Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10871.83ON57057030020.0
SAKL0C02684gsingletonON58858219870.0
SAKL0C02662g1.83ON54852519210.0
SAKL0C02640gsingletonON54854919090.0
Ecym_10881.84ON56756819020.0
Kwal_33.134011.83ON55955918830.0
Suva_5.41.83ON59058618840.0
CAGL0J08184g1.83ON57255118640.0
KLTH0F02398g1.83ON55556918490.0
KLLA0C02343g1.83ON58157818410.0
KNAG0C007901.83ON57951018370.0
KNAG0C05920singletonON59956918360.0
Skud_5.261.83ON59056718340.0
NDAI0F042001.83ON56656018300.0
YEL063C (CAN1)1.83ON59058618310.0
AFR668W1.83ON55655518260.0
KLTH0F02420g1.84ON62152118300.0
NDAI0A006101.83ON56556218220.0
Smik_5.241.83ON59053418230.0
NCAS0A006001.83ON54450918120.0
NCAS0B085701.83ON53253718030.0
CAGL0J08162g1.84ON59757917990.0
KAFR0D039401.83ON59757017980.0
TDEL0C061801.83ON58358417950.0
Kwal_33.134111.84ON56055617860.0
Smik_14.681.84ON61150817910.0
SAKL0C02728g1.84ON56250817840.0
TPHA0B044801.83ON60350917870.0
Kpol_2000.641.84ON61057117850.0
Suva_14.751.84ON61151117840.0
Skud_14.711.84ON61251317840.0
YNL268W (LYP1)1.84ON61156717820.0
NDAI0F041901.84ON59951117760.0
KLLA0C02365g1.84ON57955517630.0
TPHA0B044701.84ON59954117640.0
TDEL0C061701.84ON57355917580.0
NCAS0A006101.84ON60751017580.0
TBLA0A054601.84ON60856517570.0
KNAG0F004801.84ON59755217530.0
AFR667C1.84ON56355717440.0
Skud_14.701.83ON57357917440.0
KAFR0D007001.83ON57457317360.0
YNL270C (ALP1)1.83ON57357917210.0
Kpol_2000.651.83ON59551017190.0
TBLA0A054501.83ON60660117200.0
Smik_14.671.83ON57352917120.0
ZYRO0F16654g1.83ON58050717080.0
ZYRO0F16632g1.84ON60751016840.0
Suva_14.731.83ON49747816610.0
Kpol_358.3na 1ON57552710131e-130
Suva_16.40na 1ON6065749841e-125
Skud_16.12na 1ON6075749761e-124
KLLA0E16281gna 1ON6055579751e-124
TPHA0M00130singletonON6115129691e-123
Smik_6.473na 1ON6065199671e-123
CAGL0A01199gna 1ON6135329651e-123
KNAG0L02470singletonON6385399621e-122
YPL265W (DIP5)na 1ON6085149581e-122
Kwal_33.15545na 1ON5765449551e-121
KAFR0B06430singletonON5935129561e-121
SAKL0G14916gna 1ON5815189491e-121
Ecym_60211.244ON6004969441e-120
NCAS0D02260na 1ON5975489441e-120
ZYRO0D03762g1.244ON6005649321e-118
TBLA0A07060na 1ON6255149331e-118
Ecym_2480na 1ON5865139291e-117
ZYRO0D17908gna 1ON5184949091e-115
NDAI0I02660na 1ON5945579151e-115
KLTH0B01166gna 1ON5775399131e-115
TPHA0H028507.44ON6015909071e-114
Kwal_26.69407.44ON5705219031e-114
Kwal_33.154075.158ON5875668981e-113
ACL135Wna 1ON5885398931e-112
Ecym_80357.44ON5635318901e-112
NDAI0B052201.244ON6115668941e-112
Kwal_27.126811.244ON5935758911e-112
KNAG0C02140singletonON5985298911e-112
SAKL0G14014g5.158ON6055008901e-111
KLTH0D01474g7.44ON6244998811e-110
TDEL0C00930singletonON5955588781e-110
CAGL0B01012g1.50ON6235608761e-109
SAKL0D00836gna 2ON6014948731e-109
SAKL0F09790gsingletonON5585188681e-109
TDEL0A08030singletonON5144918641e-109
KNAG0L02460singletonON5885458681e-108
KLTH0B02046g5.158ON5895728671e-108
Kwal_33.14276na 2ON5964948661e-108
SAKL0C01232gsingletonON6135058671e-108
SAKL0B10956g7.44ON5725058621e-108
Suva_2.6881.50ON6615438671e-107
CAGL0E05632g7.44ON5985228621e-107
AFR156W7.44ON5585648561e-107
KLTH0E15642g1.244ON5965298561e-107
KNAG0E003907.44ON5995938561e-106
SAKL0D04664g1.244ON5935618551e-106
Kwal_23.4026singletonON5345128491e-106
TDEL0H040707.44ON5775428521e-106
Suva_3.1891.50ON6335678521e-105
KLLA0A11770g5.158ON5815268481e-105
AFR230C1.244ON6045878471e-105
KLLA0C01606g1.50ON6205788481e-105
Smik_3.531.50ON6335588471e-105
Kpol_543.791.244ON6055698451e-105
NDAI0A006401.50ON6415328471e-105
TPHA0B010901.244ON6065538441e-105
NDAI0D021605.158ON5875348421e-105
KAFR0D00510na 3ON6175678441e-105
Skud_11.2751.244ON6025398431e-104
YOR348C (PUT4)7.44ON6275648441e-104
TPHA0E036601.50ON6475088461e-104
Kpol_2000.921.50ON6375788441e-104
NDAI0E038007.44ON6215248421e-104
Ecym_47895.158ON5885398381e-104
CAGL0L03267g1.244ON5975308371e-104
TDEL0C065101.50ON6425288411e-104
KAFR0D04120na 4ON6485148411e-104
SAKL0C01650g1.50ON6135058361e-103
YCL025C (AGP1)1.50ON6335588371e-103
Smik_4.7901.50ON6635518371e-103
YDR508C (GNP1)1.50ON6635548341e-103
NDAI0G060301.368ON5995058281e-102
CAGL0K05753g1.50ON6605218321e-102
KLLA0A06886gsingletonON5875618261e-102
Kpol_367.77.44ON5845558251e-102
KAFR0D00520na 4ON5985358261e-102
Skud_3.381.50ON6335668271e-102
Suva_11.2731.244ON6015248251e-102
YKR039W (GAP1)1.244ON6025398241e-102
NCAS0A089201.368ON5995048241e-102
NCAS0B085801.50ON6275208261e-102
Skud_4.7841.50ON6635518251e-101
AFR698C1.50ON6095058191e-101
Suva_2.716singletonON6035108181e-101
Kpol_2002.441.50ON6275648201e-101
Ecym_10561.50ON6065168151e-100
Skud_15.5157.44ON6265728171e-100
Smik_15.5327.44ON6315648151e-100
CAGL0B03773g5.158ON6055548131e-100
KAFR0D005001.50ON6175468131e-100
NCAS0A071105.158ON5925448091e-100
KAFR0D041401.50ON6375598131e-100
Suva_7.4855.158ON6035318101e-100
Smik_16.1155.158ON6035678091e-100
KAFR0E018505.158ON5605608061e-99
Skud_7.5255.158ON6035578091e-99
KLTH0H13398g1.368ON5875608071e-99
Suva_8.4027.44ON6835548151e-99
Skud_15.1381.368ON5925088071e-99
TDEL0F02830na 5ON5614898051e-99
YGR191W (HIP1)5.158ON6035398072e-99
TPHA0A047005.158ON5695288042e-99
YOL020W (TAT2)1.368ON5925218062e-99
NCAS0B079001.244ON6195318064e-99
KAFR0C051607.44ON5845728035e-99
NCAS0D018705.158ON5955238029e-99
Kwal_33.132041.50ON6075768002e-98
YBR068C (BAP2)3.284ON6095887977e-98
Kpol_543.78singletonON6055307969e-98
Smik_15.1461.368ON5935087932e-97
TBLA0C012101.368ON6005207942e-97
TBLA0C01240singletonON6295067962e-97
KLLA0F23419g7.44ON5735507887e-97
AEL030W1.368ON5825617887e-97
KLTH0F04048gsingletonON5835877888e-97
AGR319W5.158ON6265137918e-97
Suva_15.1481.368ON5925087881e-96
KLTH0C05170g3.284ON5985797872e-96
CAGL0D02178g1.368ON5775217834e-96
KAFR0A011203.284ON5925687844e-96
Ecym_26643.285ON5755317825e-96
KLTH0F01584g1.50ON5965057836e-96
NCAS0A004201.50ON6795687896e-96
TDEL0E05750singletonON5485037788e-96
TPHA0A002405.158ON6035817838e-96
Kpol_1010.325.158ON5995287829e-96
Kwal_34.16254singletonOFF4814817739e-96
TBLA0A051801.50ON6765377881e-95
KNAG0J022103.285ON5815557801e-95
Kwal_YGOB_34.162541.368ON4914817731e-95
KLTH0F01606gna 4ON6045887821e-95
Sklu_YGOB_Anc_1.3681.368ON5414947762e-95
NDAI0C029505.158ON6095377812e-95
NCAS0E022607.44ON5935527802e-95
TBLA0B077605.158ON6584957842e-95
Skud_2.1913.284ON6095807793e-95
Kpol_534.221.368ON5925147783e-95
SAKL0D02970g3.284ON6015897793e-95
Smik_6.482na 6ON5585597745e-95
KNAG0F002701.50ON6345157771e-94
ZYRO0F17446g1.50ON6335047771e-94
NDAI0F043901.50ON6675017782e-94
Smik_11.3021.244ON5535157692e-94
Ecym_27161.368ON5925717722e-94
AGR038C3.284ON5805327712e-94
KNAG0J022003.284ON6075067715e-94
Smik_2.2023.285ON6175457691e-93
KNAG0L00110na 7ON5715187652e-93
Skud_16.2na 6ON4965087582e-93
TBLA0A05190na 4ON6675727703e-93
ZYRO0G07172gna 5ON5675047624e-93
Smik_2.2013.284ON6095447654e-93
SAKL0A09724gna 8ON5515297596e-93
AGR039Cna 9ON5865127627e-93
Suva_2.2033.284ON6045797638e-93
TPHA0B047501.50ON6395497659e-93
KAFR0C004003.284ON5825227619e-93
Smik_4.2843.284ON6045857629e-93
KNAG0G009005.158ON6135567639e-93
Ecym_26623.284ON5895287611e-92
Skud_2.1923.285ON6195097631e-92
Suva_4.3073.284ON6095617621e-92
NCAS0I015303.284ON5955737602e-92
KLLA0A06930g1.244ON5874967592e-92
SAKL0D02948gna 9ON5945457592e-92
KAFR0D04130na 3ON6445027632e-92
Skud_4.3003.284ON6045907592e-92
TBLA0G031203.284ON6735427633e-92
KLLA0A10813g1.368ON5845407564e-92
Kwal_27.105383.284ON6025957575e-92
NCAS0J00140na 7ON5584947528e-92
YDR046C (BAP3)3.284ON6045797542e-91
KLLA0F27093gsingletonON5635377502e-91
NDAI0A01340singletonON5544977483e-91
SAKL0D02926g3.285ON5835297503e-91
Suva_4.3083.285ON6185087516e-91
KNAG0H011503.284ON6175127482e-90
NDAI0A074903.284ON5965177462e-90
Ecym_2663na 9ON5895397426e-90
CAGL0M00154gsingletonON5505367387e-90
TPHA0A025001.368ON5905687417e-90
CAGL0H08393g3.284ON6125147438e-90
SAKL0C13992gsingletonON5525467381e-89
KLTH0A00308gsingletonON5415477371e-89
ZYRO0A00308gsingletonON5645437381e-89
NDAI0A056203.284ON5715687391e-89
Smik_13.1singletonON5234937351e-89
SAKL0H08184gna 10ON5985017401e-89
SAKL0F16544gsingletonON5675807372e-89
NCAS0A106803.284ON5935527382e-89
Kwal_26.9612singletonON5435417343e-89
KNAG0C005901.50ON6345187413e-89
Suva_13.517singletonON5475367334e-89
Kpol_1065.133.284ON5965547366e-89
Kwal_8.590na 11ON6295397377e-89
Skud_6.2na 7ON5584977311e-88
ADL272Wna 10ON5645347311e-88
YBR069C (TAT1)3.285ON6195277351e-88
Ecym_8297na 10ON5695147321e-88
TPHA0M012003.284ON6075787341e-88
KAFR0F02250singletonON5545327274e-88
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1087
