Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12313.498ON32932914480.0
AFR317C3.498ON3283355195e-63
Kwal_47.188953.498ON4432384335e-49
KLTH0G02398g3.498ON4622334275e-48
SAKL0F02552g3.498ON4782504242e-47
KLLA0E03939g3.498ON4352313961e-43
Kpol_480.113.498ON4632543925e-43
ZYRO0D09768g3.498ON4602293892e-42
TDEL0D056603.498ON4422353769e-41
TPHA0A056903.498ON4782593648e-39
Skud_16.4463.498ON4562493051e-30
YPR152C (URN1)3.498ON4652442954e-29
Suva_16.4803.498ON4522352874e-28
KAFR0G037203.498ON4092302821e-27
Smik_16.4043.498ON4602422724e-26
KNAG0A079703.498ON3882342704e-26
CAGL0L08404g3.498ON4102312461e-22
NCAS0F035803.498ON4132332027e-17
NDAI0B059003.498ON5222501941e-15
TBLA0D029303.498ON2761351563e-11
KAFR0A002302.649ON55631970.002
Smik_11.2432.649ON57942890.015
YKL012W (PRP40)2.649ON58342890.015
ZYRO0E00682g2.649ON57042870.027
KLTH0C00924g2.649ON56426870.030
TDEL0B074402.649ON57026860.033
Kpol_1073.42.649ON53027850.040
Skud_11.2172.649ON58326840.055
TPHA0L020202.649ON58339830.083
Suva_11.2162.649ON58527820.100
SAKL0G19360g2.649ON56828820.11
CAGL0L05368g2.649ON59026810.17
ADR159C2.649ON56927800.17
Ecym_33972.649ON57544800.19
Kwal_14.9392.649ON56226790.25
NDAI0G046002.649ON64727790.28
KNAG0M024702.649ON60649780.37
TBLA0C009302.649ON65843780.38
NCAS0C051102.649ON60433750.73
KLLA0E18239g2.649ON57129731.4
NDAI0H019507.21ON856105669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1231
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   562   0.0  
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   204   5e-63
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   171   5e-49
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   169   5e-48
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   167   2e-47
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   157   1e-43
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   155   5e-43
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   154   2e-42
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   149   9e-41
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   144   8e-39
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   122   1e-30
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   118   4e-29
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   115   4e-28
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   113   1e-27
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   109   4e-26
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   108   4e-26
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...    99   1e-22
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...    82   7e-17
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...    79   1e-15
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    65   3e-11
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    42   0.002
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    39   0.015
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    39   0.015
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    38   0.027
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    38   0.030
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    38   0.033
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    37   0.040
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    37   0.055
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    37   0.083
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    36   0.100
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    36   0.11 
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    36   0.17 
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    35   0.17 
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    35   0.19 
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    35   0.25 
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    35   0.28 
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    35   0.37 
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    35   0.38 
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    33   0.73 
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    33   1.4  
NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {O...    30   9.0  

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/329 (85%), Positives = 280/329 (85%)

Query: 1   MVWKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGAVGLVKGYXXXXXXXXXXXXXX 60
           MVWKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGAVGLVKGY              
Sbjct: 1   MVWKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGAVGLVKGYSSSSEEEEEEEEEQ 60

Query: 61  XXXXXXXXHGVDISKPLDVRVGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYT 120
                   HGVDISKPLDVRVGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYT
Sbjct: 61  QQQQQEQQHGVDISKPLDVRVGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYT 120

Query: 121 LLDDETRRELFEDWCTMKLAKAGGDSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIV 180
           LLDDETRRELFEDWCTMKLAKAGGDSSASLTG              SLEPVKFHYLSHIV
Sbjct: 121 LLDDETRRELFEDWCTMKLAKAGGDSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIV 180

Query: 181 SKSTIKPQTVFSDVKTENKLLFKNFNIDETHPKQEQRQFVXXXXXXXXXXXXXERVEIFK 240
           SKSTIKPQTVFSDVKTENKLLFKNFNIDETHPKQEQRQFV             ERVEIFK
Sbjct: 181 SKSTIKPQTVFSDVKTENKLLFKNFNIDETHPKQEQRQFVSSLLFYYKKKSSKERVEIFK 240

Query: 241 NLLDTKVKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYY 300
           NLLDTKVKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYY
Sbjct: 241 NLLDTKVKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYY 300

Query: 301 VVGVRDKTILIKEFLRHMVRSTSQVRSGS 329
           VVGVRDKTILIKEFLRHMVRSTSQVRSGS
Sbjct: 301 VVGVRDKTILIKEFLRHMVRSTSQVRSGS 329

