Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_12283.501ON2532539351e-128
Skud_16.4483.501ON2082563522e-40
Smik_16.4063.501ON2122563443e-39
YPR154W (PIN3)3.501ON2152563392e-38
KAFR0G037403.501ON2342823393e-38
Suva_16.4823.501ON2352563333e-37
AFR320W3.501ON2571093319e-37
NDAI0B059203.501ON2351463176e-35
Kwal_47.189053.501ON2361523053e-33
TDEL0D056903.501ON2011432868e-31
KNAG0A079903.501ON2211152862e-30
KLTH0G02332g3.501ON2331112862e-30
Smik_6.2323.501ON2411422838e-30
SAKL0F02486g3.501ON2301192811e-29
YGR136W (LSB1)3.501ON2411082811e-29
Skud_7.4473.501ON2381232783e-29
CAGL0F04829g3.501ON2021082754e-29
TBLA0C045303.501ON2221432712e-28
NCAS0F036003.501ON2371492671e-27
Kpol_480.83.501ON2391112628e-27
TPHA0A057203.501ON2201152573e-26
KNAG0B007503.501ON2171292503e-25
KLLA0E03873g3.501ON2201072321e-22
ZYRO0D09702g3.501ON158762244e-22
ZYRO0G20372gsingletonON150531947e-18
TBLA0D029103.501ON269691728e-14
YHR016C (YSC84)1.356ON468511528e-11
Skud_8.681.356ON475511521e-10
Suva_8.512.502ON456601457e-10
Suva_7.4243.501ON249361429e-10
Smik_8.811.356ON468511449e-10
KNAG0C020401.356ON464511431e-09
NCAS0A089901.356ON434511422e-09
Smik_7.3351.356ON460511422e-09
Suva_15.1991.356ON457511422e-09
YFR024C-A (LSB3)1.356ON459511412e-09
Kwal_0.3711.356ON217511382e-09
TPHA0C040202.502ON485741412e-09
KAFR0C044001.356ON459511413e-09
CAGL0I08965g1.356ON437511403e-09
TBLA0B054702.502ON539501403e-09
TDEL0D022401.356ON433511403e-09
Kpol_1056.372.502ON501591404e-09
Ecym_27471.356ON452701394e-09
KLTH0H12980g1.356ON399511386e-09
NDAI0G059601.356ON423551386e-09
TPHA0O012801.356ON454511386e-09
NCAS0B072501.356ON441511376e-09
TDEL0A027802.502ON451651377e-09
YHL002W (HSE1)2.502ON452611361e-08
SAKL0E02200g2.502ON511601351e-08
Suva_6.961.356ON455511351e-08
Skud_6.1081.356ON459511352e-08
AFR140C5.470ON388531342e-08
NDAI0B045801.356ON424511342e-08
SAKL0D09702g1.356ON428511323e-08
ZYRO0B01298g2.502ON411501323e-08
TBLA0F034901.356ON511511314e-08
KAFR0D033602.502ON455501315e-08
AEL017W1.356ON416501305e-08
KLLA0A08360g1.356ON423511306e-08
Smik_8.472.502ON447601306e-08
Kpol_1008.251.356ON449511306e-08
Skud_8.432.502ON454651297e-08
TBLA0D049501.356ON468511298e-08
TDEL0A033405.470ON473531271e-07
ABR008C2.502ON443501271e-07
SAKL0G03454g5.470ON468551272e-07
NDAI0A043505.470ON459551262e-07
KLTH0D06138g2.502ON489501262e-07
NCAS0A119205.470ON463701262e-07
ZYRO0G00792g1.356ON469511262e-07
KAFR0A009701.356ON396511243e-07
TBLA0A025705.470ON493551243e-07
ZYRO0D11110g5.470ON459551243e-07
Ecym_23165.470ON421541235e-07
CAGL0K02761g2.502ON450501235e-07
Skud_4.6615.470ON460551226e-07
KNAG0C046305.470ON516651226e-07
KNAG0I015801.356ON581531227e-07
TPHA0A022101.356ON397511201e-06
KAFR0E036405.470ON441551201e-06
Kwal_26.79022.502ON532501201e-06
Ecym_23082.591ON678581211e-06
CAGL0M01650g5.470ON466551192e-06
YDR388W (RVS167)5.470ON482551182e-06
KLLA0B13475g2.502ON508501182e-06
TPHA0E015005.470ON457551182e-06
KLTH0F15114g5.470ON435551182e-06
Kwal_55.212875.470ON461551182e-06
Ecym_24402.502ON459501182e-06
Smik_4.6585.470ON472551182e-06
NDAI0K021302.502ON459501163e-06
CAGL0A02145g1.356ON391551154e-06
Kpol_440.105.470ON470551146e-06
NCAS0A050802.502ON450501139e-06
KNAG0A067102.502ON419681102e-05
KLLA0E03059g5.470ON428541102e-05
SAKL0G17600g4.335ON441731075e-05
ABR082W2.591ON683581076e-05
KLLA0D16874g8.344ON227701038e-05
Smik_13.2022.591ON663641041e-04
YLR191W (PEX13)7.365ON386631012e-04
Smik_12.2517.365ON388631013e-04
KLLA0F23848g2.159ON649491004e-04
Skud_12.2567.365ON403631004e-04
Suva_10.2877.365ON39263985e-04
YMR032W (HOF1)2.591ON66964996e-04
KLLA0E19735g7.365ON408105970.001
Skud_13.1882.591ON66968970.001
AGR306C5.170ON92381970.001
Suva_13.2012.591ON66868960.001
ACR266W2.159ON62651960.001
Ecym_25266.366ON52460950.001
KLLA0C12551g2.591ON60759950.001
SAKL0H24222g4.45ON152661960.002
KAFR0L015807.365ON34467940.002
KLLA0E23365g8.539ON57564950.002
Ecym_42288.344ON26172940.002
Suva_2.564singletonON4339840.002
SAKL0H10098g8.539ON55572940.002
ADL288C2.319ON92561940.003
TPHA0B028902.159ON63452930.003
SAKL0B11176g2.591ON63369920.004
Kwal_47.169434.335ON46062910.005
KLLA0E09043g2.319ON81455910.006
KAFR0J026506.366ON55362900.006
KLTH0E09790g2.159ON62252900.007
Smik_8.1922.159ON63352900.007
Skud_8.1752.159ON63352900.008
Kpol_538.255.170ON70766900.008
Ecym_47107.365ON39963890.008
Kwal_47.178942.159ON62152880.011
Suva_2.1184.108ON116653880.014
NDAI0I002206.366ON61559880.014
SAKL0H21912g4.108ON125374880.015
CAGL0A04147g7.365ON39165860.020
Ecym_72314.108ON114665860.022
Kwal_33.148357.365ON38463850.023
SAKL0A00594g6.366ON63651860.024
KLTH0D08580g2.591ON60069860.025
ADL038W4.45ON150970860.026
NCAS0A145707.419ON35553850.027
TBLA0A076107.365ON41365850.029
CAGL0C03597g6.366ON58055850.032
YBL007C (SLA1)4.108ON124453850.033
TDEL0C018207.365ON38963840.036
Kpol_457.12singletonON56751840.038
KLLA0D09306g4.45ON153772850.038
Kwal_26.83232.591ON62774840.041
Kpol_325.126.366ON57050840.042
NCAS0D019505.170ON93957840.043
KLTH0B04818g7.365ON38063830.045
Skud_2.1044.108ON121453840.047
Ecym_33662.319ON90660830.050
Kpol_1072.562.159ON63752830.052
AGR170C4.108ON112163830.053
KNAG0C029104.108ON124456830.054
KLTH0H09416g4.45ON152870830.054
KNAG0H035002.159ON63452830.056
Ecym_54262.159ON67251830.058
Suva_15.3102.159ON63452820.063
CAGL0F05885g2.591ON71275820.064
TDEL0A078106.366ON55850820.067
KNAG0I027006.366ON57550820.067
ACR230C7.365ON39863820.068
NDAI0A033304.108ON122658820.070
ZYRO0D17358g6.366ON66850820.073
NCAS0A059704.45ON132362820.077
TBLA0F002806.366ON57651810.083
CAGL0E02783g4.108ON120352820.086
Kwal_23.64376.366ON63140810.086
Kpol_534.62.319ON88653810.087
TBLA0C055602.159ON67358810.092
TBLA0H011608.344ON22453790.099
SAKL0E10780g2.159ON62553810.099
TDEL0E055204.45ON158959810.10
Smik_3.1866.366ON59153810.11
KLLA0E06953g7.419ON35754800.11
AGL237C6.366ON57851800.12
Skud_3.1606.366ON58653800.12
YHR114W (BZZ1)2.159ON63369800.12
NDAI0D029404.45ON171768800.13
NDAI0E043907.365ON44570800.13
AGL169C8.344ON25276790.13
KLTH0G11682g8.344ON18770780.13
TPHA0F003804.45ON161858800.14
Suva_3.1246.366ON60053790.15
KLTH0A07348g6.366ON62644790.15
NCAS0E027907.365ON37963780.17
YCR088W (ABP1)6.366ON59253790.18
TBLA0H027902.591ON58365780.20
Smik_2.1134.108ON123050780.22
NCAS0B022208.539ON55460780.22
YLL017WsingletonOFF10338730.23
Kpol_1026.324.45ON130251780.24
Ecym_11678.539ON55051770.29
AEL241W8.539ON54955770.31
ZYRO0B16214g2.159ON65948770.33
NDAI0A014707.419ON36757760.34
CAGL0I02750g2.159ON61951760.38
KAFR0F007502.159ON60252760.43
NCAS0B069802.159ON63949750.45
NCAS0D047406.366ON59450750.47
Ecym_11474.335ON42256750.48
NCAS0B033608.344ON23361740.48
TBLA0C041004.108ON130258760.49
NCAS0A034904.108ON123558750.52
Kpol_1030.457.365ON38863740.57
TPHA0F031007.365ON38160730.70
KNAG0B025207.365ON31464730.71
Kwal_53.194498.344ON19960720.79
KNAG0B050005.170ON85553740.80
ZYRO0B02706g7.365ON39663730.83
TPHA0K006807.419ON35552730.89
TPHA0H023806.366ON52850730.96
SAKL0H15048g8.344ON20750711.1
NDAI0E040507.413ON97250721.2
Kpol_2000.28.344ON22553711.2
Kwal_33.153395.170ON118469721.2
ZYRO0F13882g8.344ON28884711.2
NDAI0B043202.159ON63280721.2
ZYRO0B00506g4.45ON161043721.3
KAFR0K020007.419ON33259711.3
Kpol_1025.404.108ON120260721.3
KAFR0I010404.108ON120361721.3
KLLA0F14575g5.170ON85155711.5
Ecym_82195.170ON102478711.6
ZYRO0G10098g4.108ON139261711.9
TBLA0C064405.170ON131460702.1
Ecym_71347.419ON33252692.3
Kwal_27.120278.539ON49955692.6
KLLA0A04983g4.108ON125155692.7
TPHA0C026102.591ON67063693.0
KLTH0E12518g8.539ON55259693.0
TPHA0K016004.108ON113660693.1
KLLA0F10175g6.366ON57650683.7
NDAI0J008508.344ON24562664.3
AGL286C7.419ON33052674.8
Kpol_414.14.45ON154843675.3
Kwal_27.107077.419ON34352665.5
Scer_YGOB_SDC25 (SDC25)4.45ON125267675.9
CAGL0E01045g8.344ON21362655.9
TBLA0I010507.419ON37152665.9
Kpol_1045.277.413ON88057666.5
KLTH0C06028g7.419ON34252656.7
Kpol_1045.217.419ON35852657.1
Kpol_1064.152.591ON64664667.2
Suva_10.4064.45ON158746658.7
TDEL0B052202.159ON61352659.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1228
         (253 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   364   e-128
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   140   2e-40
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   137   3e-39
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   135   2e-38
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   135   3e-38
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   132   3e-37
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   132   9e-37
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   126   6e-35
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   122   3e-33
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   114   8e-31
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   114   2e-30
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   114   2e-30
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   113   8e-30
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   112   1e-29
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   112   1e-29
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   111   3e-29
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   110   4e-29
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   108   2e-28
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   107   1e-27
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   105   8e-27
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   103   3e-26
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   100   3e-25
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...    94   1e-22
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...    91   4e-22
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    79   7e-18
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    71   8e-14
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    63   8e-11
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    63   1e-10
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    60   7e-10
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...    59   9e-10
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    60   9e-10
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    60   1e-09
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    59   2e-09
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    59   2e-09
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    59   2e-09
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    59   2e-09
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    58   2e-09
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    59   2e-09
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    59   3e-09
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    59   3e-09
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    59   3e-09
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    59   3e-09
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    59   4e-09
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    58   4e-09
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    58   6e-09
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    58   6e-09
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    58   6e-09
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    57   6e-09
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    57   7e-09
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    57   1e-08
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    57   1e-08
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    57   1e-08
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    57   2e-08
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    56   2e-08
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    56   2e-08
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    55   3e-08
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    55   3e-08
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    55   4e-08
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    55   5e-08
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    55   5e-08
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    55   6e-08
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    55   6e-08
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    55   6e-08
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    54   7e-08
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    54   8e-08
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    54   1e-07
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    54   1e-07
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    54   2e-07
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    53   2e-07
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    53   2e-07
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    53   2e-07
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    53   2e-07
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    52   3e-07
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    52   3e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    52   3e-07
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    52   5e-07
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    52   5e-07
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    52   6e-07
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    52   6e-07
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    52   7e-07
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    51   1e-06
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    51   1e-06
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    51   1e-06
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    51   1e-06
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    50   2e-06
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    50   2e-06
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    50   2e-06
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    50   2e-06
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    50   2e-06
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    50   2e-06
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    50   2e-06
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    50   2e-06
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    49   3e-06
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    49   4e-06
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    49   6e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    48   9e-06
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    47   2e-05
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    47   2e-05
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    46   5e-05
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    46   6e-05
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    44   8e-05
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    45   1e-04
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    44   2e-04
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    44   3e-04
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    43   4e-04
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    43   4e-04
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    42   5e-04
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    43   6e-04
KLLA0E19735g Chr5 complement(1756682..1757908) [1227 bp, 408 aa]...    42   0.001
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    42   0.001
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    42   0.001
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    42   0.001
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    42   0.001
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    41   0.001
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    41   0.001
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    42   0.002
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    41   0.002
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    41   0.002
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    41   0.002
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    37   0.002
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    41   0.002
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    41   0.003
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    40   0.003
SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} simila...    40   0.004
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    40   0.005
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    40   0.006
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    39   0.006
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    39   0.007
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    39   0.007
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    39   0.008
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    39   0.008
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    39   0.008
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    39   0.011
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    39   0.014
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    39   0.014
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    39   0.015
CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {...    38   0.020
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    38   0.022
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    37   0.023
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    38   0.024
KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} simila...    38   0.025
ADL038W Chr4 (623309..627838) [4530 bp, 1509 aa] {ON} Syntenic h...    38   0.026
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    37   0.027
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    37   0.029
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    37   0.032
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    37   0.033
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    37   0.036
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    37   0.038
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    37   0.038
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    37   0.041
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    37   0.042
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     37   0.043
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    37   0.045
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    37   0.047
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    37   0.050
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    37   0.052
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    37   0.053
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    37   0.054
KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} simil...    37   0.054
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    37   0.056
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    37   0.058
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    36   0.063
CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} simila...    36   0.064
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    36   0.067
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    36   0.067
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    36   0.068
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    36   0.070
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    36   0.073
NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]...    36   0.077
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    36   0.083
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    36   0.086
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    36   0.086
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    36   0.087
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    36   0.092
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    35   0.099
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    36   0.099
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    36   0.10 
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    36   0.11 
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    35   0.11 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    35   0.12 
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    35   0.12 
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    35   0.12 
NDAI0D02940 Chr4 complement(691155..696308) [5154 bp, 1717 aa] {...    35   0.13 
NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.3...    35   0.13 
AGL169C Chr7 complement(381327..382085) [759 bp, 252 aa] {ON} Sy...    35   0.13 
KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly ...    35   0.13 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    35   0.14 
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    35   0.15 
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    35   0.15 
NCAS0E02790 Chr5 (551328..552467) [1140 bp, 379 aa] {ON} Anc_7.3...    35   0.17 
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    35   0.18 
TBLA0H02790 Chr8 (653275..655026) [1752 bp, 583 aa] {ON} Anc_2.5...    35   0.20 
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    35   0.22 
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     35   0.22 
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    33   0.23 
Kpol_1026.32 s1026 complement(75177..79085) [3909 bp, 1302 aa] {...    35   0.24 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    34   0.29 
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    34   0.31 
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    34   0.33 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    34   0.34 
CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {...    34   0.38 
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    34   0.43 
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    33   0.45 
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    33   0.47 
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    33   0.48 
NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.34...    33   0.48 
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    34   0.49 
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    33   0.52 
Kpol_1030.45 s1030 (102192..103358) [1167 bp, 388 aa] {ON} (1021...    33   0.57 
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    33   0.70 
KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.36...    33   0.71 
Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2)...    32   0.79 
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    33   0.80 
ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {...    33   0.83 
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    33   0.89 
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    33   0.96 
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    32   1.1  
NDAI0E04050 Chr5 complement(903302..906220) [2919 bp, 972 aa] {O...    32   1.2  
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    32   1.2  
Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa...    32   1.2  
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    32   1.2  
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    32   1.2  
ZYRO0B00506g Chr2 complement(31949..36781) [4833 bp, 1610 aa] {O...    32   1.3  
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    32   1.3  
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    32   1.3  
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    32   1.3  
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    32   1.5  
Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar ...    32   1.6  
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    32   1.9  
TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON} Anc_...    32   2.1  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    31   2.3  
Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]...    31   2.6  
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    31   2.7  
TPHA0C02610 Chr3 complement(577049..579061) [2013 bp, 670 aa] {O...    31   3.0  
KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369) ...    31   3.0  
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    31   3.1  
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    31   3.7  
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    30   4.3  
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    30   4.8  
Kpol_414.1 s414 (1989..6635) [4647 bp, 1548 aa] {ON} (1989..6635...    30   5.3  
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    30   5.5  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    30   5.9  
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    30   5.9  
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    30   5.9  
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    30   6.5  
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    30   6.7  
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    30   7.1  
Kpol_1064.15 s1064 (28183..30123) [1941 bp, 646 aa] {ON} (28183....    30   7.2  
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    30   8.7  
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    30   9.0  

