPEP--LRPYLIDDEYNLLLDYM--IQSRP---MWEMLLTQGIPKFLPELVDEYN 189
            PL FL+     L   ++++ YN+L DY+  I  R    +W         +     + +Y+
Sbjct: 157  PLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYD 216

Query: 190  RSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSW 249
            R  EF  +Y WY                             +  K   PKLN  +  +  
Sbjct: 217  RMIEFRNFYFWYS---------------------------FSAEKNATPKLNHNI--NLL 247

Query: 250  PASYTKQTXXXXXXXXXXXXXXXXXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFL 309
              SY                        D    + ++ +EQ+++F+LN+DGTL+ PNV  
Sbjct: 248  MDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVME 307

Query: 310  HAKKRHEILYRVLGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGS 369
            H+  RHE+L+++L L     PLL+ QF TL  LVDP+TQP P + HIISID ++Q+FLG 
Sbjct: 308  HSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGL 367

Query: 370  TSNLIENMLISRGR-DWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNL 428
                I+         DW+F++C+NMQKI+ ATM RLNC   + LN++NN+D++VHW   L
Sbjct: 368  MYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRTQL 427

Query: 429  DKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGL 488
              W P GLNTQDLELLYM+D+L++Y +Y+LY  +P+Q+NPFL   L LWKNL+ V+L  L
Sbjct: 428  HIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLAL 487

Query: 489  EIDRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHG 548
            EIDR EE++ T+ TP++VRA IRG AALRSV+A ++N    S +HDFKHE +N FMSP+G
Sbjct: 488  EIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYG 547

Query: 549  RKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAI 608
            RKLCHGALYAD+RSH A++L+LG  + DVTDL +DLQ GDRFD+D++YMFDYE +DYN  
Sbjct: 548  RKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYN-- 605

Query: 609  DPEQLYXXXXXXXXXXXXXXXXXXXKDMRGYY-KRCHCVFXXXXXXXXXXXGETASSNID 667
              E                          G+Y +RC+C+F           G  AS+N D
Sbjct: 606  --ESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIF--NDDKLVAEDGANASTNND 661

Query: 668  RPKYSHNS-LNLPSSMLSTTFNGPNSQ--KFAIRSRDGVDFDFNGKDWRDIPRGLNFYYT 724
              K    S  N  S+   T  N   S    +++RSR   +FD++G+DWRD+P+  N YY+
Sbjct: 662  SIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYS 721

Query: 725  EHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTD 784
              Y F+ +   D+++ L     T+K+    +  ++RS+A+C+K EQ++ ++ D+ +  T 
Sbjct: 722  PSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTS 781

Query: 785  KG----------SSSNSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLM 834
             G          +S  +N + +   T D IYE W EES F +M+Y N+D+ WR+MDEMLM
Sbjct: 782  IGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLM 841

Query: 835  CSGYRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXX 894
            C+GYRR+LIWF+THLE+ HSLI+Y+FEL+MG+RGN  +  EA D  +  +          
Sbjct: 842  CTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGN-PFSGEASDQDRKDDMIYEILKKKQ 900

Query: 895  XXXVTIKIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEG 954
                T  +PFSRQGPI+LS IE  MLL EFF+NA I+ S                +E EG
Sbjct: 901  KNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSS-------------KNTEEEG 947

Query: 955  SDDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMN 1014
                     ED DK    VS + +GL+KL+C+MV  L+   KF FT SE  FELQTLLM 
Sbjct: 948  ---------EDADK----VSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMT 994

Query: 1015 WIGIIPEARNLFFKLKSSILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVN 1074
            WIGI+PEA++LFF++KS                             L  E +GI    V 
Sbjct: 995  WIGILPEAKDLFFQIKS----------------------------RLAMEEDGITDNTVQ 1026

Query: 1075 IDREDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHV--D 1132
                                 D  +L L++   P   N  ++SK N  ++ L P +   +
Sbjct: 1027 HK-------------------DKTDLDLDSGKKP---NTKSISKLNMKILSLFPSNPTEN 1064

Query: 1133 NENTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLA 1185
            ++N+A++ LRSFIT +S   +    GRRV++ D  I+ L  ADK +   E++ 
Sbjct: 1065 DDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYIT 1117

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1176 (38%), Positives = 655/1176 (55%), Gaps = 157/1176 (13%)

Query: 31   SLVEFRLNVGDEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRS 90
            +L E ++   D+   +LI E +++ LF TR+G S+L +           +E  +  +V  
Sbjct: 33   ALREEKVLKNDQWRPSLICETLIIALFTTRAGISLLPLF----------SESAKRKRVGP 82

Query: 91   NHSYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPL--RP 148
                      +W +  +++  F  + L N +  ++   +  A  KLPL FL+        
Sbjct: 83   R-------VLEWHNDEELMLRFFSYILENRSSRIEPRLFEKARWKLPLFFLIESKFLAAS 135

Query: 149  YLIDDEYNLLLDYMIQSRPM---W-EMLLTQGIPKFLPELVDEYNRSYEFNGYYVWYGNV 204
             ++D  YNLLLDY+    PM   W     TQG   F  + V  YNR YE      WY   
Sbjct: 136  MVLDQNYNLLLDYVHTITPMIKRWVHRAFTQGT--FFKDTVVCYNRVYELKDSSEWYSFG 193

Query: 205  TCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTXXXXXXX 264
            T    + + + ++   +    + D  T  + + P    A+   +  ASY           
Sbjct: 194  TKKSNEERRAIQQFLRENSEQVLD--TYHEMVRPSNERAI---NDTASY----------- 237

Query: 265  XXXXXXXXXXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGL 324
                               ++S  E V++FD+N+DG+LE PN+  HA  RH+IL  ++ L
Sbjct: 238  -----------------HHRISQHENVYSFDINQDGSLEIPNIMSHASVRHDILQNLMRL 280

Query: 325  PDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRD 384
            P  + PLL+ QF  +A LVDP+TQPPP + HIIS+DL++QM LG     I N L S G D
Sbjct: 281  PLCDSPLLQWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQMLLGLMEPAISNTLGSDGCD 340

Query: 385  WRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELL 444
            W+FH+C+NMQKI+ A++KRLN  D D LN++NNSDE V W  NL  W P GLNTQ+LEL+
Sbjct: 341  WKFHLCFNMQKIIQASLKRLNLQDFDTLNSINNSDEDVSWRDNLHSWLPHGLNTQNLELI 400

Query: 445  YMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPI 504
            YM+D+L++Y +Y+LY  LPVQ+NPFL   + LWKNLT V+L GLEIDRFEE+ ETF TP+
Sbjct: 401  YMIDILAVYTIYKLYEDLPVQLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFETPV 460

Query: 505  IVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHA 564
            +VRA IRG AALR+VVAT++N H  + +HDF HEP+N FMSPHGRKLC GALYAD+RSHA
Sbjct: 461  LVRATIRGAAALRAVVATILNGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLRSHA 520

Query: 565  AAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXXXXXXX 624
            AA+L+LG +L DVT+LL+DLQ GDRFD+DV+YMF+YE D+YN  D E             
Sbjct: 521  AALLALGTELEDVTNLLADLQAGDRFDEDVRYMFEYECDNYNEGDSES------------ 568

Query: 625  XXXXXXXXXKDMRGYYKRCHCV-FXXXXXXXXXXXGETA----SSNIDRPKYSHNSLNLP 679
                     +  +   +RC+C+             GE      S ++   + +  SL++ 
Sbjct: 569  -EKDGKLAVEQPKILQRRCNCIFDDDEMAEDEDFDGENDEAFFSKHLILQQNAQTSLSMS 627

Query: 680  SSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVY 739
            SS           +  A+RS    +FD++GKDWRDIPRG NFYY+  + F+       + 
Sbjct: 628  SS----------GKPRAVRSGGAFEFDYSGKDWRDIPRGSNFYYSPDFEFIESPSLSSLL 677

Query: 740  YLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNSNSDRVNEL 799
             L K+A+++K+    +  +LRS+A+C+K EQ++  + ++++   D  S ++  S   +++
Sbjct: 678  ALTKKASSEKLVEKESLTLLRSVASCVKNEQDEITLGNLIDPHQD--SQADEESRNADKI 735

Query: 800  TSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYI 859
              D IYE WCE S F K++Y+N+ L W++MDEML+C GYRRVLIWFITH+E++HSLIHYI
Sbjct: 736  EPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLIHYI 795

Query: 860  FELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPIILSIIEINM 919
            FELVMG+RGN D     E+D ++ +               + + FSRQG + LS IE  M
Sbjct: 796  FELVMGLRGNSD-----END-RDVDLAGPPLQDVDKVKGELSVGFSRQGALQLSTIETKM 849

Query: 920  LLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIG 979
            LL EFF NA I+ S       S+E   ++  E    +        D + ++  VS + +G
Sbjct: 850  LLQEFFTNAAIFISK-----KSEESTDIANEEQNNEN-------RDLNGNSENVSLYAMG 897