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  204 bits (519), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 122/335 (36%), Positives = 174/335 (51%), Gaps = 29/335 (8%)

Query: 1   MVWKRAKTGEGEFYYYETVSGEKTWERPETFEEETV------MGAVGLVKGYXXXXXXXX 54
           MVWKRAK+ +G+ YYY T + E TW++P+  E               L++GY        
Sbjct: 1   MVWKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGEERGDERARPQLIQGYESSSSDEE 60

Query: 55  XXXXXXXXXXXXXXHGVDISKPLDVRVG------YDSEHARFIALFDRYELNPYSSWSLQ 108
                          G D+                D + A   ALF+R EL+PYS+W  +
Sbjct: 61  EADEATEPEDAA--EGSDLGGGAAQSTSDRGNDETDGKKAELWALFERAELDPYSAWVFE 118

Query: 109 SRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSASLTGXXXXXXXXXXXXXXSL 168
           S K+  D  FY + DDE R+ELFE WC  K+A  G   +A L                 L
Sbjct: 119 SAKISGDAAFYAVGDDEARQELFEQWCARKIADEG---NAVLE-------DGEEAEEVEL 168

Query: 169 EPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNIDETHPKQEQRQFVXXXXXXXX 228
            P +FHYL+HIVSKST++P TV+SDV+ E+K LF    +D    K+EQR+FV        
Sbjct: 169 VPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD-ILDKKEQRRFVAGLLFYYK 227

Query: 229 XXXXXERVEIFKNLLDTK----VKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYI 284
                 R E+F+ LL           + N+ QL+++L+ + LP D+Y IE+ L  +EK I
Sbjct: 228 KMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCI 287

Query: 285 GMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHMV 319
           G+H +L +LQ +IKYYV+GV+DK +++KE LR M+
Sbjct: 288 GLHGALSKLQSEIKYYVLGVKDKLVVMKEVLREML 322

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  171 bits (433), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 139/238 (58%), Gaps = 6/238 (2%)

Query: 85  SEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGG 144
           S  A FI+LF +Y ++PYS+W++QSRK++ DP FY + +D  R+ELFE+WC   + +   
Sbjct: 209 SNDAEFISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWC---MNECSN 265

Query: 145 DSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKN 204
            S                    SLEP ++HYL+HIVSKS I   T+  D++T+ K LFK 
Sbjct: 266 QSEVPAIDEQIISSDDEDPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQ 325

Query: 205 FNIDETHPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLD---TKVKHEINNEDQLQQIL 261
           F I ++  K+EQ  F+             +R+ IFK  L+     +K  + N+++L  IL
Sbjct: 326 FRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEGKKKALKKGLKNQERLSTIL 385

Query: 262 DQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHMV 319
              +LP + Y IE+QL+ +E  I  H S   LQED++YYV+G++DKT+ +++ L+ ++
Sbjct: 386 STPSLPQENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILKDLI 443

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMG 38
          W+  KT +G  YYY   + + T+E P+ F+E+   G
Sbjct: 5  WREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSG 40

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  169 bits (427), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 135/233 (57%), Gaps = 4/233 (1%)

Query: 90  FIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGG-DSSA 148
           F +LFD Y+L+PYS+W++QS+K+  +P FY +  D  RRELFEDWC  K+      +  A
Sbjct: 226 FTSLFDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPA 285

Query: 149 SLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNID 208
                              LEP ++HYL+HIVSK+ + P T+  D+++E K LFK F I 
Sbjct: 286 HQAVSSDGDGDDDDTSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFKQFKIK 345

Query: 209 ETHPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVK---HEINNEDQLQQILDQEN 265
           E+  K++Q +F+             +R+E+    L T+ K       N +QL+ +L Q++
Sbjct: 346 ESLGKKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQQD 405

Query: 266 LPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHM 318
           LP   + IESQL+ +E  I +H   + LQ++++YYV+G++ KT  +KEFL+ +
Sbjct: 406 LPTSGFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFLKQL 458

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  167 bits (424), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 139/250 (55%), Gaps = 22/250 (8%)

Query: 89  RFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKA-GGDSS 147
           RF  LFD+Y L+PYS W  QSRK+  DP+FY + +  +R++LFE WCT  +A +    S 
Sbjct: 226 RFTILFDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISD 285

Query: 148 ASLTGXXXXXXXXXXXXX------------------XSLEPVKFHYLSHIVSKSTIKPQT 189
           A++                                  +LEP +FHYLSHI+SKS+I+  T
Sbjct: 286 ANINENDADQRQESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQTT 345