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  364 bits (935), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 190/253 (75%), Positives = 190/253 (75%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVLKEYVEA 60
           MSSSLINRSLANIKTELEFLVESNV              NPREGTMKAASQQVLKEYVEA
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGTMKAASQQVLKEYVEA 60

Query: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGGRFD 120
           LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGGRFD
Sbjct: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGGRFD 120

Query: 121 EPPPQYSLMVQDTAHSSSSNHSQLXXXXXXXXXXXXXXXXSLPPAASSYYQQQQIPMPLG 180
           EPPPQYSLMVQDTAHSSSSNHSQL                SLPPAASSYYQQQQIPMPLG
Sbjct: 121 EPPPQYSLMVQDTAHSSSSNHSQLPPAPPAPIGGGYYQQPSLPPAASSYYQQQQIPMPLG 180

Query: 181 SSSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSGGSDIFKKFGSKLGNAAVFGA 240
           SSSY                                 SSGGSDIFKKFGSKLGNAAVFGA
Sbjct: 181 SSSYQQNPAPPVQYQQPVAQPVVQQAAPQAVEQAQGQSSGGSDIFKKFGSKLGNAAVFGA 240

Query: 241 GATMGSELVHHIF 253
           GATMGSELVHHIF
Sbjct: 241 GATMGSELVHHIF 253

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  140 bits (352), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 123/256 (48%), Gaps = 51/256 (19%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX---XXNPREGTMKAASQQVLKEY 57
           MS+SLINRSL  I+TEL+FL ESNV                 NP       +S  +  EY
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASL--EY 58

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGG 117
           VEALY F PQQ GDL  K GDK+++LEK S +WYKG  NGRVG+FP+NYVK   +  NG 
Sbjct: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNGS 118

Query: 118 RFDEPPPQYSLMVQDTAHSSSSNHSQLXXXXXXXXXXXXXXXXSLPPAASSYYQQQQIPM 177
               PPPQY    Q+   + + N                        +A S YQQQ  P 
Sbjct: 119 SNLPPPPQYK--AQELQQAPTQN------------------------SAVSSYQQQPFPP 152

Query: 178 PLGSSSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSGGSDIFKKFGSKLGNAAV 237
           P  S++Y                                      +  K FGSKLGNAA+
Sbjct: 153 P--STNY------------------YQQPQQQPQQAPPQQQPSSHNHLKSFGSKLGNAAI 192

Query: 238 FGAGATMGSELVHHIF 253
           FGAGA++GS++V+ IF
Sbjct: 193 FGAGASIGSDIVNSIF 208

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  137 bits (344), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 123/256 (48%), Gaps = 47/256 (18%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX---XXNPREGTMKAASQQVLKEY 57
           MS+SLINRSL NI+TEL+FL ESNV                 +P   +   +S  +  EY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSL--EY 58

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGG 117
           VEALY F PQQ GDL  K GDKI++LEK S +WYKG  NGR G+FP+NYVK   +  NG 
Sbjct: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQ 118

Query: 118 RFDEPPPQYSLMVQDTAHSSSSNHSQLXXXXXXXXXXXXXXXXSLPPAASSYYQQQQIPM 177
               PPPQY    Q+     + N                        +A S YQQQ  P 
Sbjct: 119 SNLPPPPQYK--AQELQPVPTQN------------------------SAVSSYQQQPFPP 152

Query: 178 PLGSSSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSGGSDIFKKFGSKLGNAAV 237
           P  S++Y                                      +  K FGSKLGNAA+
Sbjct: 153 P--STNY--------------YQQPQQAPAPAPQQQQQQQQPNSHNHLKSFGSKLGNAAI 196

Query: 238 FGAGATMGSELVHHIF 253
           FGAGA++GS++V+ IF
Sbjct: 197 FGAGASIGSDIVNSIF 212

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  135 bits (339), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 122/256 (47%), Gaps = 44/256 (17%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXX---XXXXXXXXXXNPREGTMKAASQQVLKEY 57
           MS+SLINRSL NI+TEL+FL  SNV                 +P      A+   +  EY
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASL--EY 58

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGG 117
           VEALY F PQQ GDL  K GDK+++LEK S +WYKG  NGR G+FP+NYVK   +  NG 
Sbjct: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGP 118

Query: 118 RFDEPPPQYSLMVQDTAHSSSSNHSQLXXXXXXXXXXXXXXXXSLPPAASSYYQQQQIPM 177
               PPPQY    Q+     + N                        +A+S YQQQ  P 
Sbjct: 119 SNLPPPPQYK--AQELQQIPTQN------------------------SAASSYQQQPFPP 152

Query: 178 PLGSSSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSGGSDIFKKFGSKLGNAAV 237
           P  S++Y                                         K FGSKLGNAA+
Sbjct: 153 P--STNYYQQPQQQPQQAPPPQQQQQQQQHQSSHSH-----------LKSFGSKLGNAAI 199

Query: 238 FGAGATMGSELVHHIF 253
           FGAGA++GS++V++IF
Sbjct: 200 FGAGASIGSDIVNNIF 215

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  135 bits (339), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 123/282 (43%), Gaps = 77/282 (27%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAAS-------QQV 53
           MSS+LINR++ NIKTEL+FL ES +                 + + K A        Q V
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 54  LK----------------------EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWY 91
                                   EYVEALYAF PQQ GDL    GDK+++LEKPSA+WY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 92  KGQHNGRVGMFPSNYVKSLRTLPNGGRFDEPPPQYSLMVQDTAHSSSSNHSQLXXXXXXX 151
           KG  NG++GMFP+NYVK +        F  PPPQY           S+N+ Q        
Sbjct: 121 KGTCNGQIGMFPANYVKPV----TKDSFAPPPPQY--------QQYSNNYQQ-------- 160

Query: 152 XXXXXXXXXSLPPAASSYYQQQQIPMPLGSSSYXXXXXXXXXXXXXXXXXXXXXXXXXXX 211
                    + PPA++ YY                                         
Sbjct: 161 ---PSYSQPAYPPASTGYY-------------------------QQPQQVQVQQPQQVQV 192

Query: 212 XXXXXXSSGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253
                  S  ++  K+FGSKLGNAA+FGAGAT+GS+LV+ IF
Sbjct: 193 QQQPQQQSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  132 bits (333), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 122/256 (47%), Gaps = 42/256 (16%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX---XXNPREGTMKAASQQVLKEY 57
           MS+SL+NRSL NI+TEL+FL ESNV                 +P      + S  +  EY
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSASL--EY 76

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGG 117
           VEA+Y F PQQ GDL  K GDK+++LEK S +WYKG  NGR G+FP+NYVK + +  +G 
Sbjct: 77  VEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDGQ 136