Query: 980  LMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEAXXX 1039
            LMKL+CFMV   + K+KFDF++SE +FELQ LLMNWIGIIPEA+ LFF+LKS I      
Sbjct: 898  LMKLICFMVRTFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGF--- 954

Query: 1040 XXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINN 1099
                             S+ + V E +  E K  N  +ED              P + + 
Sbjct: 955  -----------------STATSVQEQKNAEVK--NDTQED-------------VPKEQSP 982

Query: 1100 LKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDN--ENTAVTALRSFITKHSLTNKTAVF 1157
            +++ N    E         +N+ L+ LLP  V N  EN A+  LRSFI   S  N   V 
Sbjct: 983  VRVSNTAGFE---------FNRKLMTLLPPLVKNKEENAAMQTLRSFIKTSSFLNTVPVI 1033

Query: 1158 GRRVIYQDHAIMGLYMADKEMRQREFLAEFGIDYNS 1193
            GR+++Y+D  I+ L  +D  +   E+     IDY+ 
Sbjct: 1034 GRKIVYEDDKILPLPKSDVPLALHEY-----IDYDG 1064

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1193 (37%), Positives = 628/1193 (52%), Gaps = 179/1193 (15%)

Query: 46   ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTE--YKQSLKV----RSNHSYWKSCY 99
            +L+ E V++    TRSG  +   L++    +    E  YK+ L      ++ H Y +   
Sbjct: 70   SLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLR--- 126

Query: 100  KDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPE--PLRP-YLIDDEYN 156
            K W S +    +F  F L N +  ++  +Y     KLPL FL  +   L P +++D++YN
Sbjct: 127  KKWSSNKLYFLKFTKFLLVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYN 186

Query: 157  LLLDYMIQSRPMWEML----LTQGIPKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQ 212
            LL DY+    P+ + +    L  GI   LP +   Y    +    Y WY           
Sbjct: 187  LLQDYIYACGPLLKCVMKDTLENGICLDLPGI---YKLDIDLQFPYPWY----------- 232

Query: 213  SSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTXXXXXXXXXXXXXXX 272
                                  +LLP +      H    + TKQ                
Sbjct: 233  ----------------------DLLPPM------HEGHLNATKQNNNSNNIPLTMQPSIK 264

Query: 273  XXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAE-GPL 331
              +   +   Q +      ++FDLN D T E  NV  H  KRH +L +++   D +  PL
Sbjct: 265  TNNNGANNNNQTV------YSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPL 318

Query: 332  LKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGST-SNLIENMLISRGRDWRFHVC 390
            L  QF  +A LVDP++QPPP    +IS+ L++ MF+G    NL E    + G +W+FH+C
Sbjct: 319  LTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHIC 378

Query: 391  YNMQKIVLATMKRLNCHDGDVL------------NTVNNSDESVHWNVNLDKWTPRGLNT 438
            +NM K++  +M  L C + + L             T N+ D++  W + L++W P G+NT
Sbjct: 379  FNMVKLINNSMVILKCDNFNKLNDIINSNNDNDEGTENDDDDA--WKLKLNEWIPHGINT 436

Query: 439  QDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRE 498
            QDLEL+YM++++++Y +Y+LYS LP+QMNPFL   + LWKNL+ ++L GL+IDR EE R+
Sbjct: 437  QDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARK 496

Query: 499  TFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYA 558
            TF+TP++VRA IRG A+LR+VVAT++N+H    EHDFKHEP+N FMSPHGRKLC GALYA
Sbjct: 497  TFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYA 556

Query: 559  DVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXX 618
            D+RSHAAA+L+LG +L DVTDLL+DLQ GDRFD+D++YMFDYEYDDYN    +       
Sbjct: 557  DIRSHAAAILALGAELEDVTDLLTDLQAGDRFDEDIRYMFDYEYDDYNDFKDD------- 609

Query: 619  XXXXXXXXXXXXXXXKDMRGYYKRCHCVFXXXXXXXXXXXGETASSNI------------ 666
                           + M  + +RC+C+F               +               
Sbjct: 610  --------VEEQEEMEIMGSFPRRCNCIFEDDNIINDDTDNINENDEDDDDEQEEYVDAI 661

Query: 667  -----DRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNF 721
                 D P   HN+LN P   + T  + PNS+    RS+   +FD+ GKDWRDIPRG N 
Sbjct: 662  EGVTKDTP---HNNLN-PHDAIRTRNSHPNSK----RSKSSFEFDYGGKDWRDIPRGFNL 713

Query: 722  YYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNG 781
            YY+  Y F+     + +  L  +AT +K+    ++ ++ ++A+CIKLEQ+K +  +++  
Sbjct: 714  YYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKH 773

Query: 782  RTDKGSSSNSNSDRVN--ELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYR 839
             T K   +  N D  +    T D IY+ W EES F +M+Y N D+ WR+MDEMLMC+GYR
Sbjct: 774  NTVKHPHAAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYR 833

Query: 840  RVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVT 899
            RVLIWFITH+E++HSLI YIFELVMG+RG+    E  E D KN               + 
Sbjct: 834  RVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIV 893

Query: 900  IK---IPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSD 956
                 +PFSRQGP+ILS IE  MLL EFF NA IYFS              S+S NEG+ 
Sbjct: 894  TSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFS--------------SKSNNEGTT 939

Query: 957  DLEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWI 1016
            + + G  E  D++ +  S +  GL+KL+CFMV  LME  KFDF  SE  FELQTLLMNWI
Sbjct: 940  NNDNG--EGIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWI 997

Query: 1017 GIIPEARNLFFKLKSSILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNID 1076
            GIIPEA +LFF LKS +  +             T       + S   +G+     I   D
Sbjct: 998  GIIPEAEDLFFTLKSGVSSSSTKTGRESDDHDNTH----ADNLSFSDDGDTGHPGISRFD 1053

Query: 1077 REDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVD--NE 1134
             +D           PP                      N S +NK L+ LLP  ++  +E
Sbjct: 1054 TDDS----------PP----------------------NESIFNKRLVSLLPKRINDKDE 1081

Query: 1135 NTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEF 1187
            N AV+ LR FI ++S   +  V+GR+V+Y D  ++ L  AD+ +   E+L E 
Sbjct: 1082 NAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTEL 1134

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1008 (41%), Positives = 584/1008 (57%), Gaps = 107/1008 (10%)

Query: 39   VGDEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRS---NHSYW 95
            +G  +  +++ E +V++LF T+SG+S+L +L +          Y   L+  S   N+ Y 
Sbjct: 44   LGQNNEPSVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYL 103

Query: 96   KSCYKDWGSRRDI-LSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEP---LRPYLI 151
            K  ++ W S R+  LS+F  F L+NE        Y     KL LQ L+      +   L 
Sbjct: 104  K--HELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILN 161

Query: 152  DDEYNLLLDYMIQSRPMWEMLLTQGIP--KFLPELVDEYNRSYEFNGYYVWYGNVTCSQV 209
             D YNLLLD+++  +P    L++  +   KF  E++ +YNR YE NG++ WY     S  
Sbjct: 162  SDNYNLLLDFIMFFQPYMNDLISYIVEGNKFF-EIIAKYNRIYELNGFHTWYTLTIASNT 220

Query: 210  QVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTXXXXXXXXXXXX 269
             +              L D L++     P +     S+    ++ +              
Sbjct: 221  SIAVRY----------LNDVLSID----PMITDQFTSNYRDKAFQES------------- 253

Query: 270  XXXXXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEG 329
                  E     QQ+ +  + +F+FDLN  G L  PN+  H++ RH+I+Y +L L   + 
Sbjct: 254  -----EETLLMSQQQTAKDDIIFSFDLNETGDL--PNLIKHSEMRHQIIYDILNLNQIDS 306

Query: 330  PLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWR-FH 388
            P LK QF+ +  LVDP+TQP P  +HIISIDLI+Q+F+G       N L  + ++ + F 
Sbjct: 307  PFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFT 366

Query: 389  VCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVD 448
            +C+NMQKI+  ++  LNC+D D L+T+ N D    +   L+KW P G+NTQDLEL+YM++
Sbjct: 367  ICFNMQKIISRSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELIYMIN 425

Query: 449  MLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRA 508
            +++IY +Y+LYS LP+Q+NPFL   + LWK L++++L GLEIDR EE  ET++TPIIVRA
Sbjct: 426  IIAIYTIYKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRA 485

Query: 509  AIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAML 568
             IRG AALR+V+AT++NDH S+KEHDFKHE  N FMSPHGRKLC GAL AD+RSHAAA+L
Sbjct: 486  TIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAIL 545

Query: 569  SLG-IDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXXXXXXXXXX 627
            +LG  +L+DVT+LL+DLQ GDRFD+DVKY+F+YEY DYN +  E                
Sbjct: 546  ALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNELGEED----------EQTNE 595