         (570 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...  1160   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   769   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   744   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   739   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   737   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   729   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   730   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   722   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   716   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   713   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              712   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            711   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   711   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            709   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   709   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   707   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   709   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   706   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   706   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   702   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            699   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   697   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   697   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   696   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   692   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   694   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   691   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   692   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   692   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   691   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   691   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   691   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   688   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   683   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   684   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   681   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              681   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   681   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                679   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   676   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   676   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   673   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   667   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   666   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   667   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   664   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   662   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   653   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   644   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   394   e-130
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   383   e-125
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   380   e-124
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   380   e-124
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     377   e-123
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   377   e-123
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   376   e-123
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             375   e-122
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   373   e-122
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   372   e-121
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   372   e-121
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   370   e-121
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   368   e-120
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              368   e-120
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   363   e-118
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   363   e-118
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   362   e-117
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   354   e-115
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   357   e-115
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   356   e-115
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   353   e-114
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   352   e-114
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   350   e-113
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   348   e-112
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   347   e-112
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   348   e-112
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   347   e-112
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   347   e-112
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   347   e-111
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   343   e-110
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   342   e-110
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   342   e-109
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   340   e-109
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   338   e-109
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            337   e-109
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             338   e-108
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   338   e-108
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   338   e-108
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   338   e-108
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   336   e-108
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   338   e-107
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   336   e-107
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   334   e-107
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   334   e-107
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   334   e-106
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   333   e-106
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   331   e-106
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   332   e-106
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   332   e-105
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   331   e-105
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   330   e-105
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   331   e-105
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   330   e-105
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   330   e-105
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   330   e-105
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   329   e-105
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    328   e-105
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      329   e-105
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   329   e-104
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   329   e-104
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   330   e-104
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   329   e-104
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     328   e-104
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   327   e-104
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   327   e-104
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   328   e-104
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   328   e-104
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   326   e-103
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   327   e-103
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   327   e-103
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   325   e-103
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   323   e-102
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   325   e-102
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   322   e-102
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   322   e-102
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   322   e-102
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   323   e-102
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   322   e-102
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   322   e-102
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   322   e-102
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   322   e-102
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   322   e-101
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   320   e-101
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   319   e-101
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   320   e-101
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   318   e-100
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   319   e-100
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   318   e-100
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   317   e-100
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      317   e-100
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   316   e-100