Query: 118 RFDEPPPQYSLMVQDTAHSSSSNHSQLXXXXXXXXXXXXXXXXSLPPAASSYYQQQQIPM 177
               PPPQY         + +SN S                    PP +++YYQQ     
Sbjct: 137 HRLPPPPQYKAQELQQIPTQNSNVSSY-------------QPQPFPPPSTNYYQQPL--- 180

Query: 178 PLGSSSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSGGSDIFKKFGSKLGNAAV 237
                                                    S  ++  K FGSKLGNAA+
Sbjct: 181 ---------------------QQPQLQPQQPPPPQQQQQQQSSSNNHLKSFGSKLGNAAI 219

Query: 238 FGAGATMGSELVHHIF 253
           FGAGA++GS++V+ IF
Sbjct: 220 FGAGASIGSDIVNSIF 235

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  132 bits (331), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 77/109 (70%), Gaps = 1/109 (0%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKA-ASQQVLKEYVE 59
           MSS+LINRSLA I+TEL FLV+S V              NP E    A A+     EYVE
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           ALYAF  QQPGDL+FKVG+KIEVLEKPS +WYKG+ NG+VGMFPSNYVK
Sbjct: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (85%)

Query: 219 SGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           SG S   KKFGSKLGNAA+FGAGAT+GS+LVH IF
Sbjct: 223 SGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  126 bits (317), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 71/146 (48%), Positives = 89/146 (60%), Gaps = 6/146 (4%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX---XXNPREGTMKAASQQVLKEY 57
           MS+SLINRSL NI+TEL+FL ESNV                 +P       +SQ    EY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK---SLRTLP 114
           VEA+Y F PQQ GDL  K GDKI+V+EKPS +W+KG+ NG+VG+FPSNYV+   S  + P
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120

Query: 115 NGGRFDEPPPQYSLMVQDTAHSSSSN 140
           +  R    PPQY   V+  +  SSSN
Sbjct: 121 SKTRLTPGPPQYQASVETQSIHSSSN 146

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 27/29 (93%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
            KKFGSKLGNAA+FGAGAT+GS++V+ IF
Sbjct: 207 LKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  122 bits (305), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 93/152 (61%), Gaps = 11/152 (7%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXX---XXXXXXNPREGTMKAASQQVLKEY 57
           MS+S INRSL+ ++TELEFL ESNV                  P   T    S Q   E+
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQ--SEF 58

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGG 117
           VEA+YAF  QQ GDL  +VGDKIEVLEKPS +WYKG+ NGRVGMFPSNYVK   +  N  
Sbjct: 59  VEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNAS 118

Query: 118 --RFDEP-PPQY---SLMVQDTAHSSSSNHSQ 143
             R + P PP+Y    ++ Q T  S++SN+SQ
Sbjct: 119 LERPNVPAPPEYQSQQIVPQATNTSANSNYSQ 150

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 27/29 (93%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           FKKFG KLGNAA+FGAGAT+GS++V+ IF
Sbjct: 208 FKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  114 bits (286), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 84/143 (58%), Gaps = 9/143 (6%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVLKEYVEA 60
           MS+S INRSLA ++TEL+FL ESNV               P+  + K        EY+EA
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSL--PQNASNKGG------EYMEA 52

Query: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGGRFD 120
           LY F PQQ GDL    GDKIEVLEKPS +W+KG+ NGRVGMFP+NYVK+  +  +     
Sbjct: 53  LYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPSV- 111

Query: 121 EPPPQYSLMVQDTAHSSSSNHSQ 143
            PPPQY    +     SS ++ Q
Sbjct: 112 PPPPQYEQAQRTNTGQSSGSYQQ 134

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/29 (82%), Positives = 27/29 (93%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
            KKFGSKLGNAA+FGAGATMGS+LV+ IF
Sbjct: 173 LKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  114 bits (286), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 75/115 (65%), Gaps = 7/115 (6%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX---XXNPRE----GTMKAASQQV 53
           MS+SLINRSL N++TEL+FL ES V                 +P +     +  ++    
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 54  LKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
             EYVEALYAF PQQ GDLE + GDKI+VLEKPSA+WYKG+  G+VGMFPSNYVK
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVK 115

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/31 (70%), Positives = 29/31 (93%)

Query: 223 DIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           + FKKFGS+LGNAA+FGAGAT+GS++V+ IF
Sbjct: 191 NAFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  114 bits (286), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (67%), Gaps = 5/111 (4%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX---XXNPREGTMKAASQQVLKEY 57
           MS+S INRSL+ ++TELEFL ES+V                 +P  G  + ++ Q   E+
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQ--GEF 58

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           VEA+YAF  QQ GDL  +VGDK+EVLEKPS +W+KG+ NGRVGMFPSNYVK
Sbjct: 59  VEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVK 109

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%)

Query: 218 SSGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           SS  S  FKKFG KLGNAAVFGAGAT+GS++V+ IF
Sbjct: 198 SSQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  113 bits (283), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 79/142 (55%), Gaps = 12/142 (8%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVLKEYVEA 60
           MS++L+NRSL NI+ ELEFL ESNV                     ++ +    +EYVEA
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60

Query: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK-----SLRTLPN 115
           LY F  QQ GDL  K GDKI+VLEK S DWYKG+ N RVG+FP+NYVK     S+ T P 
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120

Query: 116 GG-------RFDEPPPQYSLMV 130
            G       R   PPP Y   V
Sbjct: 121 EGDLSSKVSRPSVPPPSYEPAV 142

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/29 (68%), Positives = 26/29 (89%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           FK FGSKLGNAA+FGAG+ +GS++V+ IF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  112 bits (281), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (63%), Gaps = 5/119 (4%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX---XXNPREGTMKAASQQVLKEY 57
           MS+SLINRSL  I+TEL+FL ES V                 +P     +++S  +  EY
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSL--EY 58

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNG 116
           VEA+YAF  QQ GDL  K GDKI+VLEKPS++WYKG+ NG VGMFPSNYVK   +  NG
Sbjct: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNG 117

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 30/33 (90%)

Query: 221 GSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           GS  FKKFGSKLGNAA+FGAGAT+GS++V+ IF
Sbjct: 198 GSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  112 bits (281), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 55/108 (50%), Positives = 69/108 (63%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVLKEYVEA 60
           MS+SL+NRSL NI+ ELEFL ESNV                 +G  ++      +EYVEA
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60

Query: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           LY F  QQ GDL  K GDKI+VLEK S DWY+G+ N ++G+FP+NYVK
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/36 (66%), Positives = 30/36 (83%)

Query: 218 SSGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           SSG S  FK FGSKLGNAA+FGAG+ +GS++V+ IF
Sbjct: 206 SSGASSAFKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  111 bits (278), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 74/123 (60%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVLKEYVEA 60
           MS+SLINRSL NI+ ELEFL ESNV                 +   K+A+    +EYVEA
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNASTEEYVEA 60

Query: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGGRFD 120
           LY F  QQ GDL  K GDKI++LEK S DWYKG+ N  +G+FP+NYVK   T      F+
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRSTSPDFE 120

Query: 121 EPP 123
           + P
Sbjct: 121 KTP 123

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/29 (65%), Positives = 27/29 (93%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           FK FGSKLG+AA+FGAG+T+GS++++ IF
Sbjct: 210 FKSFGSKLGDAAIFGAGSTIGSDIINSIF 238

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  110 bits (275), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 60/108 (55%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVLKEYVEA 60
           MS S INRSL NI+ EL+FL ESNV               P  G         L EYVEA
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKL--PSNGASPVPPPMSL-EYVEA 57

Query: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           LY F PQQ GDL  + GDKI+VLEKPSA+WY+G  NGR GMFPSNYV+
Sbjct: 58  LYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 26/29 (89%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
            K FGSKLGNAA+FGAGAT+GS+LV+ IF
Sbjct: 174 LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  108 bits (271), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 83/143 (58%), Gaps = 11/143 (7%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVL----KE 56
           MSSSLIN+SL+ I TEL+FL++SN                PR      + QQ      +E
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLL--PRRAPEVPSRQQSNSSKNEE 58

Query: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNG 116
           +VEA+Y F PQQ GDL+   GDKI V EKPS +W+KG+ NG+VG+FPSNYV+   +  N 
Sbjct: 59  WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNN 118

Query: 117 --GRFDEPPPQYSLMVQDTAHSS 137
              R D  PPQY    QD  H S
Sbjct: 119 EKSRSDAAPPQYQ---QDDHHIS 138

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 26/29 (89%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
            K FGSKLGNAA+FGAGAT+GS+LV+ IF
Sbjct: 194 LKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  107 bits (267), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 89/149 (59%), Gaps = 16/149 (10%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX---XXNP---REGTMKAAS---- 50
           MS+S INRSLA I+TEL+FL ESNV                 +P   R  ++ +++    
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 51  QQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSL 110
           Q    E+VEA+Y F PQQ GDL  K GDKIEV+EKPS +W+KG+ NG+ GMFPSNYVK  
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 111 RTLPNG--GRFDEP--PPQY--SLMVQDT 133
            +  +G   +   P  PPQY  SL  Q++
Sbjct: 121 FSGSSGSVNKVARPNGPPQYQNSLQTQNS 149

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 27/29 (93%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
            KKFGSKLGNAA+FGAGAT+GS++V+ IF
Sbjct: 209 LKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  105 bits (262), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXX---XXXNPREGTMKAASQQVLKEY 57
           MSS+ INRSL ++KTELEFL +SNV                 +P   ++   +     EY
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           VEA+Y F PQQ GDL  + GDKI+VLEK S +WYKG+ NG+VG+FPSNYVK
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVK 111

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           FK FGSKLGNAA+FGAGAT+GS+LV+ IF
Sbjct: 211 FKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  103 bits (257), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 65/115 (56%), Gaps = 7/115 (6%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXX-------XXNPREGTMKAASQQV 53
           MS+SLINRSL  I+TELEFL ES V                      P   +        
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 54  LKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
             EYVEA+Y F PQQ GDL  + GDKI+VLEK S +WYKG  NG+VG+FPSNY K
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTK 115

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (89%)

Query: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253
            K FGSKLGNAA+FGAGAT+GS++V+ IF
Sbjct: 192 LKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  100 bits (250), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 5/129 (3%)

Query: 1   MSSSLINRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVLK----E 56
           MS   +NRS+ NI+TELE+L+ES V              +  +G     + +       E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLR-TLPN 115
           YVEA++ + PQ+  DLE +VGDK+E+LEK SADWY+G++ G+VG+FPSNYVK+++ +  +
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120

Query: 116 GGRFDEPPP 124
              F + PP
Sbjct: 121 DAMFQDIPP 129

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 4/35 (11%)

Query: 218 SSGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHI 252
           S  G ++ K+FG    N+ VFGAG  +GS++V+ I
Sbjct: 183 SGAGKNLLKQFG----NSIVFGAGQRIGSDIVNGI 213

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score = 94.0 bits (232), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 63/107 (58%)

Query: 6   INRSLANIKTELEFLVESNVXXXXXXXXXXXXXXNPREGTMKAASQQVLKEYVEALYAFV 65
           +  S+A IK+EL++L E                   R     A +     E VEALYAF 
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQPPVADTMGQNNEIVEALYAFQ 63

Query: 66  PQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRT 112
           PQQ GDL  K GDKIE+LEK S +WYKG+ NG+VG+FPSNYVKS+ T
Sbjct: 64  PQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVKSVDT 110

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/33 (78%), Positives = 30/33 (90%)

Query: 221 GSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           GS  FKKFGSKLGNAA+FGAGAT+GS+LV+ IF
Sbjct: 188 GSAAFKKFGSKLGNAAIFGAGATIGSDLVNSIF 220

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score = 90.9 bits (224), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 46/76 (60%), Positives = 53/76 (69%), Gaps = 8/76 (10%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPN 115
           E+VEA+Y F PQQ GDL    GDKIEVLEKPS +W++G+ NGRVGMFPSNYVK   +   
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFS--- 60

Query: 116 GGRFDE----PPPQYS 127
            G FD     PPPQY 
Sbjct: 61  -GGFDRPAAPPPPQYD 75

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/27 (77%), Positives = 26/27 (96%)

Query: 227 KFGSKLGNAAVFGAGATMGSELVHHIF 253
           KFGSKLGNAA+FGAGAT+GS+L++ IF
Sbjct: 132 KFGSKLGNAAIFGAGATLGSDLINSIF 158

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 79.3 bits (194), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 36/53 (67%), Positives = 41/53 (77%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           EYVE LY F PQ   DL  K GDK+EV+EK SADWYKG+ NG+ GMFP+NYVK
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVK 67