Query: 628  XXXXXXKDMRGYYKRCHCVFXXXXXXXXXXXGETASSNIDRPKYSHNSLNLPSSMLSTTF 687
                  + ++   +RC+C+F            E  + +          +NL S       
Sbjct: 596  LEELEKRSVKK--RRCNCIFEDDKMLEDYEYYEVGNES------RREDMNLES------- 640

Query: 688  NGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATT 747
            +   +  +++R     +FD++GKDWRD+PRG N YY+  Y F+       V +   +ATT
Sbjct: 641  DKSRTNPYSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATT 700

Query: 748  KKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNSNSDRVNELTSDFIYEK 807
            +K+    +  +L+S+A+C+KLEQEK ++ +  N    K  S+  + DR  E+T D +YE 
Sbjct: 701  EKLSDEDSLLLLQSVASCVKLEQEKMILENYSNT---KNCSTEEDLDR--EVTPDDVYEI 755

Query: 808  WCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELVMGMR 867
            WCEES F +M+Y N ++ WR+MDEMLMC+GYRRVL+WFITH+EI+HSL+HYIFELVMG+R
Sbjct: 756  WCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLR 815

Query: 868  GNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPIILSIIEINMLLLEFFIN 927
            G  D      DD   R               + K+PFSRQG IILS IE  MLL EFF N
Sbjct: 816  GQRDDSRNPGDD---RLKSLLLQDMMTDKKGSEKVPFSRQGSIILSEIETKMLLQEFFTN 872

Query: 928  ATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFM 987
            A I+FS N              + N  S+D E             VS + IGL+KL+CFM
Sbjct: 873  AAIFFSTN-------------DTANMSSNDSE------------NVSLYAIGLVKLICFM 907

Query: 988  VDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILE 1035
            V  LM   KFDF+ SE  FELQTLLMNWIGIIPEA+ LFF LK+++ E
Sbjct: 908  VKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVGE 955

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 51/95 (53%), Gaps = 12/95 (12%)

Query: 1104 NVGSPEID----------NNNNLSKYNKMLIELLPLHVDN--ENTAVTALRSFITKHSLT 1151
            NVG P ++          N   LS YN  L+ LLP   ++  EN A+  LRSF+ K+S T
Sbjct: 952  NVGEPSMEGKSDSDGTDSNEGELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFT 1011

Query: 1152 NKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAE 1186
            NK  V GR+VIY+D  I+ +    + +  RE + E
Sbjct: 1012 NKVPVVGRKVIYKDDKILPIPKLYQPILLRELIDE 1046

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1180 (36%), Positives = 637/1180 (53%), Gaps = 164/1180 (13%)

Query: 46   ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSR 105
            +++ E + + LF T+SG S+L  +        KL  + QSL  R + S + S  + W   
Sbjct: 68   SILFEALSIILFTTKSGKSILQAVQASTLKEKKL--WAQSL--RDDDSNYASVVQGWKDN 123

Query: 106  RDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLR-PYLIDDE-YNLLLDYMI 163
              +  +FL F L N+  +L   +Y     KLPL FL+   +  P +I +E +N+L DY+ 
Sbjct: 124  DVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKDYLY 183

Query: 164  QSRPMWEMLL-----TQGIPKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQSSTKEL 218
                  + L+     T      + +++ +Y+R  EF+  Y WY     + V  +      
Sbjct: 184  SMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFE------ 237

Query: 219  YTKFFYTLFDKLTVTKELLPKLNVA--LWSHSWPASYTKQTXXXXXXXXXXXXXXXXXSE 276
                F   FD L  + E      V         P  + K T                   
Sbjct: 238  ----FSDNFDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTII----------------- 276

Query: 277  NDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQF 336
                 ++ ++ +EQ+++F+L++DGTL+ PN+  H+  RHE+L+++L LP    PLL+ QF
Sbjct: 277  -----KRTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHELLFKILNLPSVLTPLLELQF 331

Query: 337  MTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGR-DWRFHVCYNMQK 395
              L  LVDP+ QP P ++ +ISID +FQ+FLG     I++        DW+F+ C+NMQK
Sbjct: 332  CNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQK 391

Query: 396  IVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAM 455
            I+ ATM RLNC D + LN+VNN+D  +HW   L KW P GLNTQDLELLYM+D+L+IY +
Sbjct: 392  IIDATMLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTI 451

Query: 456  YRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAA 515
            Y+LY  +P+Q+NPFL   L LWKNL+ V+L  LEIDR EE+  T+ TP++VRA IRG AA
Sbjct: 452  YKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAA 511

Query: 516  LRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLN 575
            LRSV+A+++N    S +HDFKHE +N FMSP+GRKLCHGALYAD+RSH A++L+LG  + 
Sbjct: 512  LRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIE 571

Query: 576  DVTDLLSDLQPGDRFDDDVKYMFDYEYDDYN----AIDPEQLYXXXXXXXXXXXXXXXXX 631
            DVTDL +DLQ GDRFD+D++YMFDYE +DYN      D EQL                  
Sbjct: 572  DVTDLFADLQSGDRFDEDIRYMFDYECEDYNEPFSESDDEQL--------NEDANSRGKI 623

Query: 632  XXKDMRGYY-KRCHCVFXXXXXXXXXXXGET--ASSNIDRPKYSHNSLNLPSSMLSTTFN 688
                  G+Y +RC+C+F            E    S N +      N++N+  S  +T   
Sbjct: 624  KSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGNSNMENEMPNNVNVIPSTATT--- 680

Query: 689  GPNSQKFA-------IRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYL 741
              NS +FA       +RSR   +FD++G+DWRD+P+  N YY+  Y F+ +   DV++ L
Sbjct: 681  --NSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNL 738

Query: 742  MKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDV------MNGRTDKGSSSN---SN 792
                 T+K+  + +  ++ S+A+C+K EQ++ ++ D+      ++   +  SS+N   +N
Sbjct: 739  TLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTN 798

Query: 793  SDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEIS 852
            ++ +   T D IYE W EES F +M+  N+D+ WR+MDEMLMC+GYRR+LIWF+THLE+ 
Sbjct: 799  NEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELK 858

Query: 853  HSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPIIL 912
            HSLI+Y+FELVMG+RG     E ++ D K+               V+  +PFSRQGPI+L
Sbjct: 859  HSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVS-GLPFSRQGPIVL 917

Query: 913  SIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLG 972
            S IE  MLL EFF+NA I+ S       +                          +D   
Sbjct: 918  SDIETKMLLQEFFMNAAIFLSSKNDEEEN--------------------------EDGEK 951

Query: 973  VSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSS 1032
            +S + +GL+KL+C+MV  L+   KF FT SE  FELQTLLM WIG++PEA++LFF++K+ 
Sbjct: 952  ISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTR 1011

Query: 1033 ILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPP 1092
            +                 E    K  Q      +  + K + ++R  H ++         
Sbjct: 1012 L---------------AMEEDSDKDGQ------QNDDNKDLEVERRPHTKSN-------- 1042

Query: 1093 TPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHV--DNENTAVTALRSFITKHSL 1150
                                    S+ N  L+ L P +   +N+N+A++ LRSFIT +  
Sbjct: 1043 ------------------------SELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPF 1078

Query: 1151 TNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFGID 1190
              +    GR+V++ D  I+ L  ADK +   E++    ID
Sbjct: 1079 DTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEID 1118

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1014 (40%), Positives = 578/1014 (57%), Gaps = 94/1014 (9%)

Query: 46   ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSR 105
            +L+ E + +TLF T SG S+L  +      + KL  + QS +  +N+S + S    W   
Sbjct: 68   SLLFEALAITLFTTNSGKSILQSIQTFTSKKRKL--WAQSFE--NNNSNYASIVFSWKDN 123

Query: 106  RDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLR--PYLIDDEYNLLLDYMI 163
              +L +F+ F L N+   L    Y     KLPL FL+   +     L+++ YNLL DY+ 
Sbjct: 124  DILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKDYLY 183

Query: 164  QSRPMWEMLLTQGIPKF-LPELV-----DEYNRSYEF-NGYYVWYGNVTCSQVQVQSSTK 216
                  E LL    PKF  P LV      +Y+R  E  N Y  +Y N        ++S  
Sbjct: 184  SITGRIEELLMCS-PKFNQPALVVKRTLKDYDRMIECENCYCWYYFN-------AENSAH 235

Query: 217  ELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTXXXXXXXXXXXXXXXXXSE 276
              +      L      T+  L    V         +Y KQ                    
Sbjct: 236  LKFDDNIACLMGSENNTENGLGDSRVN------NNNYHKQP------------------- 270

Query: 277  NDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQF 336
             D    + ++ +EQ+++F+LN DGTLE PNV  H+  RHE+L+++L L     PLL+ QF
Sbjct: 271  KDVVMSRTINDQEQIYSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVSTPLLELQF 330