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              317   e-100
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   316   e-100
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   316   e-100
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   315   e-99 
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   316   1e-99
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   315   1e-99
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   318   1e-99
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   315   1e-99
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   314   1e-99
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   315   2e-99
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   314   2e-99
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   315   2e-99
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   315   4e-99
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   313   5e-99
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   313   9e-99
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   312   2e-98
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   311   7e-98
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   311   9e-98
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   310   2e-97
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   310   2e-97
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   311   2e-97
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   308   7e-97
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   308   7e-97
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   308   8e-97
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   309   8e-97
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   308   1e-96
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   307   2e-96
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   306   4e-96
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   306   4e-96
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   305   5e-96
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   306   6e-96
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   308   6e-96
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            304   8e-96
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   306   8e-96
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   305   9e-96
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   302   9e-96
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   308   1e-95
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   305   1e-95
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   302   1e-95
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   305   1e-95
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   303   2e-95
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    305   2e-95
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     305   2e-95
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   306   2e-95
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   304   3e-95
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   304   3e-95
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   304   3e-95
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   302   5e-95
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   303   1e-94
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   303   1e-94
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   304   2e-94
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   300   2e-94
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   301   2e-94
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   301   2e-94
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   301   5e-94
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   300   1e-93
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   299   2e-93
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   296   2e-93
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   301   3e-93
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   298   4e-93
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   299   4e-93
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   296   6e-93
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   298   7e-93
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   298   8e-93
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   299   9e-93
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                297   9e-93
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   298   9e-93
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   298   9e-93
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   297   1e-92
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   298   1e-92
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   298   1e-92
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              297   2e-92
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   296   2e-92
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   296   2e-92
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              298   2e-92
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   296   2e-92
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              298   3e-92
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   295   4e-92
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   296   5e-92
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      294   8e-92
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   295   2e-91
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   293   2e-91
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              292   3e-91
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   293   3e-91
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   293   6e-91
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              292   2e-90
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   291   2e-90
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   290   6e-90
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   288   7e-90
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   290   7e-90
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   290   8e-90
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   288   1e-89
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   288   1e-89
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   288   1e-89
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            289   1e-89
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    287   1e-89
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   289   1e-89
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   288   2e-89
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   288   2e-89
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   287   3e-89
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   290   3e-89
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   286   4e-89
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   288   6e-89
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   288   7e-89
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      286   1e-88
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   286   1e-88
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   287   1e-88
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   286   1e-88
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   287   1e-88
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              284   4e-88
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   283   5e-88
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   281   9e-87
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   280   1e-86
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   280   2e-86
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   280   3e-86
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   281   4e-86
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   278   5e-86
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   276   2e-84
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   275   3e-84
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                273   1e-83
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   274   1e-83
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   272   4e-83
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              270   2e-82
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   270   2e-82
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   270   2e-82
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   270   2e-82
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   270   2e-82
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   270   4e-82