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%)

Query: 227 KFGSKLGNAAVFGAGATMGSELVHHIF 253
           K GSKLGNAA+FG GAT+G++LV  IF
Sbjct: 124 KVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 40  NPREGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRV 99
           NP +G   A S +   +YVEA+YA+  +Q GDLE   GD IEV+ K S  WY+G+ NG+V
Sbjct: 56  NPTKG---ALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKV 112

Query: 100 GMFPSNYVK 108
           G+FP+NYVK
Sbjct: 113 GVFPTNYVK 121

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 20/23 (86%)

Query: 231 KLGNAAVFGAGATMGSELVHHIF 253
           KLGNAA+FGAG+  G+++V+ IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  +QPGDL FK GD I +L+K  +  DW+ G+ NG+ G+FP+NYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  +QPGDL FK GD I +L+K  +  DW+ G+ NG+ G+FP+NYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 37/60 (61%)

Query: 48  AASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           AAS Q +   V A+Y     +P +L F+ GD I VLE+   DW+KG   GR+G+FP NYV
Sbjct: 216 AASGQSVVRRVRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYV 275

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%)

Query: 218 SSGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253
           SSG S  FK FGSKLGNAA+FGAG+T+GS++VH IF
Sbjct: 214 SSGASSAFKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  +Q GDL FK GD I +L+K  +  DW+ G+ NG+ G+FP+NYV+
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL F+ GD I VL+K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  +Q GDL F+ GDKI +L++  +  DW+ G+ NG+ G+FP+NYV+
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVE 432

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL F+ GD I +L+K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  +Q GDL FK GD I +L+K  +  DW+ G+ NG+ G+FP+NYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL F+ GD I +L+K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  +Q GDL F+ GD I +L+K  +  DW+ G++NG+ G+FP+NYV+
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGG 117
           V A+Y  + Q+  +L F+ GD I VLE+   DW++G  +G++G+FP NYV  +  L N  
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELSNED 293

Query: 118 RFDEPPPQYSLMVQ 131
              E   + +++ Q
Sbjct: 294 IIKENQQENNILSQ 307

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL F+ GD I +L+K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 457

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL F+ GD I +++K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVE 435

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V A+Y     +PG+L FK GD I+V+E+   DW++G   G VG+FP NYV
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYV 294

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL F+ GD I +L+K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 381 ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (57%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNG 116
           V A+Y     +P +L FK GD I VLE+   DW+KG   G +G+FP NYV  +  L N 
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISDLSNA 298

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 12/70 (17%)

Query: 41  PREGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGR 98
           P  GT KA           ALY F  +Q GDL F+ GD I +L+K ++  DW+ G+ NG+
Sbjct: 391 PSSGTPKAV----------ALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQ 440

Query: 99  VGMFPSNYVK 108
            G+FP+NYV+
Sbjct: 441 EGIFPANYVE 450

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  +Q GDL F+ GD I +L+K  +  DW+ G++NG+ G+FP+NYV+
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 397

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           E V ALY FV +Q GDL FK GD I V++K  +  DW+ G+   + G+FP+NYV+
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  ++ GDL FK GD I +L+K  +  DW+ G+ NG+ G+FP+NYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL F+ GD I +L+K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 43  EGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMF 102
           +G  K+++  V+++ V A+Y    ++P +L F+ GD I VLE+   DW++G   G+VG+F
Sbjct: 214 QGEAKSSAPAVIRK-VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIF 272

Query: 103 PSNYV 107
           P NYV
Sbjct: 273 PLNYV 277

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 47  KAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNY 106
           K  +Q V++  V ALY     +P +L F+ GD I VLE+   DW+KG   G +G+FP NY
Sbjct: 212 KIPAQTVVRR-VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNY 270

Query: 107 V 107
           V
Sbjct: 271 V 271

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 48  AASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           A +Q V+K  V A+Y     +  +L FK GD I V+E+   DW++G   GRVG+FP NYV
Sbjct: 224 APAQTVIKR-VRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYV 282

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           AL++F  ++ GDL F+ GD + +L+K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVE 453

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  ++ GDL F+ GD I +L+K  +  DW+ G+ +GR G+FP+NYV+
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEK-PSADWYKGQHNGRVGMFPSNYV 107
           E   ALY F  Q  GDL F V   IE+L++  +A W+ G++NGR G+FP+NYV
Sbjct: 332 ETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYV 384

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++  DL F+ GD I +L+K  +  DW+ G+ NGR G+FP+NYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  +Q GDL F+ GD + +L+K  +  DW+ G+ NG+ G+FP+NYV+
Sbjct: 376 ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYVE 426

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V+ALY     +P +L FK GD I VLE+   DW++G   G +G+FP NYV
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYV 281

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL F+ GD I +++K  +  DW+ G+ +GR G+FP+NYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V A+Y F   +  +L FK GD I VLE+   DW++G   GR+G+FP NYV
Sbjct: 216 VRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYV 265

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYV 107
           ALY F  +Q GDL F+ GD I +L++  +  DW+ G+ NG+ G+FP+NYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  ++ GDL F+ GD I +++K  +  DW+ G+ NG+ G+FP+NYV+
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYVE 421

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%)

Query: 48  AASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
             S+Q + + V ALY     +  +L F+ GD I VLE+   DW+KG   G++G+FP NYV
Sbjct: 207 TTSRQTVVKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYV 266

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY+F  ++ GDL FK GD I +L+K  +  DW+ G+ N   G+FP+NYV+
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYVE 447

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%)

Query: 43  EGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMF 102
           +  M     Q +   V ALY     +P +L F+  D I VLE+   DW+KG   G++G+F
Sbjct: 210 QAPMHTTPVQTIVRRVRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIF 269

Query: 103 PSNYV 107
           P NYV
Sbjct: 270 PLNYV 274

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  ++ GDL F+ GD I +++K  +  DW+ G+ NG  G+FP+NYV+
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVE 466

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           V ALY +  Q PGDL F  G  IEV+++     +W+ G++NG+ G+FP NYV+
Sbjct: 417 VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYVQ 469

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V+A++     +P +L FK GD I V+E+   DW++G   G+VG+FP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSAD--WYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F VG  IEV+E+ +    W+ G++NG+ G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IE++E+ S   +W+ G++NG+ G+FP NYV+
Sbjct: 401 ETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V AL+    ++  +L F+ GD I V+E+   DW++G+  GRVG+FP NYV
Sbjct: 217 VRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYV 266

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 7/70 (10%)

Query: 41  PREGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEK-PSA-DWYKGQHNGR 98
           P  G+M A       E V ALY +  Q  GDL F  G  IE++E+ P   +W+ G++NG+
Sbjct: 395 PTAGSMTAGG-----ETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQ 449

Query: 99  VGMFPSNYVK 108
            G+FP NYV+
Sbjct: 450 QGVFPGNYVQ 459

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  ++ GDL F+ GD I +L+K  +  DW+ G+  GR G+FP+NYV+
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVE 467

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           ALY F  ++ GDL FK GD I ++++  +  DW+ G  NG+ G+FP+NYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IE++++ +   +W+ G++NG+ G+FP NYVK
Sbjct: 435 ETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNYVK 489

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKP--SADWYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q PGDL F     IE++++   + +W+ G+++G+VG+FP NYV+
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKP-SADWYKGQHNGRVGMFPSNYVK 108
           E   +LYAF  Q   DL F     IE+L++  S+ W+ G++NG+ G+FP NYV+
Sbjct: 364 ETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNYVR 417

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V ALY     +  +L F+ GD I VLE+   DW++G  +G++G+FP NYV
Sbjct: 217 VRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYV 266

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEK-PSA-DWYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IE++++ P A +W+ G++NG+ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 46  MKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFP 103
           M AA      E V ALY +  Q  GDL F  G  IE++++ +   +W+ G++NG+ G+FP
Sbjct: 449 MGAAPMPTGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFP 508

Query: 104 SNYVK 108
            NYV+
Sbjct: 509 GNYVQ 513

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVKSL 110
           AL+ F   +PGDL FK GD I ++++  +  DW+ G+ N R G+FP+NYV+ +
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVECV 581

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           AL+ F  +Q GDL F  GD + +L+K     DW+ G+ N + G+FP+NYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSAD--WYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IE++++ + +  W+ G++NG+ G+FP NYV+
Sbjct: 384 ETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V AL+  V +   +L F+ GD I V+E+   DW++G   G++G+FP NYV
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYV 278

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 57  YVEALYAFV-PQQPGDLEFKVGDKIEVLEKPSADWYKGQ---HNGRVGMFPSNYVKSL 110
           Y +ALY+F  P +   L F++GD + + EK + DWY G+    NGR G+ P NYVK L
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVKFL 677

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEK-PSA-DWYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IEV+++ P   +W+ G++NG+ G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEK-PSA-DWYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IE++++ P   +W+ G++NG+ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V A+Y F   +  +L FK GD I V+E+   DW++G   G VG+FP NYV
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYV 276

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           EY  +LY +  Q  GDL F  G  I+++++ +   DW+ G +NG+ G+FP NYV+
Sbjct: 400 EYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSAD--WYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IEV+E+ +    W+ G++NG  G+FP NYV+
Sbjct: 378 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEK-PSAD-WYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IEV+E+ P  + W+ G++NG  G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTPDVNGWWTGRYNGYQGVFPGNYVQ 458

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V A+Y+    +  +L F  GD I V+E+   DW++G   G+VG+FP NYV
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYV 280

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEK-PSA-DWYKGQHNGRVGMFPSNYVK 108
           E V ALY +  Q  GDL F  G  IE++++ P   +W+ G++NG+ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V ALY        +L FK GD I VLE+   DW+KG+   + G+FP NYV
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYV 282

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVKSL 110
           V ALY F  QQ GDL FK  D I V +K  +  DW+ G  +G  G+FP+NYV  L
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYVADL 391

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSA--DWYKGQHNGRVGMFPSNYVK 108
           E   +LY +  Q  GDL F  G  IE++E+ +   +W+ G++NG+ G+FP NYV+
Sbjct: 413 ETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           V ALY     +  +L F  GD I VLE+   DW++G   G  G+FP NYV
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYV 269

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 40  NPREGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRV 99
           N  E T +      +K+ V A+Y      P +L F+  D I V+E+   DW+ G    RV
Sbjct: 202 NQPEVTKRETGTNTIKK-VRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRV 260

Query: 100 GMFPSNYV 107
           G+FP NYV
Sbjct: 261 GIFPLNYV 268

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEK-PSADWYKGQHNGRVGMFPSNYVK 108
           E   ALY +  Q  GDL F  G  I+V+++  +A W+ G +NG  G+FP NYV+
Sbjct: 371 ETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVE 424

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 39/73 (53%), Gaps = 7/73 (9%)

Query: 48  AASQQVLKEYVEALYAFVPQ--QPG---DLEFKVGDKIEVLEKPSADWYKGQ--HNGRVG 100
           AA+  V   Y  ALY + P   Q G   DL FK GD I V++K   +W+ G+     R G
Sbjct: 369 AANGTVPTVYATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRG 428

Query: 101 MFPSNYVKSLRTL 113
            FP N+V++ R L
Sbjct: 429 YFPVNFVETERYL 441

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 57  YVEALYAFVPQQPGD-LEFKVGDKIEVLEKPSADWYKGQ-H--NGRVGMFPSNYVKSL 110
           Y  A+Y+F      D L F++GD + + EK + DWY G+ H  NG+ G+ P NYV+ L
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVELL 682

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGR--VGMFPSNYVKSLRTL-PNG 116
           A+YAFVP+   +LE K GD + +  K    W   +++ R   G+ P  YV+ +     + 
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQLIEDDGEDN 126

Query: 117 GRFDEPPPQY 126
           GR++ P P Y
Sbjct: 127 GRYENPRPFY 136

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 56  EYVEALYAFVPQQ-PGDLEFKVGDKIEVLEKPSADWYKGQ--------HNGRVGMFPSNY 106
           EY +A+Y  V  + PG   F  GD I + E  + DWYKG+         N RVG+ P N+
Sbjct: 596 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYNF 655

Query: 107 VKSL 110
           ++ L
Sbjct: 656 IQLL 659

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKPS-----ADWYKGQ-HNGRVGMFPSNYVK 108
           E+  ALY FVP+ P  ++  K GD + +L K       +DW+K +  NG +G  P NY++
Sbjct: 309 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIE 368

Query: 109 SLR 111
            ++
Sbjct: 369 IIK 371

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKP-----SADWYKGQ-HNGRVGMFPSNYVK 108
           E+  ALY FVP+ P  ++  K GD + +L K       +DW+K +  NG +G  P NY++
Sbjct: 311 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYIE 370