Query: 337  MTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGR----DWRFHVCYN 392
             TL  LVDP+ QP P + HIISID +F++FLG     I++   S+G     DW+F+ C+N
Sbjct: 331  STLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKS---SQGHNDHYDWKFYTCFN 387

Query: 393  MQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSI 452
            MQKI+ ATM RLNC D ++LN+VNN+D SVHW   L +W P GLNTQDLELLYM+D+L++
Sbjct: 388  MQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAV 447

Query: 453  YAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRG 512
            Y +Y+LY  LP+Q+NPFL   + LWKNL+ V+L  LEIDR EE+  T+ TP++VRA IRG
Sbjct: 448  YTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRG 507

Query: 513  TAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGI 572
             AALRSV+AT++N    + EHDFKHE +N FMSP+GRKL HGALYAD+RSH+A++L+ G 
Sbjct: 508  AAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGT 567

Query: 573  DLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXXXXXXXXXXXXXXX 632
             + DVTDL +DLQ GDRFD+D++YMFDYE  DY+    E                     
Sbjct: 568  SIEDVTDLFADLQSGDRFDEDIRYMFDYECADYDESFSESDDEGLEEGIVNAREKIKSSN 627

Query: 633  XKDMRGYYKRCHCVFXXXXXXXXXXXGETASSNIDR--PKYSHNSLNLPSSMLSTTFNGP 690
              ++    +RC+C+F            E   S  +R   +   N++++ S+   TT N  
Sbjct: 628  DNNVFC-QRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHV 686

Query: 691  NSQ--KFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTK 748
            ++    F++R+R   +FD++G+DWRD+PR  N YY+  Y F++    DV++ L     T+
Sbjct: 687  STSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATE 746

Query: 749  KMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTD-----KGSSSNSNSDRVNE----L 799
            K+    +  ++RS+A+C+K EQ++ ++ D+    T      +G +S S S   NE     
Sbjct: 747  KLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRT 806

Query: 800  TSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYI 859
            T D IYE W EES F +M+  N+D+ WR+MDEMLMC+GYRR+LIWF THLE+ HSLI+Y+
Sbjct: 807  TPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYV 866

Query: 860  FELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPIILSIIEINM 919
            FEL+MG+RG   +  +A D  K  +                 +PFSRQGPIILS IE  M
Sbjct: 867  FELIMGLRGKA-FSGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKM 925

Query: 920  LLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIG 979
            LL EFF+NA I+ S N     +                      EDG+K    +S + +G
Sbjct: 926  LLQEFFMNAAIFLSSNNSEEEN----------------------EDGEK----ISLYSLG 959

Query: 980  LMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSI 1033
            L++L+C+MV  L+   KF FT SE  FELQTLLM WIGI+PEA++LFF++K+ +
Sbjct: 960  LVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRL 1013

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 1132 DNENTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREF--LAEFGI 1189
            + EN+A+  LR+FIT +S   +    GR+V++ D  I+ L  ADK +   E+  LAE  +
Sbjct: 1061 NGENSAINTLRNFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDV 1120

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/930 (40%), Positives = 540/930 (58%), Gaps = 109/930 (11%)

Query: 283  QKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQFMTLAAL 342
            + ++ +EQ+++F+LN+DGTLE PNV  H+  RHE+L+++L L     PLL+ QF TL  L
Sbjct: 275  RTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGL 334

Query: 343  VDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGR-DWRFHVCYNMQKIVLATM 401
            VDP+ QP P + HIISID +FQ+FLG  S  I+         DW+F++C+NMQKI+ ATM
Sbjct: 335  VDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATM 394

Query: 402  KRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSY 461
             RLNC D D+LN+VNN+D +VHW   L +W P GLNTQDLELLYM+D+L++Y +Y+LY  
Sbjct: 395  LRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEK 454

Query: 462  LPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVA 521
            +P+Q+NPFL   + LWKNL+ V+L  LEIDR EE+  T+ TP++VRA IRG AALRSV+A
Sbjct: 455  IPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIA 514

Query: 522  TMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLL 581
            T++N    + +HDFKHE +N FMSP+GRKLCHGALYAD+RSH A++L+LG  + DVTDL 
Sbjct: 515  TVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLF 574

Query: 582  SDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXXXXXXXXXXXXXXXXKDMRGYYK 641
            +DLQ GDRFD+D++YMFDYE +DY+    E  +                        + +
Sbjct: 575  ADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDESVVNPTEKIASGSNNVF--FRR 632

Query: 642  RCHCVFX----XXXXXXXXXXGETASSNIDRPKYS-----HNSLNLPSSMLSTTFNGPNS 692
            RC+C+F               G T S N++   ++     HN+    S  + T+   PN 
Sbjct: 633  RCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATSDHVVTS---PNP 689

Query: 693  QKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTKKMEP 752
               ++RSR   +FD++G+DWRD+PR  N YY+  Y F+++   DV++ L     T+K+  
Sbjct: 690  --LSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNK 747

Query: 753  NHASFILRSIATCIKLEQEKSMVYDV-------MNGRTD-KGSSSNSNSDR--VNELTSD 802
              +  ++RS+A+C++ EQ++ ++ D+       +NG  + +G++  S  D   +   T D
Sbjct: 748  EESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPD 807

Query: 803  FIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFEL 862
             IYE W EES F +M+  N+D+ WR+MDEMLMC+GYRR+LIWF+THLE+ HSLI+Y+FEL
Sbjct: 808  DIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFEL 867

Query: 863  VMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPIILSIIEINMLLL 922
            +MG+RG   +  EA D  K  +                 +PFSRQGPI+LS IE  MLL 
Sbjct: 868  IMGLRGK-PFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQ 926

Query: 923  EFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMK 982
            EFF+NA I+ S       +                      EDG+K    +S + +GL++
Sbjct: 927  EFFMNAAIFLSSKNNEEEN----------------------EDGEK----ISLYSLGLVR 960

Query: 983  LVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSI-LEAXXXXX 1041
            L+C+MV  L+   KF FT SE  FELQTLLM WIGI+PEA++LFFK+K+ + +E      
Sbjct: 961  LICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEEDSAD 1020

Query: 1042 XXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINNLK 1101
                      +I KK +    +E   +  K++N+              FP  P +     
Sbjct: 1021 TMQHEGRKNSDIEKKLNAKPASE---LNLKLLNL--------------FPSKPAN----- 1058

Query: 1102 LENVGSPEIDNNNNLSKYNKMLIELLPLHVDNENTAVTALRSFITKHSLTNKTAVFGRRV 1161
                                           ++++ +  LRSFI  +S   +    GRRV
Sbjct: 1059 ------------------------------KDDSSPINTLRSFIADYSFDTQVNPPGRRV 1088

Query: 1162 IYQDHAIMGLYMADKEMRQREF--LAEFGI 1189
            ++ D  I+ L  ADK +   E+  LAE  +
Sbjct: 1089 VFYDGKILPLPKADKPIPLHEYITLAELDV 1118

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 73/163 (44%), Gaps = 11/163 (6%)

Query: 47  LITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSRR 106
           L+ E +++TLF T SG S L ++        K   + QS +  +N S + S    W    
Sbjct: 69  LLLEALIITLFTTISGKSALRLIQTSSLKERK--SWAQSFE--NNSSSYASIVLSWKDND 124

Query: 107 DILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLR--PYLIDDEYNLLLDYMIQ 164
            +L +FL F L N+   L    Y     KLPL FL+   +     L+++ YNLL DY+  
Sbjct: 125 ILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKDYLYS 184

Query: 165 SRPMWEMLLTQGIPKFLPELV-----DEYNRSYEFNGYYVWYG 202
                E L++       P LV      +YNR  E   +Y WY 
Sbjct: 185 ITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYS 227

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1193 (33%), Positives = 619/1193 (51%), Gaps = 214/1193 (17%)

Query: 43   HFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSL--KVRSN--------- 91
             FD+L+ E+ VVTLF T  G  +  ML  L  G   L++    +  +VR+          
Sbjct: 7    QFDSLL-EECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWTEEALSKY 65

Query: 92   -HSYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRP-- 148
             H +++  ++D G R  I+                  +Y     KL +  L P       
Sbjct: 66   IHLFFQHVWRDAGDRFAIM------------------QYNEPAFKLQVSDLFPSEFSKAR 107

Query: 149  YLIDDEYNLLLDYMIQSRPMWEMLLTQGIPKFLPE-LVDEYNRSYEFNGYYVWYGNVTCS 207
             +++ +Y++LLD++   RP  + L+ Q +   L + +V +Y R YEF+ Y+ W+      
Sbjct: 108  LVLNTDYDVLLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFN----- 162

Query: 208  QVQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTXXXXXXXXXX 267
                  S K+   +      D L + K      +  + S    A Y              
Sbjct: 163  -----LSKKKFANR------DVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELF- 210

Query: 268  XXXXXXXSENDHWPQQKLSSREQVFTFDL-----NRDGTLEFP-NVFLHAKKRHEILYRV 321
                     N++   Q+L + E V+ FDL     N  G      ++   + +RHEIL R+
Sbjct: 211  -------EGNNNVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRM 263