Query: 190 VFSDVKTENKLLFKNFNIDETHPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTK--- 246
           +F D+K ENK LFK F I  +  K++Q  F              +R  IF+ LL +K   
Sbjct: 346 IFLDIKKENKALFKTFRIKSSLKKKDQEDFASKLLFYYKRMDLEQRKLIFQKLLLSKLDI 405

Query: 247 VKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRD 306
           ++  + N ++L+ I  +++ P D+Y IE+QL+ ME  + +H  L  LQ ++ YY++G++D
Sbjct: 406 IRSNLRNVEKLRDIATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILGIKD 465

Query: 307 KTILIKEFLR 316
           KTI +K+FL+
Sbjct: 466 KTIQLKQFLQ 475

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  157 bits (396), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 140/231 (60%), Gaps = 6/231 (2%)

Query: 88  ARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSS 147
           ++FI L +  +L+PYS+WS+Q++++  DP +Y +  ++ R ELF+ WC+ +L  +   + 
Sbjct: 204 SKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCSQQLNNSN--ND 261

Query: 148 ASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNI 207
                              +LEP K+HYL+HI+SK+ I P+T+FS++K ENK LFK   I
Sbjct: 262 NENNAQDSAENSDEEDSDVTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEI 321

Query: 208 DETHPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVKHEINNEDQLQQILDQENLP 267
           ++T  K+EQ QF              +R E+FK ++  K++    +E +L Q++ +E  P
Sbjct: 322 NKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNKLRFPPISE-KLSQLMLEET-P 379

Query: 268 NDAYEIESQLITMEKYIGMHDSLRQ--LQEDIKYYVVGVRDKTILIKEFLR 316
           +D++++E+QL+ +E  + + D+L+   +Q +I YY++G++DK   +KE LR
Sbjct: 380 SDSFKLETQLLQLENALLILDNLQNSYMQNEIMYYILGIKDKLAALKEILR 430

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETF 31
          WKR K   G FYY+ T S   T E+P+ F
Sbjct: 4  WKRFKDPSGNFYYFNTRSKVSTKEKPKEF 32

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  155 bits (392), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 139/254 (54%), Gaps = 10/254 (3%)

Query: 69  HGVDISKPLDVRVGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRR 128
           HG+D    +D+    +   + F  LF+ ++L+PYSSW LQ +K+Q+ P+++ + D+ TR 
Sbjct: 217 HGLDSLDDIDL----EKSKSLFTRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTRE 272

Query: 129 ELFEDWCTMKLAKAGGDSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQ 188
           ELFE WC+ K    GG S+ +                   EP KFHYL+HI+SK+ I   
Sbjct: 273 ELFESWCSSKF--NGGKSNVT-NFEGEDEETLTSDEEDDFEPTKFHYLAHIISKADIAAD 329

Query: 189 TVFSDVKTENKLLFKNFNI-DETHPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKV 247
           T+F D+K  NK LFK F I D    K++Q  F              ER  +F  LL    
Sbjct: 330 TIFLDIKENNKSLFKEFKIKDFIKSKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENE 389

Query: 248 KHEINNEDQLQQILDQ--ENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVR 305
              I N +   +I+    +N  ++AYEIE+QL+ +EK IG+ + L  L  D KYY++G++
Sbjct: 390 NLIIPNINSNIEIVRHIIKNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIK 449

Query: 306 DKTILIKEFLRHMV 319
           DK IL+KE+L+  +
Sbjct: 450 DKLILLKEYLKDKI 463

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGAVG 41
          +WK     +G  YYY   S E TW +P++   +T  G VG
Sbjct: 5  IWKEFNAPDGRKYYYNIKSKESTWTKPDSL-YDTEKGKVG 43

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  154 bits (389), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 130/229 (56%), Gaps = 12/229 (5%)

Query: 93  LFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSASLTG 152
           LF RY+LNPYS+W  + +K++ DP+F  +LDD  R ++FE+WC   ++   GD    +  
Sbjct: 236 LFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAIS---GDQVEPVD- 291

Query: 153 XXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNI-DETH 211
                          LEP K+HYL+HIVSKS I P T+F D+K +NK  FK +NI D   
Sbjct: 292 ---EIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFLT 348

Query: 212 PKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVK----HEINNEDQLQQILDQENLP 267
            K++Q  FV             ER E+F  LL    K    +  N+ D+++  L QE   
Sbjct: 349 SKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLAQEIDS 408

Query: 268 NDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLR 316
           ND Y +E++L  MEK++G+  +L  L E+ KYY++G+RDK + + ++L+
Sbjct: 409 NDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLELNDYLK 457