Query: 109 SLR 111
            ++
Sbjct: 371 IIK 373

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHNGRVGMFPSNYV 107
           A Y +  Q P +L  +VGDKI+VL++   + W  G+ NG  G+FP+ Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKP-----SADWYKGQ-HNGRVGMFPSNYVK 108
           E+  ALY FVP+ P  ++    GD + +L K      ++DW+K +  NG++G  P NY++
Sbjct: 326 EFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYIE 385

Query: 109 SLR 111
            ++
Sbjct: 386 IIK 388

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKPS-----ADWYKGQ-HNGRVGMFPSNYVK 108
           E+  ALY F+P+ P  ++  K GD + +L K       +DW+K +  NG +G  P NY++
Sbjct: 315 EFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYNYIE 374

Query: 109 SLR 111
            ++
Sbjct: 375 IIK 377

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 56  EYVEALYAFVPQQ-PGDLEFKVGDKIEVLEKPSADWYKGQ--------HNGRVGMFPSNY 106
           EY +A+Y  +  + PG   F  GD + + E  + DWYKG+         N R+G+ P N+
Sbjct: 602 EYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYNF 661

Query: 107 VKSL 110
           ++ L
Sbjct: 662 IQLL 665

>KLLA0E19735g Chr5 complement(1756682..1757908) [1227 bp, 408 aa]
           {ON} similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 14/105 (13%)

Query: 48  AASQQVLK----EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKP-----SADWYKGQ-HN 96
           A +QQ+L     E+  A+Y FVP+ P  +   K GD + ++ K      +++W+K +   
Sbjct: 301 AMAQQILDPNNLEFARAIYDFVPENPRIECNLKKGDLMAIISKKDPLGNNSEWWKVRTKQ 360

Query: 97  GRVGMFPSNYVKSLRTLPNGGRFDEPPPQYSLMVQDTAHSSSSNH 141
           G +G  P NY++ ++   NG   +      S   ++ A S+S +H
Sbjct: 361 GNIGYVPYNYLELIKKRKNGVPVESEKSNTS---EELADSTSVDH 402

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 56  EYVEALYAFVPQQ-PGDLEFKVGDKIEVLEKPSADWYKGQ--------HNGRVGMFPSNY 106
           EY +A+Y  V  + PG   F  GD + + E  + DWYKG+         + RVG+ P N+
Sbjct: 602 EYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYNF 661

Query: 107 VKSLRTLP 114
           ++ L   P
Sbjct: 662 IQLLHQGP 669

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query: 46  MKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWY-----KGQHNGRVG 100
           M AA +  +   V A Y +     GDL F+ G +IEV+      WY      G  N + G
Sbjct: 1   MNAAKEPEVPFDVIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEG 60

Query: 101 MFPSNYVK----SLRTLPNGG 117
           +FP NYV+     + + P GG
Sbjct: 61  IFPKNYVEVAQDDIHSAPTGG 81

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 56  EYVEALYAFVPQQ-PGDLEFKVGDKIEVLEKPSADWYKG--------QHNGRVGMFPSNY 106
           EY +A+Y  V  + PG   F  GD I + E  + DW+KG        + + RVG+ P N+
Sbjct: 601 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYNF 660

Query: 107 VKSLRTLP 114
           ++ L   P
Sbjct: 661 IQLLHQGP 668

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHNGRVGMFPSNYV 107
           V A+Y +  Q   ++  + GD I+VL   + + W  G+ NG  G+FPSNY 
Sbjct: 575 VTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 51  QQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYVK 108
           +QV +    A Y +   +  +L FK GD+I  +E    DW+ G  ++ G  G+FPSNYVK
Sbjct: 462 EQVREPSAIAEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 56  EYVEALYAFV-PQQPGDLEFKVGDKIEVLEKPSADWYKG---QHNGRVGMFPSNYVKSL 110
           +YV+A+Y++  P +   L F  GD + ++E  + DWY G   Q N + G+ P NYVK +
Sbjct: 548 KYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVKVI 606

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 5/61 (8%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG-----QHNGRVGMFPSNYVKSL 110
           + V A Y +VP +   L    GD + VL K  + W+ G      +    G FP NY KS+
Sbjct: 24  DVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSKSI 83

Query: 111 R 111
           R
Sbjct: 84  R 84

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKPSA-----DWYKGQ-HNGRVGMFPSNYVK 108
           E+  A+Y FVP+ P  ++  + GD + +L K  +      W+K +  NG VG  P NY++
Sbjct: 260 EFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNYIE 319

Query: 109 SLRTLPN 115
            +   PN
Sbjct: 320 VIIRKPN 326

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  KEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH--NGRVGMFPSNYVKSL-R 111
           ++ ++ALY +  Q  G+L F  GD   V ++   DWY+  +  +G+ GM P NY +   R
Sbjct: 65  EKVIKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNYFEIFGR 123

Query: 112 TLPN 115
           T PN
Sbjct: 124 TRPN 127

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 50  SQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH--NGRVGMFPSNYV 107
           ++ V+ + V ALY FVP+   +LE K GD I +  K    W   ++    R G+ P  YV
Sbjct: 111 NEYVVDKKVVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

Query: 108 KSLR--TLPNGG 117
              +   LP GG
Sbjct: 171 SIWKGDELPKGG 182

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 37.0 bits (84), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 28/39 (71%), Gaps = 2/39 (5%)

Query: 72  LEFKVGDKIEVLEK-PSA-DWYKGQHNGRVGMFPSNYVK 108
           L F  G  IE++++ P A +W+ G++NG+ G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 8/72 (11%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH--NGRVGMFPSNYVKSL-RTLP 114
           ++A+Y +  Q PG+L F  GD   VL +   +WY   +  +G+ GM P +Y +   RT P
Sbjct: 71  IKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGMVPKSYFEIFGRTRP 129

Query: 115 ---NG-GRFDEP 122
              NG G FD P
Sbjct: 130 GSVNGSGSFDSP 141

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYVKSLRTLPN 115
           V+A+Y++  +   DL F   D IEV  K   +W  G+   N + G FP NYV+ L  +PN
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQVLYEVPN 70

Query: 116 G 116
           G
Sbjct: 71  G 71

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYVK 108
           V+ALY +  Q   ++   VGD I V++    + W  G+ NG  G+FPS+Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHN--GRVGMFPSNYVKSLRTLPN 115
           + LY +  Q   ++   VGD I +++  +   W + ++N  G  G+ P++YV+ ++T  +
Sbjct: 505 KVLYQYNKQDADEISIDVGDSISLVQADTGSGWTRIKNNTTGEEGLVPTSYVE-IKTQES 563

Query: 116 GGRFDEPPP 124
            G     PP
Sbjct: 564 RGPAPVAPP 572

>SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain-containing protein
           required for cytokinesis
          Length = 633

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 41/69 (59%), Gaps = 10/69 (14%)

Query: 51  QQVLKEYVEALYAFV-PQQPGDLEFKVGDKIEVLEKPSADWYKGQ-HNG-------RVGM 101
           ++V+K Y +ALY ++ P +   + F+V D I + ++ + DWY G+ +N        R G+
Sbjct: 565 EKVIK-YAKALYTYMEPNENNLVNFRVDDYILLTKRLNQDWYLGEVYNAGGIEDRYRCGL 623

Query: 102 FPSNYVKSL 110
            P+NY++ L
Sbjct: 624 VPANYIEIL 632

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query: 57  YVEALYAFVPQQPG---DLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYVKSLR 111
           Y  AL+ + P +P    DL F+  + I+V++K    W+ G+     + G FP+NYV+  R
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVELER 458

Query: 112 TL 113
            L
Sbjct: 459 FL 460

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYVKSL 110
           V+  +A+  ++  DL F  GD IEV  + + DWY G+   N + G FPSNYV  L
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEVT-RVTGDWYFGKLIRNKKQGYFPSNYVSIL 64

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 48  AASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSN 105
           A  Q+  + +  A Y +   +  +L F+  DKI  +E    DW+ G  + NG  G+FPSN
Sbjct: 487 ATEQKEEQPWAIAEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSN 546

Query: 106 YV 107
           YV
Sbjct: 547 YV 548

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHNGRVGMFPSNYVK 108
           V+AL+ +  Q   ++  + GD I VL+      W  G+ NG+ G+FP+NY +
Sbjct: 571 VKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTNYCQ 622

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYVK 108
           +EA+YA+  Q   ++   VGD I V+     + W  G+ +G  G+FP++Y K
Sbjct: 582 LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHN--GRVGMFPSNYVK----SLR 111
           + LYA+V Q   ++    GD+I ++ + +   W K  ++  G  G+ P+ Y++       
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDTA 558

Query: 112 TLPNGGRFDE-PPPQYSLM 129
           T  N G   E PPP+ S +
Sbjct: 559 TANNRGPAPEVPPPRRSTL 577

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYVK 108
           +EA+YA+  Q   ++   VGD+I V+     + W  G+ +G  G+FP++Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYK--GQHNGRVGMFPSNYVK 108
           + LYA+V Q   +++   GDKI ++ + +   W K    + G  G+ P+ Y++
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIR 551

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 50  SQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGR-----VGMFPS 104
           SQ+ +   V A+ A+ PQ   DL+   GDKI VL      WY G++  +      G+FPS
Sbjct: 3   SQEDVPFEVVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPS 62

Query: 105 NYVKSL 110
           ++VK +
Sbjct: 63  SHVKVI 68

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEK--PSAD---WYKGQ-HNGRVGMFPSNYVK 108
           E+  A+Y F P+ P  +   K GD + ++ K  P+ +   W+K +   G VG  PSNY++
Sbjct: 315 EFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNYIE 374

Query: 109 SLR 111
            +R
Sbjct: 375 LIR 377

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHNGRVGMFPSNYVK 108
           VEA+Y++  Q   +     GD I VL+      W  G+ NG  G+FP++Y K
Sbjct: 570 VEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 3/53 (5%)

Query: 62  YAFVPQQPGDLEFKVGDKIEVL-EKPSADWYKGQ--HNGRVGMFPSNYVKSLR 111
           Y F+ +   +L  K GDK+ +L +K S+DW+  Q   +G+ G+ P+ +V+ +R
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPVR 406

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 51  QQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYV 107
           ++  K +  A Y +   +  +L F   DKI  +E    DW+ G+   NG  G+FPSNYV
Sbjct: 553 KEETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 57  YVEALYAFVPQQPGDLE--FKVGDKIEVLEKPSADW--YKGQHNGRVGMFPSNYVKSLRT 112
           + +ALY +   Q  D E  F  GD+ +V +    DW     + +G +G  P NYV+    
Sbjct: 73  HAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVEISEA 132

Query: 113 LPNGGRFDEPPPQY 126
            P G     PPPQ+
Sbjct: 133 TPVGSNSFPPPPQH 146

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWYK-------GQHNGRVGMFPSNYVK 108
           +A+YA+ PQ P +L     D + +L+K    DW+              VG+ P+NY++
Sbjct: 9   KAIYAYQPQNPEELAIDEEDLLYLLQKSDVDDWWTVKKRVIGTDQEEPVGLVPNNYIE 66

>CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191w PAS20
          Length = 391

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 7/65 (10%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKP-----SADWYKGQHN-GRVGMFPSNYVK 108
           E+  ALY F P+ P  ++  K GD + ++ K      S+DW+K ++  G+ G  P NY++
Sbjct: 317 EFARALYDFTPENPQIEITLKKGDLVAIISKADPLGRSSDWWKVRNRAGQNGYAPYNYLE 376

Query: 109 SLRTL 113
            ++ +
Sbjct: 377 IIKRV 381

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 58  VEALYAFVPQQPGD--LEFKVGDKIEVLEKPSADWY--KGQHNGRVGMFPSNYVKSLRTL 113
           V A+Y +   Q  D  L F+ GD  ++ +   ADW+  +   + +VG  P NYV+   T+
Sbjct: 74  VHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVGFIPGNYVE---TI 130

Query: 114 PNGGR 118
             GGR
Sbjct: 131 EEGGR 135

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWY--KGQHNGR-----VGMFPSNYVKSL 110
           +A+Y++ PQ   +L  +  D + VLEK    DW+  K +  G      VG+ P+NY++  
Sbjct: 9   KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIEEA 68

Query: 111 RTL 113
             L
Sbjct: 69  DVL 71

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEK------PSADWYKGQHNGRVGMFPSNYVK 108
           E+  A+Y F P+ P  +L  K GD + V+ K      PS  W      G +G  P NY++
Sbjct: 308 EFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVPYNYLE 367