Query: 322  LGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISR 381
            L L + + P L  QF  + +LVDP+TQPPP++ +++S+DL++++FL           + +
Sbjct: 264  LNLKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVSLDLLYKLFLA---------FLPK 314

Query: 382  GRDWR----FHVCYNMQKIVLATMKRLNCHDGDVLNTVN-----NSDESVHWNVNLDKWT 432
             +D      F +C+NMQKI+  T+ RL C D   L +++       +   ++  +L +W 
Sbjct: 315  NQDTEQNDTFLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWV 374

Query: 433  PRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDR 492
            P GLNTQDLELLYMVD++++Y +Y  YS+LP+Q+NPFL + + LWKNL+ VLL  LE+DR
Sbjct: 375  PNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDR 434

Query: 493  FEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLC 552
             EE  +TF+TP++VRA IRG +ALR+VVA ++N H    EHDFKHEP+N FMSPHGRKLC
Sbjct: 435  CEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLC 494

Query: 553  HGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPE- 611
             G+LYAD+RSHAAAMLSLG+DL DVT+LLSDLQPGDRFD+D++YMF+YEY+DYN +D E 
Sbjct: 495  QGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFED 554

Query: 612  --QLYXXXXXXXXXXXXXXXXXXXKDMRGYYKRCHCVFXXXXXXXXXXXGETASSNIDRP 669
              +                            +RC+C+F                   D+ 
Sbjct: 555  EDEDAAAAATTATASAAAITAANEGTGASQKRRCNCIFTD-----------------DKI 597

Query: 670  KYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVF 729
              S  S          +  G  ++ +++R++   +FD++G DWRD+PRGLN Y+   Y F
Sbjct: 598  IQSDES--------KVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEF 649

Query: 730  VNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSS 789
            + +        +  +A   K+ P  +  +L+ +A+ IK+EQE  ++   +  +T+  +  
Sbjct: 650  LARPGLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQE-CIIMGTVYPQTEGIAVG 708

Query: 790  NSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHL 849
            +        LT D IY+ W ++ +F ++++ N +L W++MDE+LMC GYRRVL+WF+TH+
Sbjct: 709  DDGL-----LTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHM 763

Query: 850  EISHSLIHYIFELVMGMRG-----NVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIP- 903
            E++HS+IHYIFELVMG+RG     +V  +E+ +  + N               + I  P 
Sbjct: 764  ELNHSVIHYIFELVMGLRGQELSADVTLEEQRKQALHN--------------LMEIDTPN 809

Query: 904  -----FSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDL 958
                 FSRQG + LS IE+ MLL EFF NA I+                          L
Sbjct: 810  GGTLMFSRQGNLALSEIEVKMLLQEFFTNAAIF--------------------------L 843

Query: 959  EYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGI 1018
                 E+ + +T  VS + IGL+KL+CFMV  L+   KF+F+ SE  FELQTLLMNW+GI
Sbjct: 844  SASESEEPESETSDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGI 903

Query: 1019 IPEARNLFFKLKSSILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDRE 1078
            +P+A+ LFF LK +I +              T      ++ +L   G+            
Sbjct: 904  VPDAQELFFLLKKNISDTK------------TATTTTTTTSALGAPGD------------ 939

Query: 1079 DHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNE---- 1134
              +   L+DAD      D NN   E           NLS++NK L+ LLP    +E    
Sbjct: 940  --IFPTLTDAD------DDNNAVAE-----------NLSEFNKKLVMLLPRATQSEGKGS 980

Query: 1135 NTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEF 1187
            + A+ ALR+F+ KHSL+++  V GRR++ +   I+     ++ +  RE+L  +
Sbjct: 981  SQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYLGSY 1033

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1333 (33%), Positives = 662/1333 (49%), Gaps = 256/1333 (19%)

Query: 25   YKPDIRSLVEFRLNVG---DEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCC------G 75
            YKP+I+ L+E  ++      E+ D+L+ E +++ LF T  G S+L+++  L         
Sbjct: 18   YKPNIQ-LLETLIDYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQK 76

Query: 76   RIKLTEYKQSLKVRSNH------------------------------SYWKSCYKDWGSR 105
            +  L     +  V S H                              ++     + W + 
Sbjct: 77   KNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRND 136

Query: 106  RDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLL-------------PEPL-----R 147
            +  L +F  F L+N N  L+Y  +     KLPL+FLL              + L      
Sbjct: 137  KITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNN 196

Query: 148  PYLIDDEYNLLLDYMIQSRPMWEMLLTQGI-PKFLPELVDEYNRSYEF--NGYYVWYGNV 204
              L+D  YNLLLDY+  S P+   LL   + P     ++  YN+S+E   +   +WY  +
Sbjct: 197  TLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFI 256

Query: 205  TCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLP--------KLNVALWSHSWPASYTKQ 256
                           T  F T+ + + +    L          LN  + +  +  S +  
Sbjct: 257  DSKD-----------TTNFGTITNCIDIINNFLEIFDMHKNFTLNAEISNSLFNISSSST 305

Query: 257  TXXXXXXXXXXXXXXXXXSENDHWPQQKLSSREQVFTFDL---NRDGTLEFPNVFLHAKK 313
            T                  EN        S  E   +F+L   N +  +  P++  H  K
Sbjct: 306  TKSNMHNENEGADLNLLMDEN--------SMGEHTLSFNLFENNINHGILHPDLMAHISK 357

Query: 314  RHEILYRVLGLPDAE----GPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGS 369
            RH+IL ++L + D +     PLL  QF  L ALVDP+TQP P   +IISIDL+FQ+FLG 
Sbjct: 358  RHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGF 417

Query: 370  TSNLIENMLISR-GRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNL 428
                ++    +  G +W+F VC+NM+KI+ + MK+LNC D + LN++NNSDESVHW   L
Sbjct: 418  LKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQL 477

Query: 429  DKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGL 488
             KW PRG NTQDLELLYMV++L+ Y +Y+L   LP+Q+NPFL   +  WKNL+  +L GL
Sbjct: 478  HKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGL 537

Query: 489  EIDRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHG 548
            EIDR EE+ ETF+TP+IVRA +R + ALRS++AT++N+H ++  HDFKHE +N FMSP+G
Sbjct: 538  EIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYG 597

Query: 549  RKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAI 608
            RKLC+GALY D RSHA+ +L+L  DL  VT L+SDLQPGDRFD+DVKYMF  E++DYN +
Sbjct: 598  RKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMF--EFEDYNTL 655

Query: 609  DPEQLYXXXXXXXXXXXXX---------------XXXXXXKDMRGY----------YKRC 643
             P  L                                   +++R Y          ++RC
Sbjct: 656  -PNVLGGEDDETSTDTLKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRC 714

Query: 644  HCVFXXXXXXXXXXX-----GETASSNI------------------------DRPKYSHN 674
            +C+F                G ++S+ I                        D      N
Sbjct: 715  NCIFSDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKN 774

Query: 675  SLNLPSSMLSTT---------FNGP--------NSQKFAIRSRDG---VDFDFNGKDWRD 714
              NL    LS+T         FN P        N+   ++ +++     DFD+NGKDWRD
Sbjct: 775  IENLTKDQLSSTEMESLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRD 834

Query: 715  IPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSM 774
             PRG+N YY  +Y F+ K + D+V+ L  +AT  K++ + ++ +LR +A+ +K EQ++ +
Sbjct: 835  TPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRII 894

Query: 775  ---------VYDVMNGRTD----------KGSSSNSNSDR-VNELTSDFIYEKWCEESLF 814
                     V ++M    D          K    N N    + E+T D IYE WCEES F
Sbjct: 895  FSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAF 954

Query: 815  TKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDE 874
             +MM  N ++ +R+MDEMLMC GYRRVLIWFITHLE+SHS+IHYIFELVMG RG  + + 
Sbjct: 955  ERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENG 1014

Query: 875  EAEDDIKNRNXXXXXXXXXXXXXVT------------IKIPFSRQGPIILSIIEINMLLL 922
              ED   N               +             +++PFSRQG I LS IE  ML+ 
Sbjct: 1015 ATEDKHTNTKGNVNELENKNENELVNMLLNDYSKIFDLQLPFSRQGNIELSEIERKMLIQ 1074

Query: 923  EFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLMK 982
            EF  NA I+F       N    L  + + N+ S+  E  + +D D+D   +S + IGLM+
Sbjct: 1075 EFLTNAAIHF-------NERNNLKHNPNSNDNSNSNEDNINKDEDEDE--ISLYSIGLMR 1125

Query: 983  LVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEAXXXXXX 1042
            L+CFM+   ++  K      + IFELQTLLMNWI IIPEA+ LFF++K  I         
Sbjct: 1126 LICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFQIKDII--------- 1176