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETFEE 33
          +W+     +G  YYY  V+ + TW +PE+ +E
Sbjct: 4  IWREYVAPDGRKYYYNAVTKQSTWHKPESLDE 35

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  149 bits (376), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 126/235 (53%), Gaps = 6/235 (2%)

Query: 90  FIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSAS 149
           F  L  R++ +PYS+WS+Q+RK+Q DP FY + DD  R  +FE+WC   + +        
Sbjct: 209 FFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQDL- 267

Query: 150 LTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNIDE 209
           +                 LEP+ FHYL+HIVSK+ I P T+F D+K +NK  FK + I +
Sbjct: 268 VDEDNLDDDSREEEEEDELEPLPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQ 327

Query: 210 -THPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDT---KVKHEINNEDQ-LQQILDQE 264
               K +Q  FV             ER EIF +LL++    +K  +  E + ++  L +E
Sbjct: 328 FVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEE 387

Query: 265 NLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHMV 319
              NDAY IE++L+ ME  IG+   + +L  D KYYV+G++DK I +  +L   +
Sbjct: 388 AGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTSYI 442

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETFEEE 34
          +W       GE YYY   + E TW+RPE+F E+
Sbjct: 4  LWTTFTAPSGEKYYYNLRTKESTWKRPESFYED 36

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  144 bits (364), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 140/259 (54%), Gaps = 24/259 (9%)

Query: 81  VGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLA 140
           + +++   ++  LF++Y+LN +S+WS QS+ V  DP+FY + D+  R ++FE+WC+ K +
Sbjct: 224 LDFNASKEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHS 283

Query: 141 ---------------KAGGDSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTI 185
                           +G  SSA                  +LEP K+HYLSHI+SK+ I
Sbjct: 284 HHNSITSVDKDDQTDSSGAHSSAE--DNLDDNVADQNEEEENLEPTKYHYLSHIISKANI 341

Query: 186 KPQTVFSDVKTENKLLFKNFNIDE-THPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLD 244
            P T+F D+K +NK LFK F I++    K++   F              +R +IF+ +L+
Sbjct: 342 SPDTIFQDIKKDNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILE 401

Query: 245 TKV----KHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYY 300
                  KH + + D++ + L+     N+ +E E+QL+ +E  +G+  SL +L  D KYY
Sbjct: 402 QNKTAINKHVVEHSDKVLETLNTS--VNEDFEKETQLLKLEDILGLSGSLEKLANDPKYY 459

Query: 301 VVGVRDKTILIKEFLRHMV 319
           ++G++DK   +K +LR++ 
Sbjct: 460 ILGIKDKLECLKNYLRNLT 478

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  122 bits (305), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 126/249 (50%), Gaps = 31/249 (12%)

Query: 79  VRVGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMK 138
           +  G   E   F  LFDRYEL+ +S+WSLQS+K+++DP+FYT+ DD  R   FE+WC  +
Sbjct: 204 IDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCGHE 263

Query: 139 LAKAGGDSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKS-TIKPQTVFSDVKTE 197
            + +   ++A  +G               LEP K+HYL+ I++K+ TI P  V  D++ +
Sbjct: 264 HSDS---AAAEASGSEDVGDV--------LEPTKYHYLAQILAKAGTIPPDAVPQDIRKQ 312

Query: 198 NKLLFKNFNIDETHP-KQEQRQFVXXXXXXXXXXXXXERVEIFKNLLD----------TK 246
            K L+K + I E  P K+EQ +FV             +R EIF++ L             
Sbjct: 313 QKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKS 372

Query: 247 VKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRD 306
           ++ E     Q Q +L+    P D   +E  L+ +E    +      +  D +YYVVG+ D
Sbjct: 373 IRRESGLISQWQAVLE---APADGASVEEVLLNIEYRCNI-----VVAADPRYYVVGILD 424

Query: 307 KTILIKEFL 315
           KT++   +L
Sbjct: 425 KTMVWVRWL 433

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  118 bits (295), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 126/244 (51%), Gaps = 20/244 (8%)

Query: 90  FIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSAS 149
           F  LFDRY+L+ +S+WSLQS+K+++DP+FY + DD  R  LFE+WC        G+ S +
Sbjct: 219 FFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWC--------GERSGN 270

Query: 150 LTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKS-TIKPQTVFSDVKTENKLLFKNFNID 208
            T                LEP K+HYL+ IV+ + TI P T+  D++ + K L+K + I 
Sbjct: 271 ATAEESDSEDNSEDDSEVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIK 330