Query: 109 SLR 111
            ++
Sbjct: 368 LIK 370

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYVK 108
           A Y +   +  +L F  GDKI  +E    DW+ G  +  G  G+FPSNYV+
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain- containing protein
           required for cytokinesis
          Length = 600

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 10/69 (14%)

Query: 51  QQVLKEYVEALYAFV-PQQPGDLEFKVGDKIEVLEKPSADWYKGQH--------NGRVGM 101
           ++VL+ Y +ALY F+ P +   + F VGD + + E+   DW+ G+           R G+
Sbjct: 532 EEVLR-YAKALYTFMEPNEQQIVNFHVGDYLLLTEQLDQDWFIGEVLDSQNVDPEYRYGI 590

Query: 102 FPSNYVKSL 110
            P NY++ L
Sbjct: 591 IPRNYIEIL 599

>ADL038W Chr4 (623309..627838) [4530 bp, 1509 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR310C (CDC25),
           YLL016W and YLL017W; YLL016W and YLL017W represent one
           ORF in this genome
          Length = 1509

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 12/70 (17%)

Query: 54  LKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG-------QHNGRV-----GM 101
            K+ V AL  FVP +   L  K GD + VL +  + W  G       + N  V     G 
Sbjct: 16  CKDVVRALCDFVPLKKQHLPLKAGDVVYVLSRHESGWCDGIIIEQTAKGNSTVTQCQRGW 75

Query: 102 FPSNYVKSLR 111
           FP  Y +S+R
Sbjct: 76  FPRTYTRSIR 85

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 58  VEALYAFVPQQPG--DLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           V+ALY++        +L F+ GD ++V +     W   + NG+ G+ PSNYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKPS-----ADWYKGQ-HNGRVGMFPSNYVK 108
           E+  ALY F+P+ P  +   K G+ + +L++       ++W+K +  NG  G  P NY++
Sbjct: 332 EFGRALYDFIPENPRIEATMKKGELLAILDRRDVFGNESEWWKVRTKNGSTGYVPYNYIE 391

Query: 109 SLRTL 113
            +R +
Sbjct: 392 IIRRI 396

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 55  KEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYV 107
           K +  A Y +   +  +L F+  DKI  +E    DW+ G  +  G  G+FPSNYV
Sbjct: 521 KPWATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 62  YAFVPQQPGDLEFKVGDKIEVL-EKPSADWYKGQ--HNGRVGMFPSNYVKSLR 111
           Y F+ +   +L  K GDK+ +L +K S DW+  Q   +G+ G+ P+ +++ +R
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPVR 414

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 8/62 (12%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWY--KGQHNGR-----VGMFPSNYVKSLR 111
           A+YA+ PQ P +L  +  D + +L+K    DW+  K +  G      VG+ PS Y++   
Sbjct: 10  AVYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEAP 69

Query: 112 TL 113
            L
Sbjct: 70  VL 71

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKPSA-----DWYKGQ-HNGRVGMFPSNYVK 108
           E+  ALY F P+ P  ++  K GD + ++ K  +     +W+K +  +G +G  P NY++
Sbjct: 309 EFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRTKSGDIGYVPFNYIE 368

Query: 109 SLR 111
            +R
Sbjct: 369 IIR 371

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVG---MFPSNYV 107
            LY F P++P +LE   GDKI +    + +W+   H    G   + P ++V
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFV 219

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 47  KAASQQVLK--EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRV--- 99
           KA    ++K  + V A Y F P +   L F  GD I V+ K  + W+ G   +N  +   
Sbjct: 13  KAGLSTIIKPLDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSLVLR 72

Query: 100 GMFPSNYVKSLR 111
           G FP +Y KS++
Sbjct: 73  GWFPRSYTKSIK 84

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 10/74 (13%)

Query: 46  MKAASQQVLKEYVEALYAFVPQQPGDL-EFKVGDKIEVLEKPSADWYKGQ----HNG--- 97
           + +  ++VLK Y +ALY F+      +  F+ GD + + E+   DW+ G+    H+    
Sbjct: 554 LSSKEEKVLK-YAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPE 612

Query: 98  -RVGMFPSNYVKSL 110
            R G+ P NY++ L
Sbjct: 613 YRYGIIPRNYIEIL 626

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYV 107
           A Y +   +  +L F  GDKI  +E    DW+ G  +  G  G+FPSNYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLP 114
           V+A + +  +   DL F     I V      +WY G++  + G+FP ++VK L T P
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVKILETAP 66

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 36.6 bits (83), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKP-----SADWYKGQ-HNGRVGMFPSNYVK 108
           E+  A+Y F P+ P  +   + GD + V+ K      +++W++ +   G VG  PSNYV+
Sbjct: 311 EFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYVE 370

Query: 109 SLR 111
            +R
Sbjct: 371 LIR 373

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 62  YAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQ--HNGRVGMFPSNYVKSLR 111
           Y F+ +   +L  K GDK+ +L+ K S DW+  Q   +G+ G+ P+ +++ +R
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPVR 407

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWY--KGQHNGR-----VGMFPSNYVK 108
           A+YA+ PQ P +L  +  D + +L K    DW+  K +  G      VG+ PS Y++
Sbjct: 10  AIYAYEPQTPEELAIEEDDLLYLLHKSDVDDWWTVKKRVIGSDSEEPVGLVPSTYIE 66

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYVKSLRTLPN 115
           V ALY++  +Q  DL F   D IEV  K   DW  G+   N + G FP  YV+ ++ + N
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQLIQEVYN 70

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYVK 108
           VEA+Y +      +L    G+ I+V+     + W  G+ NG  G+FPS+Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 36.6 bits (83), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 58  VEALYAFVPQQPGDLE--FKVGDKIEVLEKPSADWY--KGQHNGRVGMFPSNYVKSLRTL 113
           V ++Y +   Q  D E  F+ GD+ +V +   ADW   + + +G VG  P NYV+ +   
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVEKVGAA 133

Query: 114 PNG 116
           P G
Sbjct: 134 PAG 136

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 59  EALYAF-VPQQPGD-LEFKVGDKIEVLEKPSADWY--KGQHNGRVGMFPSNYVKSL 110
            ALY +  PQ P + L FK  D  ++ +    DW   + Q +G VG  P NYV+ L
Sbjct: 75  RALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEPL 130

>KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1528

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 9/70 (12%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--------QHNGRVGMFPSNYV 107
           + V A   F P +   L    GD + VL K  + W+ G        Q   R G FP N+ 
Sbjct: 25  DVVVATCDFTPTKKAQLRLSAGDVVYVLGKNESGWWDGVTVCGRSPQRVAR-GWFPHNFT 83

Query: 108 KSLRTLPNGG 117
           +S R    GG
Sbjct: 84  RSYREHKRGG 93

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYVK 108
           V A YA+V Q   +L  + GD ++V++    + W  G+ +G  G+ P++Y K
Sbjct: 583 VTAQYAYVAQGDDELSLEAGDVVKVIKGDDGSGWTYGELDGAKGLIPTSYCK 634

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHNGRVGMFPSNYV 107
           V A+Y +  +   ++  + GD I+V+   + + W  G+  G  G+FPSNY 
Sbjct: 621 VIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYVK 108
           +EA YA+  +   ++   VGD I V+     + W  G+ +G  G+FP++Y K
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHN--GRVGMFPSNYVK 108
           + LYA+  Q   ++    GDKI ++ + S   W K  ++  G  G+ P+ YV+
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVR 551

>CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032w HOF1
           involved in cytokinesis
          Length = 712

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 10/75 (13%)

Query: 45  TMKAASQQVLKEYVEALYAFVPQQPGDL-EFKVGDKIEVLEKPSADWYKGQHNGRV---- 99
           T+    ++V+K + +ALY  +  +  +L  F+ GD + + E  + DWY+G+  G      
Sbjct: 635 TITKEGEEVIK-FAKALYPLINSEAQELANFEKGDYLLLTEVVNEDWYRGEVYGNSNTTT 693

Query: 100 ----GMFPSNYVKSL 110
               G+ PSN+++ L
Sbjct: 694 THGNGLIPSNFIQIL 708

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYV 107
           A Y +   +  +L F   DKI  ++    DW+ G+   NG  G+FPSNYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 36.2 bits (82), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYV 107
           A Y +   +  +L F   DKI  +E    DW+ G+   NG  G+FPSNYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEK-----PSADWYKGQ-HNGRVGMFPSNYVK 108
           E+  A+Y F P+ P  +   K GD + ++ +       + W+K +   G VG  P NY++
Sbjct: 315 EFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWWKVRTKKGDVGYVPCNYIE 374

Query: 109 SLR 111
            +R
Sbjct: 375 LIR 377

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWY--KGQHNGR-----VGMFPSNYVK 108
           +A+Y + PQ P +LE K  D + +LEK    DW+  K +  G      VG+ PSNY++
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIE 66

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYV 107
           A Y +   +  +L F+  DKI  +E    DW+ G+    G  G+FPSNYV
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNYV 664

>NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]
           {ON} Anc_4.45
          Length = 1323

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG-------QHNGRVGMFPSNYVK 108
           + V  +Y F P     L+ +  + + VL KP+  W+ G       Q   + G FP  +V 
Sbjct: 61  DIVRVVYDFTPSSSDQLQLRQNEIVYVLNKPNTGWWDGITISESPQQQIKRGWFPQTFVH 120

Query: 109 SL 110
           S+
Sbjct: 121 SI 122

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYVK 108
           A Y +   +  +L F   DKI  +E    DW+ G  + +G  G+FPSNYV+
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 36.2 bits (82), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVL-EKPSADWYKGQ--HNGRVGMFPSNYVK 108
           ALY F  + P +L  + GD + V+ +K S DW+  +   NG+ G+ P+ +++
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE 428

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 12/61 (19%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWYKGQHNGRV---------GMFPSNYVK 108
           +A+Y++ PQ P +L  +  D + +LEK    DW+  +   R+         G+ PSNY++
Sbjct: 9   KAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVKK--RIIGSDAEEPQGLVPSNYIE 66

Query: 109 S 109
           +
Sbjct: 67  A 67

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 35.8 bits (81), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 71  DLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYVK 108
           +L FK GDKI  +     DW+ G  +  G  G+FPSNYV+
Sbjct: 589 ELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRV-GMFPSNYV 107
           V A Y +  Q  GDL F  GD +EV +K + DW+ G    N +  G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKNFV 61

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 35.8 bits (81), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 53  VLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPS--ADWYKGQHNGRVGMFPSNYVK 108
           VL   + ALY +  Q   ++   VGD I+V+ KP   + W  G+ N +  +FP++Y K
Sbjct: 612 VLIRTMVALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYK--GQHNGRVGMFPSNYVKSL 110
           + LYA+      ++    GD I+V+EK +   W K      G +G+ PS+Y++++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLETV 592

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 35.0 bits (79), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYVKSL 110
           ALY FVP+   +L+   GD I +  K    W   Q  +N ++G+ P  +V  L
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFVSYL 157

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPS--ADWYKGQHNGRVGMFPSNYVK 108
           +EALY +  Q   +L    G  ++VL KP   + W  G+ +G  G+FP++Y K
Sbjct: 574 IEALYDYQAQGDDELSIYAGSVVKVL-KPDDGSGWTYGELDGAKGLFPTSYCK 625

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG---QHNGRV--GMFPSNYVKS 109
           + V A++ +  +   +L  + GD I V+ K  + W+ G   + NG+V  G FP NY +S
Sbjct: 49  DVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRS 107

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYV 107
           +  A Y +   +  +L F   DKI  +E    DW+ G  + +G  G+FPSNYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 59  EALYAFVPQQPG--DLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSL 110
           EALY +   Q    ++ F+ G+ + V +     W   + NG  G+ PSNYVK L
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVKLL 352

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYVK 108
           A Y +   +  +L F+ GD I  ++    DW+ G  Q  G+ G+FPSNYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYV 107
           +  A Y +   +  +L F   DKI  +E    DW+ G  + +G  G+FPSNYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 41  PREGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRV 99
           PR  T+   +       +EA+YA+  Q   ++    GD I V+     + W  G+ +G  
Sbjct: 572 PRRSTLPVRT-------MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLK 624

Query: 100 GMFPSNYVK 108
           G+FP++Y K
Sbjct: 625 GLFPTSYCK 633

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 8/79 (10%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHN--GRVGMFPSNYVK-----SL 110
           + LYA+V +   ++    GDKI ++ + +   W K  ++  G  G+ P+ Y++     ++
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATV 558