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   268   3e-81
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   267   3e-81
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   266   5e-81
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   268   7e-81
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   265   2e-80
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   271   2e-80
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   270   2e-80
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   264   3e-80
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   263   6e-80
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   264   9e-80
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   263   1e-79
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   263   1e-79
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      261   4e-79
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   261   8e-79
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   260   1e-78
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   260   1e-78
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   258   3e-78
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                258   5e-78
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              259   5e-78
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   258   5e-78
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   264   6e-78
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   256   3e-77
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   262   3e-77
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   256   5e-77
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   256   6e-77
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   253   8e-77
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   253   5e-76
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              254   6e-76
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    253   6e-76
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   252   8e-76
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   253   8e-76
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   252   1e-75
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   251   2e-75
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   256   3e-75
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   256   9e-75
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   249   1e-74
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   249   2e-74
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   248   4e-74
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                247   9e-74
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   247   1e-73
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   246   2e-73
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   251   2e-73
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   245   5e-73
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   243   2e-72
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   249   2e-72
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   243   3e-72
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   248   5e-72
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   243   5e-72
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   248   6e-72
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   241   7e-72
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   241   3e-71
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   240   5e-71
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   243   3e-70
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   241   1e-69
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   235   1e-69
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   234   6e-69
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   233   7e-69
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   238   1e-68
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   237   5e-68
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   235   3e-67
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   234   8e-67
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   228   1e-66
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   232   3e-66
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   232   3e-66
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   230   2e-65
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   221   2e-64
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     204   3e-60
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     204   6e-60
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   213   6e-60
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         147   3e-39
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   142   4e-38
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         117   1e-29
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     118   3e-29
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    120   3e-29
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          94   2e-21
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    86   8e-19
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      82   2e-18
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    69   2e-12
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      63   5e-11
Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar t...    49   2e-05
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              45   9e-05
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    46   2e-04
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    44   0.001
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    44   0.001
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    43   0.002
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    42   0.003
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    42   0.004
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    42   0.004
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    41   0.007
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    41   0.009
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    40   0.011
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    40   0.012
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    40   0.016
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...    40   0.018
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    40   0.021
ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,...    39   0.023
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...    39   0.036
Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)    37   0.15 
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...    37   0.18 
KLLA0B13233g Chr2 complement(1159097..1160833) [1737 bp, 578 aa]...    36   0.29 
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    36   0.31 
Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON...    35   0.43 
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    35   0.49 
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    35   0.84 
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...    34   0.95 
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...    34   1.00 
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    34   1.0  
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    34   1.3  
TBLA0D02060 Chr4 complement(519297..521225) [1929 bp, 642 aa] {O...    34   1.3  
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...    33   1.5  
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...    33   1.6  
Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON...    33   2.1  
KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112     33   2.2  
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    33   2.2  
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    33   2.6  
Smik_9.143 Chr9 complement(239206..241914) [2709 bp, 902 aa] {ON...    33   2.7  
NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {O...    33   2.7  
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...    33   2.9  
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...    32   3.5  
Sklu_YGOB_Anc_4.195 Chr2 (423552..424091,424095..425261) [1707 b...    32   4.1  
KLTH0A03278g Chr1 (283065..284783) [1719 bp, 572 aa] {ON} highly...    32   6.7  
Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {O...    32   7.0  
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...    32   7.2  
TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.2...    31   7.6  
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    31   7.7  
Skud_9.122 Chr9 complement(233973..236681) [2709 bp, 902 aa] {ON...    31   8.9  
TPHA0B03530 Chr2 (823638..826523) [2886 bp, 961 aa] {ON}               31   9.1  