Query: 209 ETHP-KQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVKHEINNEDQLQQ---ILDQE 264
           E  P K++Q +FV             +R EIF + L    +      + L+Q   ++D+ 
Sbjct: 331 EYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRW 390

Query: 265 N----LPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHMVR 320
                 P D+  IE  L+++E    +   +     + +YYVVG+ +KT++   +L   V 
Sbjct: 391 QTLLKAPADSSSIEDILLSIEHRCCVSPIVVT---EPRYYVVGILEKTVVWVRWLAAEVG 447

Query: 321 STSQ 324
            +S+
Sbjct: 448 PSSR 451

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  115 bits (287), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 113/235 (48%), Gaps = 28/235 (11%)

Query: 85  SEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGG 144
           +E   F  L DRYEL+ +S+WSLQ +K+++DP+FY + D   R  LFE+WC    A A G
Sbjct: 208 NERGLFFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFEEWCASASASASG 267

Query: 145 DSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKN 204
           + S                    LEP KFHYL+ IV+K+ I P  +  D++ + K LFK 
Sbjct: 268 NESED------------EDDADLLEPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFKA 315

Query: 205 FNIDETHP-KQEQRQFVXXXXXXXXXXXXXERVEIFKNLLD----------TKVKHEINN 253
           + I E  P K++Q +FV             +R EIF+  L             ++ ++  
Sbjct: 316 YRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVGL 375

Query: 254 EDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKT 308
             + Q IL       D   +E  L+++E   G+         D +YYV+G+ DKT
Sbjct: 376 ISRWQAIL--RPTAADGASVEDALLSIEHRCGVGAIALA---DPRYYVLGILDKT 425

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  113 bits (282), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 117/230 (50%), Gaps = 15/230 (6%)

Query: 82  GYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAK 141
           G   + A+F+ LFDRY L+ +S WS++  KV  DP+FY + DD+ R +LFE WC+ +   
Sbjct: 182 GLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIH 241

Query: 142 AGGDSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLL 201
           +  D  A   G               LEP KFHYLS IVSKS I+  T+F D+K +NK L
Sbjct: 242 STSDEEAKEGG------EPEEHEERPLEPTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRL 295

Query: 202 FKNFNI-DETHPKQEQRQFVXXXXXXXXXXXXXE-RVEIFKNLLDTKVKHEINNEDQLQQ 259
           FK + I D     +EQ +FV             E R + F + L  K  +  +  D    
Sbjct: 296 FKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSMSD--MN 353

Query: 260 ILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTI 309
            L +    ND Y IE+ L+ +E      +  + +  D++YY++ ++ KTI
Sbjct: 354 TLSEHIKRNDTYAIETTLLQIE-----CNFPQDVLSDVRYYILDLKQKTI 398

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETFEEETV 36
          +WK  +   G+ YYY T + + TWE+PE  + E +
Sbjct: 4  IWKEYRAPNGKKYYYNTETKKTTWEKPEAAKREEI 38

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  109 bits (272), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 115/242 (47%), Gaps = 34/242 (14%)

Query: 86  EHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGD 145
           E + F  L DRY+L+ +S+WSLQS+K+++DPEFY + DD  R  LFE+WC    AK    
Sbjct: 218 ERSLFFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDS 277

Query: 146 SSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKS-TIKPQTVFSDVKTENKLLFKN 204
              S                  LEP K+HYL+ IV+K+  I P  +  D++   K L+K 
Sbjct: 278 EDES----------------NVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKA 321

Query: 205 FNIDETHP-KQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVKHEINNEDQLQQILDQ 263
           + I E  P K+EQ +FV             +R  IF++ L     HE +    +  +   
Sbjct: 322 YRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCL---WDHERDFGGAIASLRQD 378

Query: 264 ENL----------PNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKE 313
             L          P D   IE  L+++E    +      +  D +YYVVG+ +KT++   
Sbjct: 379 NKLISRWQALLEDPIDGTSIEDVLLSIENRCCVS---AIVVADPRYYVVGILEKTVVWVR 435

Query: 314 FL 315
           +L
Sbjct: 436 WL 437

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERP 28
          VW+  KT  GE YYY   + +  WE+P
Sbjct: 4  VWQEFKTPTGEKYYYNKTTKQSQWEKP 30

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  108 bits (270), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 105/234 (44%), Gaps = 25/234 (10%)

Query: 84  DSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAG 143
           D+    +  LF  Y L+ YS WS++S K+ +DP F+ + DD  R E+FE+WC   +    
Sbjct: 179 DANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVDDS 238

Query: 144 GDSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFK 203
            D   S                  L P K+HYLS IV+KST+ P T+F D+K E   LFK
Sbjct: 239 EDEGYS-------------SGDDDLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFK 285