Query: 1043 XXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDH-LENCLSDADFPPTPIDINNLK 1101
                           S + +         I+++D++++ +EN  S           NN K
Sbjct: 1177 ---------------SNNQIDNNNFNNNLILDLDQDNNTIENQTSKD---------NNDK 1212

Query: 1102 LENVGSPEIDNNNNLSKYNKMLIELLPL--HVDN-ENTAVTALRSFITKHSLTNKTAVFG 1158
            ++   S ++D+N   S +NK LIEL P   H +  ENTA+  L++++ K     +  + G
Sbjct: 1213 MD--ESSKVDSN---SSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIG 1267

Query: 1159 RRVIYQDHAIMGL 1171
            R+VIY+D  I+ +
Sbjct: 1268 RKVIYEDGKILKI 1280

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1180 (34%), Positives = 598/1180 (50%), Gaps = 155/1180 (13%)

Query: 46   ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSR 105
            + ITE  V+ LF TR G S+L+ L D       + E  +     S           W   
Sbjct: 50   SFITEVTVIALFTTRPGISLLNCLTD----NFGIDEDNKDFNPNSLLPRMPQLALKWMHD 105

Query: 106  RDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRPY----LIDDEYNLLLDY 161
              IL +FL F + N N  +++        KL L FL+      +    L+ +E +++ +Y
Sbjct: 106  ELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREY 165

Query: 162  MIQSRPMWEMLLTQGI----------PKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQV 211
            +    P  + ++   +            F    +  Y R YE   ++ +Y   +     +
Sbjct: 166  LTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSS-----M 220

Query: 212  QSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYT-KQTXXXXXXXXXXXXX 270
            +++  ++Y K        L+     L KL+   ++     SY   +              
Sbjct: 221  KTNGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGE 280

Query: 271  XXXXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAE-- 328
                 E D+  Q  L                L+FP++     KRH  L +++     E  
Sbjct: 281  VEENQETDNILQPSL----------------LDFPDLMNETAKRHLALSKLIIDSKLEKQ 324

Query: 329  ---GPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISR-GRD 384
                PLL+ Q+ TL AL+DP+TQP P + H+ISIDL+  MFLG     I+N L +  G D
Sbjct: 325  ISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVD 384

Query: 385  WRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELL 444
            WRFH+C+NMQ+I++A++  LNC+D + L TV   DES  W   L  W PRGLNTQ+LEL+
Sbjct: 385  WRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGLNTQNLELV 441

Query: 445  YMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPI 504
            YM  +L++Y +Y+LYS  PV  NPFL   + LWK+LT V+L GL+IDR EE  ++F+TPI
Sbjct: 442  YMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPI 501

Query: 505  IVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHA 564
            IVRA IRG AALRS+VAT++N+    K HDF HE +N FMSPHGRKLC GALYAD++++ 
Sbjct: 502  IVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYT 561

Query: 565  AAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXXXXXXX 624
            A++L+LG +  +VTDL+S LQ GD+FD+DVKYMF+YEY+DYN I  +             
Sbjct: 562  ASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFEYEYEDYNEIYEDS------------ 609

Query: 625  XXXXXXXXXKDMRGYYKRCHCVFXXXXX--------------XXXXXXGETASSNIDRPK 670
                      D     +RC+C+F                         GE A+ + +  +
Sbjct: 610  SNENEENEEIDYAFNKRRCNCIFSDDNLIEEEEDDEEESDVEKTSDIDGEIATKSKEHTE 669

Query: 671  YSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFV 730
             +  S     S LS   + P+    A+RS+   +FD++GKDWRDIPR  N YY+  Y F+
Sbjct: 670  KTIES----DSGLSNQLSKPH----AVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFI 721

Query: 731  NKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSN 790
            ++   + V+ L  +AT++K+    A+ +L S+A+ +K EQ++ +  +++    DK S+++
Sbjct: 722  DRPDLNTVFVLTLKATSEKLTKEEAALLLCSVASTVKNEQDRMIFGNLL--EQDKSSTAD 779

Query: 791  SNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLE 850
             + D   E T D IYE WCEES F +++++N DL W++MDEMLMCSGYRRVLIWFITH+E
Sbjct: 780  EHEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHME 839

Query: 851  ISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPI 910
            +SHSLI YIF+L+MG RG    D        ++N              +  + FSR G +
Sbjct: 840  LSHSLIIYIFDLMMGSRGINKTD-------TSKNVKSTFITENISDSNSNSLKFSRMGHL 892

Query: 911  ILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDT 970
             LS +E  M+L E F NA IYFSD  +  N     P   +E E  D+   G         
Sbjct: 893  KLSELETRMILQELFTNAAIYFSDKARKSNQSILTPDYSTEEEEFDEENEG--------- 943

Query: 971  LGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLK 1030
             G S + +GLMKL+C MV  L+E  KF+  +S+ +FELQTLLM WI I+PEA+ L FK+ 
Sbjct: 944  -GYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKIN 1002

Query: 1031 SSILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADF 1090
            SS+ E             G      KS + LV                            
Sbjct: 1003 SSLSEFSHVENSELASIEGAST---KSHKQLV---------------------------- 1031

Query: 1091 PPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLP--LHVDNENTAVTALRSFITKH 1148
                                D N+   KYN++L++L+P       EN      R +I  +
Sbjct: 1032 --------------------DKNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDY 1071

Query: 1149 SLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFG 1188
            S  ++ +   R++I+Q   I+ L  ++K     ++L E+G
Sbjct: 1072 SFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLTEYG 1111

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/930 (37%), Positives = 521/930 (56%), Gaps = 107/930 (11%)

Query: 287  SREQVFTFDLNRDGTLEFP-NVFLHAKKRHEILYRVLGLPDAEG-PLLKAQFMTLAALVD 344
              E+V++FDLN DG++  P N+ L+ KKRH+IL ++L     +  PLL+ QF  +  LVD
Sbjct: 393  GEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVD 452

Query: 345  PITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATMKRL 404
            P++QPPP + HIIS+DL++Q+F+       E    + G +W+ HVC+ M KI+   M++L
Sbjct: 453  PLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCMEKL 512

Query: 405  NCHDGDVLNTV------NNSDESV-------------------HWNVNLDKWTPRGLNTQ 439
            NC+D   L  +      NN +E +                   +W   L++W P GLNTQ
Sbjct: 513  NCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGLNTQ 572

Query: 440  DLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRET 499
            DLELLYMV +L+ Y + +L   +P+Q+NPFLP  ++LWK LT +L+ GL+IDR EE  ET
Sbjct: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632

Query: 500  FNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYAD 559
            + TP++V+A IRG +ALRSVVAT++N++    +HDFKHE +N FMSPHGRKLC+GALY D
Sbjct: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692

Query: 560  VRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXX 619
            ++  AA++ +LG+DL ++ +LLS L+PGDRFD+D+ YMF+YEYDDYNA   E        
Sbjct: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKT 752

Query: 620  XXXXXXXXXXXXXXK-DMRGYYKRCHCVFXXXXXXXXXXXGETASSNIDRPKYSHNSLNL 678
                          +  +  Y +RC+C+F           G       ++ +      N+
Sbjct: 753  LKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILQDDDDGNGDEQQGEQEEQEGTPKNV 812

Query: 679  PSSMLSTTFNGPNSQK---FAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHA 735
             S      F  P  ++   +A+RS+   +FD++GKDWRDIPRG N YY+  Y F++    
Sbjct: 813  AS------FQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSL 866

Query: 736  DVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSS-----SN 790
            D +  L  +A+T+K+  + +  +L+ +A+ IK EQ   ++ D++ G+    S+      N
Sbjct: 867  DTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVN 926

Query: 791  SNSDRVNE---LTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFIT 847
            S  ++       T D I++ W ++ +F +M+++N +L WR+MDEMLMC+GYRRVLIW+IT
Sbjct: 927  SKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYIT 986

Query: 848  HLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQ 907
            H++++HSLI YIFEL+MG+RG+        ++ + +N                  PFSRQ
Sbjct: 987  HMKLNHSLIQYIFELLMGLRGS-----PFANNNECKNELLHELMLGKKIVDNHTYPFSRQ 1041

Query: 908  GPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGD 967
            GP+ILS IE  MLL EFF NA IYF +++     D +L         ++D+     E  +
Sbjct: 1042 GPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQL------EHTTEDISINSDEIEN 1095

Query: 968  KDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFF 1027
             +  GVS + +GLMKL+C MV  L+E KKFDFT S+  FELQTLLMNWIGI+ EA+ LFF
Sbjct: 1096 NENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFF 1155

Query: 1028 KLKSSILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSD 1087
            KLKS I E              + + RK S  +   EG  I +                 
Sbjct: 1156 KLKSDIEETSESTDGGDDDDFESIDSRKSSESNGKWEGSRIGK----------------- 1198

Query: 1088 ADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELL-PLHVD----NENTAVTALR 1142
                                        ++ +NK L+ LL P+H      N +T  T  R
Sbjct: 1199 ----------------------------MNDFNKRLLRLLAPIHSGDTDLNSDTVTTPFR 1230