Query: 111 RTLPNGGRFDEPPPQYSLM 129
           +    G   + PPP+ S +
Sbjct: 559 KANDRGPAPEVPPPRRSTL 577

>NDAI0D02940 Chr4 complement(691155..696308) [5154 bp, 1717 aa] {ON}
           Anc_4.45 YLR310C
          Length = 1717

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 12/68 (17%)

Query: 56  EYVEALYAFVPQQPG-------DLEFKVGDKIEVLEKPSADWYKG-----QHNGRVGMFP 103
           + V +LY F P+           L F   + I VLEK  + W+ G     Q++ + G FP
Sbjct: 183 DIVISLYDFFPENRNSTTYTNSQLSFPKNELIYVLEKNFSGWWDGIIISSQNDVKRGWFP 242

Query: 104 SNYVKSLR 111
            NYV S++
Sbjct: 243 QNYVTSIK 250

>NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.365
           YLR191W
          Length = 445

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 7/70 (10%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKPS-----ADWYKGQ-HNGRVGMFPSNYVK 108
           E+  A Y FVP+ P  +L+   GD + ++ K       ++W+K +  NG +G  P NY++
Sbjct: 371 EFARAKYKFVPENPEMELQLSKGDLMAIISKQDPLGRDSEWWKVRTKNGDMGYVPYNYLE 430

Query: 109 SLRTLPNGGR 118
            ++ +    R
Sbjct: 431 IIKRVAKDRR 440

>AGL169C Chr7 complement(381327..382085) [759 bp, 252 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR162C
           (NBP2)
          Length = 252

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 53  VLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNG--RVGMFPSNYVKSL 110
           V+ ++  ALY FVP+   +LE + G  + +  K    W   + +   R G+ P  YV  L
Sbjct: 108 VVNKHAWALYDFVPENDNELELQEGSIVYISYKHGQGWLVAEDSARTRTGLVPEEYVSIL 167

Query: 111 RT-----LPNGGRFDE 121
                  +  GGR D+
Sbjct: 168 EDEDEPGVVAGGRADD 183

>KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly
           similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 187

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 40  NPREGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH--NG 97
           + R  ++   S+ ++     ALY FVP+   +LE + GD + +  +    W   ++    
Sbjct: 53  DSRRQSIVLPSEYIVNRRAVALYDFVPENDNELELREGDVLFIGYRHGQGWLVAENAERT 112

Query: 98  RVGMFPSNYV 107
           R G+ P  YV
Sbjct: 113 RTGLVPEEYV 122

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 67  QQPGD--LEFKVGDKIEVLEKPSADWYKG-QHNGRV---GMFPSNYVKSLRTLPNGGR 118
             P D  L F  GDKI VL K    W+ G   +G+V   G FP ++VK  RT+  G +
Sbjct: 46  NHPSDTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKPYRTVSPGAK 103

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYV 107
           +  A Y +   +  +L F   DKI  +E    DW+ G  + +G  G+FPSNYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 70  GDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYVKSLR 111
            +L F+ GDKI  +     DW+ G+    G  G+FPSNYV+ ++
Sbjct: 583 NELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQLIK 626

>NCAS0E02790 Chr5 (551328..552467) [1140 bp, 379 aa] {ON} Anc_7.365
           YLR191W
          Length = 379

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKPS-----ADWYKGQ-HNGRVGMFPSNYVK 108
           E+  ALY FVP+ P  + E K G+ + ++ +       ++W+K +  +G +G  P NY++
Sbjct: 305 EFARALYDFVPENPQIEAELKKGELMAIISQRDPVGRESNWWKVRTKDGSMGYVPYNYIE 364

Query: 109 SLR 111
            ++
Sbjct: 365 VIK 367

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYV 107
           +  A Y +   +  +L F   DKI  +E    DW+ G  + +G  G+FPSNYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>TBLA0H02790 Chr8 (653275..655026) [1752 bp, 583 aa] {ON} Anc_2.591
           YMR032W
          Length = 583

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 9/65 (13%)

Query: 56  EYVEALYAFVPQQPGDL-EFKVGDKIEVLEKPSADWYKGQ--------HNGRVGMFPSNY 106
           +Y +ALY  V     +L  F  GD + +      DWYKG+           + G+ PSN+
Sbjct: 519 QYAKALYPLVDNPATELAHFHKGDYLLLTHIIDKDWYKGEVYANDMIDATHKYGLIPSNF 578

Query: 107 VKSLR 111
           V+ L+
Sbjct: 579 VRLLK 583

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 62  YAFVPQQPGDLEFKVGDKIEVL-EKPSADWYKGQ--HNGRVGMFPSNYVK 108
           Y F+ +   +L  K GDK+ +L +K S DW+  Q   +G+ G+ P+ +++
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIE 408

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 8/62 (12%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWY--KGQHNGR-----VGMFPSNYVKSLR 111
           A+YA+ PQ P +L  +  D + +L+K    DW+  K +  G      VG+ PS Y++   
Sbjct: 10  AIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIEEAP 69

Query: 112 TL 113
            L
Sbjct: 70  VL 71

>NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539
          Length = 554

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH--NGRVGMFPSNYVKSL-RTLP 114
           ++ALY +  Q P ++ F  G+   V+ + + +WY+  +  NG+ GM P +Y +   RT P
Sbjct: 74  IKALYNYHSQTPNEVSFVEGEFFYVINE-TEEWYEASNPSNGKKGMVPKSYFEEFDRTRP 132

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 56 EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG 93
          + VE  Y +  +    L  +VGD I VL K S  W+ G
Sbjct: 29 DVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>Kpol_1026.32 s1026 complement(75177..79085) [3909 bp, 1302 aa] {ON}
           complement(75177..79085) [3909 nt, 1303 aa]
          Length = 1302

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 72  LEFKVGDKIEVLEKPSADWYKG--QHNGRV--GMFPSNYVKSLRTLPNGGR 118
           L+FK  D I VL K ++ W+ G    NG V  G FP+N+  S++  P+  R
Sbjct: 38  LQFKATDVIYVLYKHNSGWWDGFIISNGIVKRGWFPNNFTSSMKKRPSFKR 88

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYK--GQHNGRVGMFPSNY 106
           ++ALY +  Q PG+L F  G+ + V+ +   +W++     +GR GM P +Y
Sbjct: 69  LKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGRKGMVPKSY 118

>AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR200W
           (BEM1); 1-intron
          Length = 549

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYK--GQHNGRVGMFPSNYVKSL 110
           ++ALY +  Q PG+L F  G+  +V      +WY+      GR GM P +Y + +
Sbjct: 67  LKALYTYHAQSPGELSFNKGELFQV-NGEDGEWYEVTSTEGGRKGMVPKSYFEQV 120

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 62  YAFVPQQPGDLEFKVGDKIEVL-EKPSADWYKGQHNGRVGMFPSNYVK 108
           Y +  Q+  ++  +VGD + VL E   + W   + +G  G+ P+NY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 58  VEALYAFVPQQPG--DLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRT 112
           V+ALY++        ++ F  G+ ++V +     W   + NG+ G+ PSNYV+ + T
Sbjct: 311 VKALYSYQADDADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVELIDT 367

>CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38822 Saccharomyces cerevisiae
           YHR114w BZZ1
          Length = 619

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYV 107
           + A Y +  Q   +L   VGD + VL+    + W  G+ NG  G+ P++Y 
Sbjct: 568 ITAQYEYTSQGDDELSLAVGDVVTVLKGDDGSGWTYGELNGHKGLVPTSYC 618

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYVK 108
           +E ++ +V Q   ++   VGD + V++    + W  G+ NG  G+ P++Y K
Sbjct: 551 LEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYV 107
           A Y +V Q   ++    GD I V+     + W  G+ NG  G+FP++Y 
Sbjct: 590 AKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSYC 638

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 3/74 (4%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-W--YKGQHNGRVGMFPSNYVKSLRTLPN 115
           + LYA+  Q   ++     D I +L   S   W   K +  G  G+ P+ Y+K   +   
Sbjct: 510 KVLYAYTKQDSDEITISPQDIITLLAADSGSGWTKIKNETTGESGLVPTTYIKIEESSHR 569

Query: 116 GGRFDEPPPQYSLM 129
           G     PPP+ S +
Sbjct: 570 GNAPAAPPPRRSTL 583

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYV 107
           A Y +   +  +L F   DKI  +E    DW+ G  + +G  G+FPSNYV
Sbjct: 541 AEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 590

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 57  YVEALYAFVPQ--QPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYVK 108
           Y   LY + PQ   P  L  K GD I+++ +    W+ G        G+FP +YV+
Sbjct: 361 YATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDLLRTKTKGLFPQSYVQ 416

>NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.344
           YDR162C
          Length = 233

 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 53  VLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGR--VGMFPSNYVKSL 110
           V+ ++  A+Y FVP+   +L+ K  D + +  K    W   ++  R   G+ P  +V  L
Sbjct: 108 VVNQWAVAIYDFVPENENELDLKENDIVFISYKHGQGWLVAENEARTKTGLVPEEFVSYL 167

Query: 111 R 111
           +
Sbjct: 168 Q 168

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 8/58 (13%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWYKGQH-------NGRVGMFPSNYVK 108
           +A+YA+ PQ P +L  +  D + +LEK    DW+  +        +   G+ PSNYV+
Sbjct: 9   KAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNYVE 66

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WY--KGQHNGR-----VGMFPSNYVK 108
           +A+Y + PQ P +LE    D + +LEK   D W+  K +  G      VG+ PSNY++
Sbjct: 9   KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIE 66

>Kpol_1030.45 s1030 (102192..103358) [1167 bp, 388 aa] {ON}
           (102192..103358) [1167 nt, 389 aa]
          Length = 388

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEKPSA-----DWYKGQ-HNGRVGMFPSNYVK 108
           E+  A Y F P+    ++     D + VL K  A     +W+K Q  +G+ G  P NY++
Sbjct: 319 EFARACYDFTPENNKFEVPLNKDDIVAVLRKQDALGRNSNWWKVQTKDGKTGYVPYNYIE 378

Query: 109 SLR 111
            +R
Sbjct: 379 VIR 381

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 56  EYVEALYAFVPQ-QPGDLEFKVGDKIEVLEKP-----SADWYKGQ-HNGRVGMFPSNYVK 108
           E+  AL+ F P+ +  +L    GD + +L K      ++ W+K +  NG  G  PSNY++
Sbjct: 307 EFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSNYIE 366

>KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.365
           YLR191W
          Length = 314

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 9/64 (14%)

Query: 56  EYVEALYAFVPQ--------QPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYV 107
           ++  ALY FVP+        + GDL   + +K +   + S  W     +G VG  P NYV
Sbjct: 245 KFARALYDFVPENAKIEVPLKKGDLMAIISEK-DTFGRDSQWWRVRTRDGNVGYIPYNYV 303

Query: 108 KSLR 111
           + ++
Sbjct: 304 EVIK 307

>Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2) -
           interacts with Nap1, which is involved in histone
           assembly [contig 398] FULL
          Length = 199

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 50  SQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH--NGRVGMFPSNYV 107
           S+ ++     ALY FV +   +LE K GD + +  + +  W   ++    R G+ P  YV
Sbjct: 66  SEYIVNRTAVALYDFVAENDNELELKEGDVLFIGYRHAQGWLVAENMDRTRTGLVPEEYV 125

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHN---GRV--GMFPSNYV 107
           A +A+  +   DL FK G KI V      +WY G++    G V  G+FP ++V
Sbjct: 12  AQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSFV 64

>ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 396

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 56  EYVEALYAFVPQQPG-DLEFKVGDKIEVLEK--PS---ADWYKGQ-HNGRVGMFPSNYVK 108
           E+  ALY F P+ P  +   K G+ + ++ K  PS   ++W+K +   G +G  P NYV+
Sbjct: 314 EFARALYDFTPENPQIEAPLKKGELMAIITKQHPSGNNSEWWKVRTKTGNMGYVPFNYVE 373

Query: 109 SLR 111
            ++
Sbjct: 374 IIK 376

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 59  EALYAFVPQQPG--DLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           +ALY++        ++ F+ G+ ++V +     W   + NG+VG+ PSNYV+
Sbjct: 300 KALYSYQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH--NGRVGMFPSNYV 107
           A Y +   +  +L F  G KI  +E    DW+ G++   G  G+FP+NYV
Sbjct: 475 AEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGR--VGMFPSNYV 107
           A+Y F+P+   +L  K GD + +  K    W   ++  R   G+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>NDAI0E04050 Chr5 complement(903302..906220) [2919 bp, 972 aa] {ON}
           Anc_7.413 YBL085W
          Length = 972