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/570 (100%), Positives = 570/570 (100%)

Query: 1   MVENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDP 60
           MVENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDP
Sbjct: 1   MVENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDP 60

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE
Sbjct: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS
Sbjct: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240
           VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY
Sbjct: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240

Query: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300
           WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN
Sbjct: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300

Query: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360
           KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV
Sbjct: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360

Query: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420
           ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI
Sbjct: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420

Query: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480
           SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY
Sbjct: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480

Query: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540
           AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI
Sbjct: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540

Query: 541 DTDRREIDALVWSDDDEPKTLLQKLWQSFS 570
           DTDRREIDALVWSDDDEPKTLLQKLWQSFS
Sbjct: 541 DTDRREIDALVWSDDDEPKTLLQKLWQSFS 570

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  770 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/582 (65%), Positives = 469/582 (80%), Gaps = 14/582 (2%)

Query: 1   MVENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEG-----------IFINQENMS 49
           M E + L  YP G+++N+   ESS +S+     K+TK+             +     N+S
Sbjct: 9   MAEQIPLTPYPYGQEYNNAMGESSTASEEPFGCKDTKSTDEKTRVVSQVSPMRTGSPNVS 68

Query: 50  EVESLYGN-DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMG 108
                 GN  D +VKR LKPRH+SMI+LGGTIGTGLF+GI+SP+  AGPVG+L+AY+FMG
Sbjct: 69  IDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMG 128

Query: 109 TIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQ 168
           TIA+ VTQSLGEMATFIPVTSSFT++TQRFLSPA G ANGYLYWFSWC+TFALELS++GQ
Sbjct: 129 TIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQ 188

Query: 169 LIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC 228
           +IQ+WTFAVPL  WI +FW++LT SN+ PV++YGE+EFWIA +KVL+I GF+IYA +MVC
Sbjct: 189 IIQFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC 248

Query: 229 GGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGES 288
           G    G +GFRYW+NPGPWG G+IS +  E RFLGWVSSLI AAFTYQGTELVGITAGES
Sbjct: 249 GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGES 308

Query: 289 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNS 348
           KNPR+TVP+AINKVFFRILFFYILSL F+GLLVP+ DP+L  + DS I++SPFV+AI+NS
Sbjct: 309 KNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLK-SEDSYISSSPFVIAIENS 367

Query: 349 GTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLT 408
           GTKVLP +FN VIL TI+SAGNSNIY+GSRVLYGL+K+ LAP +F +  K GVP+ +VL 
Sbjct: 368 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLG 427

Query: 409 SSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLP 468
           ++ FG LAYLN+S +A+KVFDWLL ITA+AGFFAWL ISL+HIRFMQVLKDR +SRNDLP
Sbjct: 428 TAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLP 487