Query: 1143 SFITKHSLTNK-TAVFGRRVIYQDHAIMGL 1171
              +  +S T+K   V GR+V+Y D  I+ L
Sbjct: 1231 GLLKNYSFTSKPKKVAGRKVVYTDDEILPL 1260

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 96/205 (46%), Gaps = 40/205 (19%)

Query: 22  FRTYKPDIRSLVEFRLNVGDEHFD------------ALITEKVVVTLFMTRSGNSMLHML 69
           F+ YKP I +L +F   + DEHF             +++ E +V+  F T+SG S+L+ L
Sbjct: 82  FKIYKPTIENLQDF---LEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYL 138

Query: 70  YDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEY 129
           +D    R   T   + L+            K W     +   F+DF +RN+N  ++  ++
Sbjct: 139 FD--TKRKPPTVQNKILR------------KTWEVNEFLYFCFIDFLIRNKNNEINIDKF 184

Query: 130 ASATRKLPLQFLLP-EPLR-----PYLIDDEYNLLLDYMIQSRPMWEMLLTQ----GIPK 179
                KL ++FLL   PL        ++D  YN+L DY+  +   W +LL +     +  
Sbjct: 185 NEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDYL-DATSNWLILLIKMTILNVGP 243

Query: 180 FLPELVDEYNRSYEFNGYYVWYGNV 204
           F    +  YNR  +FNG++ WY ++
Sbjct: 244 FFYNTIIRYNRIPQFNGHFQWYTSL 268

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/1025 (34%), Positives = 529/1025 (51%), Gaps = 112/1025 (10%)

Query: 45   DALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGS 104
            D    E + + LF T+ GN +LH   +   G     E+  S     +   ++     W  
Sbjct: 113  DNFFYELLTIALFTTKPGNKILHFFKN--TGLDSAIEHNDSDDTLFHSPAYEHLKMLWKW 170

Query: 105  RRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEP----LRPYLIDDEYNLLLD 160
              + L   L F L+N N  +D   Y   + K PL FLL  P       +L+ +E+N+L +
Sbjct: 171  EDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTCPNNNIKHRFLLSEEFNILEE 230

Query: 161  YM------IQSRPMWEMLLTQGIP-KFLPELVDEYNRSYEFNGYYVWYG-----NVTCSQ 208
            Y+      I+S+    +  T G    F    +  Y+R  E+N  Y+ Y      N  C  
Sbjct: 231  YLYAAQSNIKSKIAIAIQSTIGKHMNFFTMTLHLYDRVTEYNQSYLRYEITDDENALC-- 288

Query: 209  VQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTXXXXXXXXXXX 268
             Q   S  ++  +F     ++   T ++     + L S          +           
Sbjct: 289  -QFDESLLDVLLEF-----ERYVTTDDIEA---ILLQSGRINKVKDISSAIERGDYKWEQ 339

Query: 269  XXXXXXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLP--D 326
                  + N+H    +    E + +FD+N +G  E PN+   +  RH IL+  LGL   +
Sbjct: 340  GTLRSLTPNNHKADNE---EEVILSFDINENGLQEVPNIMKDSMLRHSILFEFLGLSQRN 396

Query: 327  AEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGR--- 383
               P L+ QF TLA LVDP+TQP P + HIISIDL+  ++ G    L+   LI  G+   
Sbjct: 397  TLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTG----LVHPALIKSGKARN 452

Query: 384  -DWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLE 442
             DW++   +N+ KIV  ++K+L+C   D LN + N +E   W   L+ W P+ LNTQDLE
Sbjct: 453  YDWKYLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQTLEYWIPKNLNTQDLE 512

Query: 443  LLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNT 502
            LLYM+D+LS+YA+Y+LY   P+Q NPFL     +WK +T ++  GL++DR EE  ++  T
Sbjct: 513  LLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDSEET 572

Query: 503  PIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRS 562
            P+++RA +RG +A R+ + T++N    + EHDFKHEPIN FMSPHGRKLC G+LYAD+R 
Sbjct: 573  PLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYADMRV 632

Query: 563  HAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAI-DPEQLYXXXXXXX 621
                 +  G++L+D+T+LL+DLQPGDRFD+DV+YMFDYEY+DYN + D E +        
Sbjct: 633  STKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYNLVSDSEDMDEKADNES 692

Query: 622  XXXXXXXXXXXXKDMRGYYKRCHCVFXXXXXXXXXXXGETASSNIDRPKYSHNSL----N 677
                              ++RC+CVF                  +D     H SL     
Sbjct: 693  DGVRPAPI----------FRRCNCVFEDDKI-------------MDESTIDHQSLITDME 729

Query: 678  LPSSMLSTTFNG------PNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVN 731
            L ++ +ST             + F +R R   DF++ GKDWRDIPRG N YY   +VFV 
Sbjct: 730  LENNAISTKDENDKIKIISQPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQ 789

Query: 732  KLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNS 791
            +  +        +A    ++ + ++ +++ +A+CI+ EQ++ ++Y  M+         N 
Sbjct: 790  ECSSSEFASYFSKAVNSVLDISESNRLIQLVASCIREEQDRMVIYHGMSQLPLANGDVNK 849

Query: 792  NSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEI 851
            +     +LT D IY++    + F KM+Y + +L   +MDE+LM  GYRRVLIWF+TH+ I
Sbjct: 850  S-----KLTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLTHINI 904

Query: 852  SHSLIHYIFELVMGMR-GNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSRQGPI 910
            +  LIHYIFELVMG R G  D D   +++ K+                T K  FSR G +
Sbjct: 905  TFPLIHYIFELVMGYRVGFSDGDANGDNNKKSS---------------TGKCGFSRLGTV 949

Query: 911  ILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDT 970
             LS IE  MLL EFF+NAT+  S   K+  S+       +E +  DD       + D+D 
Sbjct: 950  ALSSIEKQMLLQEFFLNATVSLS--AKSFESN------GTEIDNYDD-------NADEDN 994

Query: 971  LGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLK 1030
              +S + +G++ L+C MV  L+   + D + SEY  ELQTLL+NWI +IPEA+ LFF LK
Sbjct: 995  EYISSYAVGIVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWISLIPEAKELFFFLK 1054

Query: 1031 SSILE 1035
                E
Sbjct: 1055 QEAHE 1059

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  516 bits (1330), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 293/731 (40%), Positives = 426/731 (58%), Gaps = 70/731 (9%)

Query: 311  AKKRHEILYRVLGLPDAEG------PLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQ 364
             ++R  ILY+VL     +        L+   F  + ALVDP+TQP P ++H+IS+DL+++
Sbjct: 285  TERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISLDLLYK 344

Query: 365  MFLGSTSNLIENMLISR--GRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESV 422
            +FL      ++ +LI R    DWR+ +  N+QKI+      LNC+D + LN V   DE+ 
Sbjct: 345  IFLAMMLPHVQ-VLIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKV---DETK 400

Query: 423  HWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTN 482
            HW   L  W P GLN Q+LELLYM+ +  +YA+++LY   P+  NPFLP  L  WK LT 
Sbjct: 401  HWKEQLHLWLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLSTWKKLTY 460

Query: 483  VLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINL 542
            V+L GL++DRFEE+ E+FNTPI+VRA IRG +ALRSVVA+++N+    K+HDF+HEP+N 
Sbjct: 461  VMLYGLQVDRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQHEPLNT 520

Query: 543  FMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEY 602
            FMSPHGRKLC GALYAD++S+ A+ML+ G++  D+T+LLS LQPGD FD+DVKYMF+YEY
Sbjct: 521  FMSPHGRKLCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDEDVKYMFEYEY 580

Query: 603  DDYNAIDPEQLYXXXXXXXXXXXXXXXXXXXKDMRGYYKRCHCVFXXXXXXXXXXXGETA 662
            DDYN  + ++                            +RC CVF           G+  
Sbjct: 581  DDYNEPEEDESDEDGERNNSEENIKFNFNR--------RRCRCVF---SDDDVLEHGDFN 629

Query: 663  SSNIDRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFY 722
             +N +      NS ++ + +L      PN      + ++GV+FDF+GKDWR +PR LN +
Sbjct: 630  DANSEYSNSEENSNDVDNFVL------PNDG--IDKPKNGVEFDFDGKDWRAVPRHLNMF 681

Query: 723  YTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGR 782
            Y+  Y+F+      ++  L+ EA+   +    +  +LR+IA+ IK+ Q+  +   + + R
Sbjct: 682  YSFDYIFIENPLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDSRI---LGSKR 738

Query: 783  TDKGSSSNSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVL 842
            +  G+ S   S   N L++  + +       F  ++ +N +L   +MDE+LM  GYRRVL
Sbjct: 739  SPNGTDS---SKSQNGLSTGDLIKLITAGDTFENILKFNRELGCFLMDELLMILGYRRVL 795