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 64  FVPQQPGDLEFKVGDKIEVLE---KPSADWYKGQH--NGRVGMFPSNYVK 108
           ++ Q   +L+ K+GDKI+V+    K +  WY G++      G+FP  + K
Sbjct: 11  YLKQMEDELDLKIGDKIKVITDDGKYNDGWYLGENLKTKEKGLFPVQFTK 60

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGR--VGMFPSNYVKSL 110
           ALY FVP+   +L  + GD + +  K    W   ++ GR   G+ P  +V  L
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFVSFL 159

>Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa]
           {ON} YJL020C (BBC1) - 1:1 [contig 290] FULL
          Length = 1184

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNG-----RVGMFPSNYVKSLRT 112
           V A + +  +   DL F+ G +I V      +WY G++       R G+FP ++VK    
Sbjct: 10  VIAQFPYSSEHEDDLNFEKGRRITVQSIEDEEWYFGEYRTEDGEFREGIFPRSFVKLAEE 69

Query: 113 LPNGGRFDE 121
            P+    DE
Sbjct: 70  SPSEASEDE 78

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 8/84 (9%)

Query: 53  VLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWY--KGQHNGRVGMFPSNYVKSL 110
           V+     ALY F P+   +LE + GD + +  +    W   + Q+  + G+ P  +V   
Sbjct: 126 VINRLAVALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFV--- 182

Query: 111 RTLPNGGRFDEPPPQYSLMVQDTA 134
            T  N    DE   +Y    QDTA
Sbjct: 183 -TYANED--DENWAEYEEGFQDTA 203

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHN--GRVGMFPSNYVKSLRTLP- 114
           + LYA+  Q   ++    GD I +L   +   W K +++  G  G+ P+ YVK    +  
Sbjct: 497 KVLYAYAKQDTDEISISPGDSISLLAADTGSGWTKIRNDTTGESGLVPTTYVKITENVAV 556

Query: 115 -----NGGRFDEPPPQYSLM 129
                NG     PPP+ + M
Sbjct: 557 DGGHGNGHAPAVPPPRRTTM 576

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 41  PREGTMKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRV 99
           PR  TM + +       + A Y++      ++   VGD I V+     + W  G+ NG  
Sbjct: 571 PRRTTMPSRT-------LTAAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSK 623

Query: 100 GMFPSNYVK 108
           G+ P++Y K
Sbjct: 624 GLVPTSYCK 632

>ZYRO0B00506g Chr2 complement(31949..36781) [4833 bp, 1610 aa] {ON}
           similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1610

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 77  GDKIEVLEKPSADWYKG---QHNGRV--GMFPSNYVKSLRTLP 114
           GD + VL K    W+ G      GRV  G FP NY +SL+  P
Sbjct: 89  GDTVYVLGKTDNGWWDGIVIDSLGRVSRGWFPRNYARSLQHFP 131

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 59  EALYAFVPQQPGDLE--FKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPN 115
           +ALY++   +    E  F+ G+ + V +     W   + NG  G+ PSNYV+ + +  N
Sbjct: 273 KALYSYQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQLINSETN 331

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 12/60 (20%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWYKGQHNGRV---------GMFPSNYVK 108
           +A+Y + PQ P +L  +  D + +LEK +  DW+  +   RV         G+ PSNYV+
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKK--RVIGSDIDEPAGLVPSNYVE 66

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 12/61 (19%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWYKGQHNGRV---------GMFPSNYVK 108
           +A+Y++ PQ P +L  +  D + +LEK    DW+  +   RV         G+ PSNY++
Sbjct: 9   KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWWTVKK--RVIGSDAEEPSGLVPSNYIE 66

Query: 109 S 109
           +
Sbjct: 67  T 67

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH---NGRV--GMFPSNYV 107
           VEAL+ +      DL F  G  I VLE    +W+ G+    +G+   G+FP  +V
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar to
           Ashbya gossypii AGR306C
          Length = 1024

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 46  MKAASQQVLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG-----QHNGRVG 100
           M  A +  +   V A +++  +   DL F  G KI V+      WY G     +   R G
Sbjct: 1   MNKAKEPEIPFQVVAQFSYKSEYKHDLHFDKGQKILVISIEDNQWYYGHFVDSEGKQREG 60

Query: 101 MFPSNYVKSLRTLPNGGR 118
           +FP ++V  +R     GR
Sbjct: 61  IFPKSFVSIVRDEMKTGR 78

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 12/61 (19%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSAD-WYKGQHNGRV---------GMFPSNYV 107
           V+ALY + PQ   +L  K  D + +LEK   D W+  +   RV         G+ PSNYV
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKK--RVIGLDAEEPTGLVPSNYV 65

Query: 108 K 108
           +
Sbjct: 66  E 66

>TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON}
           Anc_5.170 YJL020C
          Length = 1314

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNG-----RVGMFPSNYVKSLRT 112
           V A + +  +   DL F     I V      +WY G++ G     RVG+FP ++V +  T
Sbjct: 7   VVATFPYTSEYEDDLNFDKDQTITVTAIEDDEWYSGEYLGPDGVMRVGIFPRSFVAAAPT 66

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 59  EALYAFVPQQPG--DLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
            ALYA+   +    ++ F+ G+ + V +     W   + NG  G+ PSNYV+
Sbjct: 273 RALYAYEADESDAYEISFQQGEILRVGDIEGRWWKAKRSNGETGIIPSNYVE 324

>Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]
           {ON} YBR200W (BEM1) - contains two SH3 domains [contig
           24] FULL
          Length = 499

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQH--NGRVGMFPSNYVKSL 110
           ++ALY +  Q P +L F  G+   V++    +WY   +  + R GM P +Y +S 
Sbjct: 8   IKALYNYQAQSPRELSFVKGEFF-VVQAEDKEWYDAANPQDHRRGMVPKSYFESF 61

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 58  VEALYAF--VPQQPGDLEFKVGDKIEVLEKPSADWY--KGQHNGRVGMFPSNYVK 108
           V ALY +  V     +L F   D  ++ +   ADW+  K   N  VG  P NYV+
Sbjct: 74  VVALYDYEQVQNANEELVFHENDTFQLYDDRDADWFLVKNTKNSEVGFVPGNYVE 128

>TPHA0C02610 Chr3 complement(577049..579061) [2013 bp, 670 aa] {ON}
           Anc_2.591 YMR032W
          Length = 670

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 57  YVEALYAFVPQQ-PGDLEFKVGDKIEVLEKPSADWYKGQ--------HNGRVGMFPSNYV 107
           Y +A Y  +    PG   F+  D + + E  S +WYKG+         N R G+ P N++
Sbjct: 607 YAKAEYPLMENDAPGLAHFEKNDYLLITEVVSDEWYKGEVYGNDMIGINHRSGLIPFNFI 666

Query: 108 KSL 110
           + L
Sbjct: 667 QLL 669

>KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369)
           [1659 bp, 552 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 552

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 54  LKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG--QHNGRVGMFPSNYVKSL 110
           +++ ++ALY +  Q P +L F  G+   V++    +WY      + R GM P +Y +S 
Sbjct: 62  VEKVIKALYNYQAQSPKELSFVKGE-FFVVQAEDKEWYDAFNPQDQRRGMVPKSYFESF 119

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 12/60 (20%)

Query: 59  EALYAFVPQQPGDLEFKVGDKIEVLEKPSA-DWYKGQHNGRV---------GMFPSNYVK 108
           +A+Y + PQ P +L  +  D + +LEK    DW+  +   RV         G+ PSNY++
Sbjct: 9   KAIYNYEPQTPEELAIQEDDLLYLLEKSDVDDWWTVKK--RVIGSDAEEPSGLIPSNYIE 66

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQ--HNGRVGMFPSNYV 107
           A Y +   +  +L F+  ++I  ++    DW+ G+   +G  G+FPSNYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 53  VLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGR--VGMFPSNYVKSL 110
           V+ ++  ALY F P+   +L  K  D + +  K    W   ++  R   G+ P  YV  L
Sbjct: 104 VVNQWAVALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYVSYL 163

Query: 111 RT 112
            +
Sbjct: 164 ES 165

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 59  EALYAFVPQQPG--DLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           +ALYA+        ++ F+ G+ + V +     W   + NG  G+ PSNYV+
Sbjct: 271 KALYAYEADASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPSNYVE 322

>Kpol_414.1 s414 (1989..6635) [4647 bp, 1548 aa] {ON} (1989..6635)
           [4647 nt, 1549 aa]
          Length = 1548

 Score = 30.4 bits (67), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 5/43 (11%)

Query: 72  LEFKVGDKIEVLEKPSADWYKG-----QHNGRVGMFPSNYVKS 109
           L+FK GD I VL K S  W+ G       + + G FP+N+ K+
Sbjct: 41  LKFKQGDIIYVLNKNSNGWWDGIILKSSKSIKRGWFPNNFTKT 83

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 59  EALYAFVPQQPGDLE--FKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           +ALY +        E  F+ G+ + V +     W   + NG  G+ PSNYV+
Sbjct: 285 KALYTYTADSNDAYEVSFEQGETLRVGDIEGRWWKAKRANGETGIIPSNYVE 336

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
           1252 aa] {ON} ANNOTATED BY YGOB - skipping over
           frameshift in strain S288c
          Length = 1252

 Score = 30.4 bits (67), Expect = 5.9,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 12/67 (17%)

Query: 56  EYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKG---------QHNGRV---GMFP 103
           + VE  Y +  +    L  +VGD I VL K S  W+ G          +N  +   G FP
Sbjct: 29  DVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDGVLIRHSANNNNNSLILDRGWFP 88

Query: 104 SNYVKSL 110
            ++ +S+
Sbjct: 89  PSFTRSI 95

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 53  VLKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHN--GRVGMFPSNYVKSL 110
           V+ +   ALY F P+   +L  K GD I +  +    W   Q++   + G+ P  +V  L
Sbjct: 94  VVNQKAVALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFVSYL 153

Query: 111 RT 112
            +
Sbjct: 154 DS 155

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 59  EALYAFVPQQPG--DLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
            ALY++   +    ++ F+  + +EV +     W   + NG  G+ PSNYV+
Sbjct: 317 RALYSYKANENDAYEISFEQNELLEVSDIEGRWWKARRENGTTGIIPSNYVE 368

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 34/57 (59%), Gaps = 5/57 (8%)

Query: 60  ALYAFVPQQPGDLEFKVGDKIEVL---EKPSADWYKGQH--NGRVGMFPSNYVKSLR 111
           A+  +  +   +L+FK GDKI+V+   E+ +  WY G++    + G++P+ + + ++
Sbjct: 38  AINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGKNLRTQQEGLYPAVFTQEIK 94

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 59  EALYAFVPQQPGDLE--FKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
           +ALY +        E  F+ G+ + V +     W   + NG  G+ PSNYV+
Sbjct: 284 KALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIPSNYVE 335

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 59  EALYAFVPQQPGDLE--FKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108
            ALY++        E  F+ G+ ++V +     W   +  G VG+ PSNYV+
Sbjct: 299 RALYSYQADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQ 350

>Kpol_1064.15 s1064 (28183..30123) [1941 bp, 646 aa] {ON}
           (28183..30123) [1941 nt, 647 aa]
          Length = 646

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 9/64 (14%)

Query: 56  EYVEALYAFVPQQ-PGDLEFKVGDKIEVLEKPSADWYKGQHNG--------RVGMFPSNY 106
           ++ +A Y  +    PG + F   D + + E  + DW+KG+  G        R G+ P N+
Sbjct: 582 QFAKASYPLLDNDTPGLVNFHKNDYLLITEMINNDWFKGEVYGNDLIGIDHRRGLIPINF 641

Query: 107 VKSL 110
           ++ L
Sbjct: 642 IQIL 645

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 72  LEFKVGDKIEVLEKPSADWYKG----QHNGRV--GMFPSNYVKSLR 111
           L  + GD I +L K S+ W+ G      +G+V  G FP N+ + LR
Sbjct: 85  LSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQNFGRPLR 130

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 58  VEALYAFVPQQPGDLEFKVGDKIEVLE-KPSADWYKGQHNGRVGMFPSNYVK 108
           ++A Y +  Q   +L     D + V+     + W  G+ NG  G+FP++Y +
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,657,063
Number of extensions: 657991
Number of successful extensions: 1600
Number of sequences better than 10.0: 262
Number of HSP's gapped: 1485
Number of HSP's successfully gapped: 306
Length of query: 253
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 146
Effective length of database: 41,212,137
Effective search space: 6016972002
Effective search space used: 6016972002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)