Query: 469 FKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFK 528
           FKAKFMPWGAYY+AFFI++II+IQGF +FAP+F  S F A YISVFLF+  W+ FQ+ F+
Sbjct: 488 FKAKFMPWGAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFR 547

Query: 529 TRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSFS 570
           TR IL K DVDIDTDRR+ID +VW +++ PK    K W + +
Sbjct: 548 TRFILTKNDVDIDTDRRDIDCIVW-EEETPKNAWDKFWAAMA 588

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/525 (66%), Positives = 434/525 (82%), Gaps = 2/525 (0%)

Query: 46  ENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           E+   +ESL    +  VKR LKPRH+SMI+LGGTIGTGLF+ I++P+  AGPVG+L+AY+
Sbjct: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
           F+GT+A+ VTQSLGEMATFIPVTSSFT++TQRFLSPALG+ANGYLYW SW +TFALELS+
Sbjct: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145

Query: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225
           +GQ+IQ+WT AVPL+ WI +FW++LT SN+ PV++YGE+EFWIA +KVL+I GF+IYA +
Sbjct: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205

Query: 226 MVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITA 285
           MVCG    G +GFRYW+NPGPWG G+IS +  E RFLGWVSSLI AAFTYQGTELVGITA
Sbjct: 206 MVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265

Query: 286 GESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAI 345
           GE+ NPRKTVP+AINKVFFRILFFYILSL F+GLLVP+ DP+L  + DS I++SPFV+AI
Sbjct: 266 GEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLK-SEDSYISSSPFVIAI 324

Query: 346 QNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYA 405
           +NSGTKVLP +FN VIL TI+SAGNSN+Y+GSR+ Y ++ +GLAP     T K G+P+ A
Sbjct: 325 ENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAA 384

Query: 406 VLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRN 465
           VLT+S+ G LAYL  S  A  VF+WLL ITAVAGFF W+LIS+SHIRFMQ LK +GISR+
Sbjct: 385 VLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRD 444

Query: 466 DLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQV 525
           DLPFKAKFMPWGAYYAAFFI VII+IQGF +FAP+F  S+F   YISV LF V W+GFQ+
Sbjct: 445 DLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQI 504

Query: 526 LFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSFS 570
            F+  L ++ ED+D+DTDRREID +VW ++ +P+ L +K W + +
Sbjct: 505 WFRGPLFIKTEDIDLDTDRREIDDVVW-EEQKPRNLWEKFWAAIA 548

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/549 (64%), Positives = 443/549 (80%), Gaps = 4/549 (0%)

Query: 20  SAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGT 79
           SA+   SS+   + +E  +E  F   +++  +ESL    +  VKR LKPRH+SMI+LGGT
Sbjct: 2   SAQQHHSSEKEKNSEELVSE--FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGT 59

Query: 80  IGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFL 139
           IGTGLF+ I++P+  AGPVG+L+AY+F+GT+A+ V+QSLGEMATFIPVTSSF ++TQRFL
Sbjct: 60  IGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFL 119

Query: 140 SPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVR 199
           SPALGAANGY+Y+ SW +TFALELS++GQ+IQ+WT AVPL+ WI++ W++L ++N+ PV+
Sbjct: 120 SPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVK 179

Query: 200 FYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEA 259
           FYGE+EFWIA +KVL+I GF+IYA +MVCG    G +GFRYW+NPGPWG G+IS +  E 
Sbjct: 180 FYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEG 239

Query: 260 RFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGL 319
           RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+AINKVFFRILFFYILSL F+GL
Sbjct: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGL 299

Query: 320 LVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRV 379
           LVP+ DP+L  + DS I++SPFV+AI+NSGTKVLP +FN VIL TI+SAGNS++YI SRV
Sbjct: 300 LVPFNDPKLK-SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRV 358

Query: 380 LYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAG 439
           LY +  +GLAP     T K G+P+ AVLT+S+ G LAYL  S  A  VFDWLL ITAVAG
Sbjct: 359 LYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAG 418

Query: 440 FFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP 499
           FFAW+LIS++HIRFMQ LK +GISR+DLPFKAKFMPWGAYYAAFFI VII+IQGF +FAP
Sbjct: 419 FFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP 478

Query: 500 EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPK 559
           +F  S+F   Y+SV LF   W+GFQ+ F+  L  + ED+D+DTDRREID  VW ++DEPK
Sbjct: 479 KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVW-EEDEPK 537

Query: 560 TLLQKLWQS 568
            L +K W +
Sbjct: 538 NLWEKFWSA 546

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/568 (61%), Positives = 449/568 (79%), Gaps = 8/568 (1%)

Query: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDV 62
           E + LET    ++   + A+ +  S++      T + G    +E+  E E  Y   + +V
Sbjct: 8   ETIVLETLT--RERYSKKAKGNNGSEI-ALESITPDSGDEFPEEH--EQEGDY--HETEV 60