Query: 843  IWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKI 902
            +WF+THL +SH++I+YIFEL+M  RG V   E  + +                    +  
Sbjct: 796  LWFLTHLTLSHTIIYYIFELLMHHRGQVSDTEREQSE--------------------LSY 835

Query: 903  PFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGL 962
             FSRQG + LS +E  MLL EFF NAT++FS       SD     +   NE + D+    
Sbjct: 836  TFSRQGELRLSDLEREMLLQEFFTNATMFFSSKSVLFASD-----TGDNNEINTDV---- 886

Query: 963  CEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEA 1022
              DG++     S + +GLM++ C M+  L +   FD + SE IFELQTLLM WI IIPEA
Sbjct: 887  --DGEEGL--YSLYAVGLMRVTCIMIISLFDNADFDLSSSESIFELQTLLMGWINIIPEA 942

Query: 1023 RNLFFKLKSSI 1033
            + LFFKLK S+
Sbjct: 943  KLLFFKLKESV 953

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 1110 IDNNNNLSKYNKMLIELLP--LHVDNENTAVTALRSFITKHSLTNKTAVFGRRVIYQDHA 1167
            ID N+   ++NK L++  P     D+ +  +   + F+  +S  ++    GR+VIY+   
Sbjct: 979  IDENSEQYRFNKKLLKTFPKSFSGDDGDILLKTFKDFLRNYSFDSEPPYIGRKVIYESDE 1038

Query: 1168 IMGLYMADKEMRQREFLA 1185
            I+ L   +K +   +FL+
Sbjct: 1039 ILQLTDIEKPISLHKFLS 1056

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  503 bits (1294), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 367/1194 (30%), Positives = 576/1194 (48%), Gaps = 129/1194 (10%)

Query: 36   RLNVGDEHFD-ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSY 94
            RL + D   D +++ EK+V+ LF T  G +++  L +    R    +  + L +R N  Y
Sbjct: 10   RLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLIN-DAKRTNDVDGVECL-IRMNDPY 67

Query: 95   WKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLP--EPLRPYLID 152
            W + +  W + + ILS FL + LRNE   +D   Y+  + K+ ++FLL   +P     + 
Sbjct: 68   WVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLW 127

Query: 153  DEYNLLLDYMIQSRPMWEMLLTQGIPKFLPELVDEYNRSYEFNGYYVWYGN-VTCSQVQV 211
            D  N+LLDY+  ++P+ E +L +       + + +YNR YEFNG Y W+    + S  + 
Sbjct: 128  DTSNILLDYLHNAKPLIESVLKKLDGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAES 187

Query: 212  QSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTXXXXXXXXXXXXXX 271
             ++  E  + F  TL +        L +L       +   SY K +              
Sbjct: 188  PTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPLS------ 241

Query: 272  XXXSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEGPL 331
                ++DH P              LN +G  +  N+F             LGL     PL
Sbjct: 242  ---KQDDHNP--------------LNLNGKSDRFNLFFK-----------LGLHKEPHPL 273

Query: 332  LKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWRFHVCY 391
            L  QF +L    DP+TQPPP + HIIS+DL+  ++LGS +  I  ++ +  + W+ H+  
Sbjct: 274  LAEQFNSLCLFADPMTQPPPNDSHIISLDLLHDLYLGSLTAYIVKLIPNYQKVWKIHLSA 333

Query: 392  NMQKIVLATMKRLNCHDGDVLNTVNN--SDESVHWNVNLDKWTPRGLNTQDLELLYMVDM 449
            N++ I LA ++ L   D   L+ + +  +     +   +  W P  L+  ++E+LYM+  
Sbjct: 334  NLETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAG 393

Query: 450  LSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAA 509
            LS Y+M++++S  P ++NPFLP+ L  W+ L++ L+ GL+IDRFEE +  + TP+IV A 
Sbjct: 394  LSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAV 453

Query: 510  IRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLS 569
            IRG +ALRS++AT++N H   K HDFKH+P   FMSPHGRKLC+GALY     + AA+L 
Sbjct: 454  IRGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLP 513

Query: 570  LGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYXXXXXXXXXXXXXXX 629
             G+D +++ +LL+D+Q GDR D+DV+YMFDYEY DYN  D  +L                
Sbjct: 514  SGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQ 573

Query: 630  XXXXKDMRGYYKRCHCVFXXXXXXXXXXX--------GETASSNIDR---------PK-Y 671
                + +RG YKRC C F                   GE +   +D          P+ +
Sbjct: 574  KNRFRMLRGLYKRCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTF 633

Query: 672  SHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVN 731
            S +S  +  + L T  +  N       S     +D NG DWRDIPRGLN YY + Y F++
Sbjct: 634  SESSNAVAFTSLMTHRDSQND----FVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLS 689

Query: 732  KLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSNS 791
            KL    ++ L++    + +  + A  +LRSIATC+KLEQE+ ++      +    +S+  
Sbjct: 690  KLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILL------KLITATSAEV 743

Query: 792  NSDRVNELTSDFIYEKWCEESLFTKMMYY---NNDLVWRMMDEMLMCSGYRRVLIWFITH 848
            +   +   T + I   + ++    K   +   N+ L W++ DE++M  G+RR+LI+ +TH
Sbjct: 744  DLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTH 803

Query: 849  LEISHSLIHYIFELVMGMRGNV--DYDEEAEDDIKNRNXXXXXXXXXXXXXVTIKIPFSR 906
               + S IHY++EL+ G+RGN    YD E+    KN+                  I FSR
Sbjct: 804  RSYTFSSIHYVYELLFGLRGNPARSYDLES---TKNKQLGILSWTPTGEFERVAAIEFSR 860

Query: 907  QGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDG 966
            QG I LS IE  MLL EFF+  +        +    E   +        DD  YG  E+ 
Sbjct: 861  QGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGF-EAFSIKNPSKVYVDD--YG--EEF 915

Query: 967  DKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSE-YIFELQTLLMNWIGIIPEARNL 1025
               T      + G +K+VCF+++ ++  K+F+F   E Y++EL+  LM W     EA ++
Sbjct: 916  FSAT-SRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSM 974

Query: 1026 FFKLKSSILEAXXXXXXXXXXXXGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCL 1085
            +  LKS  L              GTE +  +                 N D +D L    
Sbjct: 975  YALLKSKAL--------GKVLDLGTEGLDDRP----------------NTDPDDQL---- 1006

Query: 1086 SDADFPPTPIDINNLKLENV-------GSPEIDNNNNLSKYNKMLIELLPLHVDNENTAV 1138
                    P+D + LKL ++           I+N +  S  ++    +LP+   +     
Sbjct: 1007 -------LPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSERFSRMLPVQSLDGQPVD 1059

Query: 1139 TALRSFITKHSLTNKTAVFGRRVI-YQDHAIMGLYMADKEMRQREFLAEFGIDY 1191
               R  + K+ LT  T + GR  + Y DH I+ L +   +   REFLA F IDY
Sbjct: 1060 KVFRHLLQKYPLTEGTPIHGRITLEYHDH-ILPLDIRTHQSLHREFLAVFDIDY 1112

>TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {ON}
           Anc_8.477 YDR247W
          Length = 431

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 111 EFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRPYLIDD 153
           +F    + N++  LDYIE +++  +L    L P+PL+ Y IDD
Sbjct: 290 QFFKSYMTNKSVLLDYIEVSTSFYQLLTLILEPDPLKRYGIDD 332

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
            YIL130W
          Length = 902

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 1/100 (1%)

Query: 922  LEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSP-HVIGL 980
            L+ ++NA +    ++   + D+ LPL  S+   ++   Y   EDG   + G++  H   +
Sbjct: 441  LDVYVNAMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLSSTGIANCHTRLI 500

Query: 981  MKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIP 1020
            M L   M  +   K+  +    E +  L+ LL +W   +P
Sbjct: 501  MILDTIMRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLP 540

>Kpol_1048.32 s1048 complement(92901..94232) [1332 bp, 443 aa] {ON}
           complement(92901..94232) [1332 nt, 444 aa]
          Length = 443

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 323 GLPDAEGPLLKAQFMTLAALVDPITQPPPTE-DHIISIDLIFQMFLGSTS------NLIE 375
           G  DAEG  L+   ++L A+VD   Q      DH+I    +F++FLG T       NL+E
Sbjct: 312 GSTDAEGKPLRNSHLSLLAIVDSWYQLGINPYDHMICSTPLFRIFLGVTEYLFLNDNLLE 371

Query: 376 NMLISRGRDWRF 387
             + S   D  F
Sbjct: 372 ETIDSAVNDLEF 383

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 128,736,767
Number of extensions: 5884291
Number of successful extensions: 17567
Number of sequences better than 10.0: 44
Number of HSP's gapped: 17793
Number of HSP's successfully gapped: 76
Length of query: 1204
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1083
Effective length of database: 39,606,813
Effective search space: 42894178479
Effective search space used: 42894178479
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)