Query: 204 NFNIDETHPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVKHEINNEDQLQQILDQ 263
            + I +   K+EQ QFV             ERV++F   +       + +          
Sbjct: 286 QYGIKQFLSKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVPSPTSPADSATP 345

Query: 264 ENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRH 317
           E       +IE+ L+ ME ++        + ++  YY + ++ K  ++   L H
Sbjct: 346 E-------DIETNLLQMESHLP-----PTVLDNTVYYTLDIKTKQSVLHRMLPH 387

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPET 30
          VW+  +   G+ YY+ T +GE TW+ P T
Sbjct: 4  VWREYRAPNGKKYYHNTTTGETTWDSPYT 32

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 114/231 (49%), Gaps = 32/231 (13%)

Query: 90  FIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSAS 149
           + ALF ++ELN YS+W ++S KV  DPEFY ++DD  R  +FE+WC      AG   S  
Sbjct: 208 YFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCN-----AGSVESNE 262

Query: 150 LTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNIDE 209
            +G                EP K+HYLS +V+   +KP T+  +   ++K L K + I +
Sbjct: 263 ESG---------DPGDDQFEPTKYHYLSQLVANYDLKPDTI-PEDIIKDKKLIKKYRIKD 312

Query: 210 THPKQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVKHEINNEDQLQQILDQENLPND 269
              K EQRQF+             +R ++F+  +D     +  + D            +D
Sbjct: 313 YTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIPVGKYTDID------------SD 360

Query: 270 AYE-IESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHMV 319
           A E +ESQL+ +E  +G+  S    + D++YY + +R K  ++   +R+ V
Sbjct: 361 AQEDVESQLLELENQLGIPTS----ENDLEYYCIDLRSKRDILLSTIRNRV 407

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score = 82.4 bits (202), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 110/233 (47%), Gaps = 34/233 (14%)

Query: 89  RFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSA 148
           R   LF+ + L+ YS+WSLQSRK+ +  +++ + DD  R E+FEDWC MK+A+   D S 
Sbjct: 189 RLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPEDESE 248

Query: 149 SLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVS--KSTIKPQTVFSDVKTENKLLFKNFN 206
           +                   EP K+HYLS I+   +  I   TV  D+   ++ LFK ++
Sbjct: 249 AED--------------DDYEPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYH 294

Query: 207 IDETHP-KQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVKHEINNEDQLQQILDQEN 265
           I +  P ++E R  V             ER  +F + +            Q   +L  E+
Sbjct: 295 IKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYV-----------SQRYGLLPGED 343

Query: 266 LPND------AYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIK 312
           + ND        ++E++++  E+      +       ++YYVVG+R+K I ++
Sbjct: 344 VDNDDAGSLSGEQMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYIGLR 396

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 115/250 (46%), Gaps = 37/250 (14%)

Query: 90  FIALFDRYELNPYSSWSLQSRKVQSDPE-FYTLLDDETRRELFEDWCTMKLAKAG----- 143
           F  L D+ +L+ YS+WS+QSR++   P  FY++ +D  R E+FEDWC  ++   G     
Sbjct: 259 FFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTGLYSSN 318

Query: 144 ----GDSSASLTGX---XXXXXXXXXXXXXSLEPVKFHYLSHIVSK--STIKPQTVFSDV 194
                D    + G                  LEP K+HYLS ++ K   +I  +++F D+
Sbjct: 319 VKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSIFQDI 378

Query: 195 KTENKLLFKNFNIDETHP-KQEQRQFVXXXXXXXXXXXXXERVEIFKNLLDTKVKHEIN- 252
           K + K LFK++ I +  P K+E  + V             ER + F+  +      +I  
Sbjct: 379 KRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVTKHYGEKIKL 438

Query: 253 NEDQLQQILDQENLPNDAYE----IESQLITMEKYIGMHDSLRQLQEDI----------- 297
           + ++L +IL+  +  +   E    IE +++ +E  I     LR   + +           
Sbjct: 439 HHEELNKILEPSSSADAEAEADVDIEKEILQIENVI-----LRSGDDHVPVTAAVDTPGL 493

Query: 298 KYYVVGVRDK 307
           +YY++G+R K
Sbjct: 494 EYYIIGLRAK 503

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETF 31
          +WK  KT  G+ YYY   + + TWE+P +F
Sbjct: 11 IWKEYKTPNGKKYYYNIETKQSTWEKPFSF 40

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 18/135 (13%)