Query: 63  KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA 122
           KR LK RH+SMI+LGGTIGTGLF+ IASP+R AGPVGSL+AY+FMGT+ + +TQSLGEMA
Sbjct: 61  KRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMA 120

Query: 123 TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVW 182
           TFIPVTSS T++++RFLSPA G ANGY+YWF+W +TFA+ELS++GQ+I YWT  VPL  W
Sbjct: 121 TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVVPLGAW 180

Query: 183 IVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWK 242
           I +FWI++T  N  PVRFYGEIEFWIA++KV++I G+LIYA ++VCGGSS+G +GFR W+
Sbjct: 181 ITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGSSQGPIGFRNWR 240

Query: 243 NPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKV 302
           NPGPWG G+ISSN+ EARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKV
Sbjct: 241 NPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKV 300

Query: 303 FFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVIL 362
           FFRILFFYILSLFFVGLLVPY DPR+  TSD+D+N SPFV++I+N+GTK+LP +FN V+L
Sbjct: 301 FFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKILPDIFNAVVL 360

Query: 363 VTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQ 422
           VT++SA NSN+YIGSRV+Y L++SG AP  F   N+ GVP   V+ +++ G +A+L ++ 
Sbjct: 361 VTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNN 420

Query: 423 NAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAA 482
           NAK  F+WL+ I+ +AG  AWL ISL+HIRFMQ LK RGISR+ LPFKAKFMPW AYYAA
Sbjct: 421 NAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAA 480

Query: 483 FFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDT 542
            F+ VII IQG+ +F+P+F  ++F   YIS+ L +V ++G Q+ +K R + + ED+DIDT
Sbjct: 481 SFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDT 540

Query: 543 DRREIDALVWSDDDEPKTLLQKLWQSFS 570
           +RREIDA+VW +DDEPK L  K W + +
Sbjct: 541 NRREIDAIVW-EDDEPKNLWDKFWSTIA 567

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/559 (63%), Positives = 436/559 (77%), Gaps = 9/559 (1%)

Query: 19  RSAESSESSDVLHHRKETKNEGIF----INQENMSEVESLYGNDDPD---VKRDLKPRHM 71
           +++E    S     R E    G F    ++QE  S  +S  G+       V+R LKPRH+
Sbjct: 3   KTSEKEGMSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHV 62

Query: 72  SMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSF 131
           SMI+LGGTIGTGLF+GI SP+R AGPVG+L++YLFMG+IA+CVTQSLGEMATFIPVTSSF
Sbjct: 63  SMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSF 122

Query: 132 TMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLT 191
           T++T+RFLS  LGAANGY+Y FSW VT+ALELSI+GQ+I+YWT AVP + WI +FW+ +T
Sbjct: 123 TVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPIT 182

Query: 192 ASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGM 251
            SN++PV+FYGE +FWIA +KV++I GFL+Y L MVCG    G +GFRYW+NPGPWG G+
Sbjct: 183 LSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDGI 242

Query: 252 ISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYI 311
           IS + +E RFLGWVSSL+ AAFTYQGTELVGI+AGES NPRKTVPKAINKVFFRIL FY+
Sbjct: 243 ISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYV 302

Query: 312 LSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNS 371
            SLFF+GLLVP+ D +L T+SDS    SPF++AIQNSGTK+LP +FN VIL TI+SA NS
Sbjct: 303 GSLFFIGLLVPFNDEKL-TSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANS 361

Query: 372 NIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWL 431
           N+Y+GSRVLYGL+K  LAP  F +TN+ GVP  AVL  + FG L YL++S  A K FDWL
Sbjct: 362 NVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWL 421

Query: 432 LTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILI 491
           L ITA+AGFF+WL ISL H+RFMQ LK +GISR+DLPFKAK MPWGAYY+AFFIT+II+I
Sbjct: 422 LNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIII 481

Query: 492 QGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALV 551
           QGF S AP F  S F A YISVF+F+V W  FQ  ++TR+I R E VDID+DRRE+DA  
Sbjct: 482 QGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQ 541

Query: 552 WSDDDEPKTLLQKLWQSFS 570
           W D+ EP TL  K W + +
Sbjct: 542 W-DNTEPTTLWGKFWAAMA 559

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/586 (61%), Positives = 449/586 (76%), Gaps = 28/586 (4%)

Query: 2   VENVELETYPAGKQHNDRSAESSESSDVLHHR------KETKNEGIF--------IN-QE 46
           VE   + T PAG   +D  A  +      HHR      K+ K++ ++        +N Q+
Sbjct: 10  VEEKHMYTEPAGTFFHDVEASQT------HHRRGSLSLKDEKSKELYPLRSFPNGVNGQD 63

Query: 47  NMSEVESLYGNDD-----PDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSL 101
             S  E +   D+      +VKR+LK RH+ MI+LGGTIGTGLF+G+++P+  AGPVG+L
Sbjct: 64  TFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGAL 123