Query: 85  SEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGG 144
           ++  +F  L DR  ++ YS W L+++K+  DP FY +  D  R +LFE WC  KL     
Sbjct: 70  NKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGKLHSREE 129

Query: 145 DSSASLTGXXXXXXXXXXXXXXSLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKN 204
           +++                       + +H L+ ++    I+  T++ D++  NK + + 
Sbjct: 130 ETTQPQLAL----------------ALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVR- 172

Query: 205 FNIDETHPKQEQRQF 219
             IDE   K EQ +F
Sbjct: 173 -QIDEKISKNEQEKF 186

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEE 33
          WK AK  +G  YYY TV+ + TWE+P+ F E
Sbjct: 4  WKAAKDPKGRIYYYNTVTKKSTWEKPKNFAE 34

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETF--EEETVMGAVG 41
          +WK AK   G  YYY +++ + TWE+P+    EEE ++   G
Sbjct: 3  IWKEAKDANGRVYYYNSLTKKSTWEKPKELVSEEEQLLRENG 44

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGA 39
          W+ AKT EG+ YYY   + E +W  P  FE++    A
Sbjct: 45 WRAAKTKEGKVYYYNPATRETSWTIP-VFEKKVQTTA 80

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETF--EEETVMGAVG 41
          +WK AK   G  YYY T++ + TWE+P+    +EE ++   G
Sbjct: 3  IWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEELLLRENG 44

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP 28
          WK AKT +G+ YYY   + E +W  P
Sbjct: 45 WKAAKTADGKVYYYNPTTRETSWTIP 70

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 103 SSWSLQSRKVQSDPEFYTLLD-DETRRELFEDWCTMKLAKAGGDSSASLT 151
           S+W L S+++    E+  L D D  RR++FED+     A     ++A+LT
Sbjct: 517 STWDLASKELGESLEYKALGDEDNIRRQIFEDFKPESSAPTAESATANLT 566

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPETF--EEETVMGAVG 41
          +WK AK   G  YYY   +GE  WE+P     E+E ++   G
Sbjct: 6  LWKEAKDTSGRIYYYNAKTGESKWEKPRELLSEQELILAKHG 47

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFE 32
          WK +KT +G+ YYY   +    WE P+  E
Sbjct: 48 WKSSKTSDGKLYYYNAQTKTSRWELPDLPE 77

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 16/26 (61%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP 28
          WK A   EG  YYY   SGE TW++P
Sbjct: 4  WKEANDAEGRVYYYNADSGETTWDKP 29

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 14/58 (24%)

Query: 3   WKRAKTGEGEFYYYETVSGEKTWE--------------RPETFEEETVMGAVGLVKGY 46
           WK  KT EG+ YYY   +G+  WE              RP T +E +   A   ++ Y
Sbjct: 45  WKTGKTDEGQVYYYNQETGKSCWEIPTFEEHGEEEEAERPHTSDERSTTPAQSNIESY 102

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP 28
          WK ++T EG+ YYY +++ E  WE+P
Sbjct: 48 WKSSRTAEGKIYYYNSITKESRWEKP 73

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETF--EEETVMGAVG 41
          WK A   +G  YYY   +GE  WE+P+    EEE V+   G
Sbjct: 7  WKEALDDKGRTYYYNAKNGESRWEKPQELFTEEELVLLKHG 47

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERP 28
          +WK AK   G  YYY + +GE  WE+P
Sbjct: 4  IWKEAKDNNGRVYYYNSKTGESRWEKP 30

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVM 37
          W   K+  G+ YYY T +GE +WE P+ F+E  ++
Sbjct: 46 WSIGKSKAGKIYYYNTKTGESSWELPK-FDEVKII 79

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP 28
          WK AK   G  YYY T++ + TWE+P
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTWEKP 29

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEET 35
          W+ AKT EG+ YYY T + + +W  P  FE++T
Sbjct: 45 WRAAKTAEGKVYYYNTTTRKTSWAIP-IFEKKT 76

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGAVG 41
          W  A+T +G+ YYY + +GE  WE P+ FE+ T   + G
Sbjct: 46 WGVARTKDGKLYYYNSSTGESRWEAPK-FEDATTEVSRG 83

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERP 28
          +W+ AK   G+ YYY T +G   WE+P
Sbjct: 6  LWRTAKDSNGKVYYYNTKTGVSQWEKP 32

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPE 29
          WK AK   G  YYY T++ +  WE+PE
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPE 30

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEET 35
          WK AKT EG+ YYY   + + +W  P  F+++T
Sbjct: 45 WKAAKTAEGKIYYYNPSTRQTSWTIP-AFDKKT 76

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 2  VWKRAKTGEGEFYYYETVSGEKTWERPE 29
           WK AK  +G  YYY T + E TW +P+
Sbjct: 5  TWKEAKDLQGRIYYYNTATSETTWTKPQ 32

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 13/26 (50%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP 28
          WK   T   + YYY   SGE  WE P
Sbjct: 47 WKVGSTAGKQTYYYNEASGESRWELP 72

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP 28
          WK+A    G+ YYY TV+ E  W++P
Sbjct: 5  WKKATDSNGKVYYYNTVTKESRWDKP 30

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP---ETFEEETVMGAV 40
          W  AKT EG+ YYY   + E  W+ P   +  E++T  G +
Sbjct: 46 WNVAKTKEGKVYYYNVKTKESRWDNPLAEKATEKKTKTGQI 86

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPE 29
          WK A T +G  YYY   +GE  WE+PE
Sbjct: 44 WKVATTEDGNVYYYNRETGESRWEKPE 70

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGAVGLVKGY 46
          WK     EG  YYY +  GE TW +P+  E E V+ A+ L +G+
Sbjct: 4  WKETIDPEGRVYYYNS-KGETTWHKPK--EMEVVLDAILLKQGW 44

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGA 39
          WK A T +G+ YYY   + E TWE P   EE+   G 
Sbjct: 44 WKVASTEDGKVYYYNKNTNESTWELPVVREEKKDEGG 80

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP 28
          W  A   EG  YYY + SGE TW++P
Sbjct: 4  WNEAHDPEGRVYYYNSESGETTWDKP 29

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGAV 40
          WK  +T  G+ YYY   SGE  WE P TFE +    AV
Sbjct: 45 WKTGETEGGKLYYYNESSGESRWEVP-TFESDEKEEAV 81

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
          {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPE 29
          W+ AK  +G  YYY  ++ E  WE+P+
Sbjct: 14 WRSAKDAKGRIYYYNLITKESKWEKPK 40

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2.649
           YKL012W
          Length = 606

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 10/49 (20%)

Query: 2   VWKRAKTGEGEFYYYETVSGEKTWERP----------ETFEEETVMGAV 40
            WK AKT +G+ Y+Y + +G+ +W  P          ET   E+  GAV
Sbjct: 65  TWKSAKTKDGKVYFYNSATGKSSWTLPAGVQLEVAPKETATTESPRGAV 113

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {ON}
           Anc_2.649 YKL012W
          Length = 658

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 22/43 (51%)

Query: 3   WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGAVGLVKG 45
           W+ A+T EG  YYY   + E  W+ P   +  ++  A  ++K 
Sbjct: 67  WRTAQTKEGRIYYYNVDTKESRWDPPNLPKNTSLKNADDIIKN 109

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPET 30
          WK+AK  +G  YYY   + E  W+ P++
Sbjct: 5  WKQAKDPKGRVYYYNLKTKESRWDLPKS 32

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEET 35
          W+ AK   G  YYY   + E  W+RP + E  T
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGST 43

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERPETFEEETVMGA 39
          WK   T EG+ YYY   +GE  W+  +   +E +  A
Sbjct: 58 WKSNVTNEGKVYYYNLKTGESRWDVNDLIRQERMKNA 94

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 1  MVWKRAKTGEGEFYYYETVSGEKTWERPE 29
          M W+  K  +G  YYY   +G+ TWE+PE
Sbjct: 1  MSWQETKDPQGRVYYYND-TGQTTWEKPE 28

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 3  WKRAKTGEGEFYYYETVSGEKTWERP 28
          WK A   +G  YYY++ +GE TW  P
Sbjct: 43 WKTALAEDGRVYYYKSDTGETTWNVP 68

>NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {ON}
           Anc_7.21 YAL047C
          Length = 856

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 25/105 (23%)

Query: 237 EIFKNLLDTKVKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGM---------- 286
           +  +N L  K+ ++ N  +Q+QQ + + N  ND  E ESQ+I +EK + +          
Sbjct: 507 QAIENALYEKLSNQFNLLNQIQQYIQESN--NDTGEKESQIIQLEKELNLLEKKLNNEKV 564

Query: 287 -------------HDSLRQLQEDIKYYVVGVRDKTILIKEFLRHM 318
                         D + QL+ DI+Y      D T LI E  +++
Sbjct: 565 NNTKLMNLKEENWQDLIGQLENDIEYLTSNKDDLTSLIDELSKNI 609

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,182,396
Number of extensions: 1187661
Number of successful extensions: 4322
Number of sequences better than 10.0: 49
Number of HSP's gapped: 4393
Number of HSP's successfully gapped: 82
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)