Query: 102 LAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFAL 161
           ++YLFMG++A+ VTQSLGEMATFIPVTSSFT+++QRFLSPA GAANGY+YWFSW VTFAL
Sbjct: 124 ISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFAL 183

Query: 162 ELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLI 221
           ELS++GQ+IQ+WT+AVPL+ WI +FW+++TA NM PV++YGE EFW+A++KV++I GFLI
Sbjct: 184 ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLI 243

Query: 222 YALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281
           Y   MVCG    G +GFRYW+NPG WG G+IS NK EARFLGWVSSLI AAFT+QGTELV
Sbjct: 244 YCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303

Query: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPF 341
           GITAGE+ NPRKTVP+AI KV FRIL FYI SL F+GLLVPY DP+L T++ S ++TSPF
Sbjct: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TSATSYVSTSPF 362

Query: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401
           ++AI+NSGTKVLP +FN VIL TI+SA NSNIY+GSRVL+GLSKS LAP  F KT K GV
Sbjct: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422

Query: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461
           P+ AV  +SIFG LAY+  S    KVF WLL IT VAGFFAWL IS+SHIRFMQ LK RG
Sbjct: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482

Query: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWL 521
           ISR++LPFKAK MP  AYYA FF+ VIILIQGF SF P F    F+A YISVFLF+  W+
Sbjct: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWI 542

Query: 522 GFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
            F+++F+ R + + EDVDID+DRR+I+A+VW ++ EPKTL  K W 
Sbjct: 543 LFELIFRCRFVWKIEDVDIDSDRRDIEAIVW-EEPEPKTLWDKFWN 587

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/551 (63%), Positives = 432/551 (78%), Gaps = 5/551 (0%)

Query: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISL 76
           ND  + +S + ++   +++T             + E L   +  DVKR LK RH+ MI+L
Sbjct: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELL---EHHDVKRSLKQRHIGMIAL 80

Query: 77  GGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQ 136
           GGTIGTGLF+GIA+P+  AGPVG+L+AYLFMGT+ F VTQSLGEMATFIPVTSSF+++ Q
Sbjct: 81  GGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQ 140

Query: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMI 196
           RFLSPALGAANGY+Y+ SWC TFALELS++GQ+IQ+WTF VPL+ WI +FW+LLTA NM 
Sbjct: 141 RFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMF 200

Query: 197 PVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNK 256
           PV+FYGE EFWIA++KVL++ GFLIY+L +VCG    G +GFRYW+NPG  G G+ISSN 
Sbjct: 201 PVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNT 260

Query: 257 YEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFF 316
            EARFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK VP+AI KV  RIL FYI SLFF
Sbjct: 261 GEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFF 320

Query: 317 VGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIG 376
           +GL VPY DP+L T++DS +++SPF++ IQN+GT+VLP +FN VIL TI+SAGNSN+Y+G
Sbjct: 321 IGLTVPYNDPKL-TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVG 379

Query: 377 SRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITA 436
           SR+L+ ++K+GLAP    KT  QGVP+ +VL  S FG L+Y+ +S    K F+WLL IT 
Sbjct: 380 SRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITG 439

Query: 437 VAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDS 496
           VAGFFAWLLIS SH+RFMQ LK RGISR+DLP+KA +MPW AYYA FF+ VIILIQGF S
Sbjct: 440 VAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTS 499

Query: 497 FAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDD 556
           FAP F   +F+A YISV LF+V W  FQ+ F+ R+I + EDVDIDTDRREI+++VW +DD
Sbjct: 500 FAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVW-EDD 558

Query: 557 EPKTLLQKLWQ 567
            PKTL  K W 
Sbjct: 559 APKTLWDKFWD 569

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/569 (61%), Positives = 441/569 (77%), Gaps = 14/569 (2%)

Query: 2   VENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD 61
           +E    E  P   ++  +  E  ESS +         +G+   Q  +    S     +  
Sbjct: 1   MEMQSFEKQPQLHKNEIKVMEEGESSSL--------ADGVLEQQSQIDTASS----QERG 48

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           ++R LKPRH+SMI+LGGTIGTGLF+GIA+P+R AGPVGSL++YLFMG++AF VTQSLGEM
Sbjct: 49  IQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEM 108

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSV 181
           ATFIPV SSFT++T+RFLSPALGAANGY+Y FSWC+TFALELSI+G++IQYWT  VP + 
Sbjct: 109 ATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAA 168

Query: 182 WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYW 241
           WI++FW+ ++ SN++ V+FYGE +FWIA +KV++I GFLIY L MVCG    G +GFRYW
Sbjct: 169 WIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPVGFRYW 228

Query: 242 KNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 301
           +NPGPWG G+IS +K E RFLGWVSSL+ AAFTYQGTELVG++AGES NPRKTVPKAI K
Sbjct: 229 RNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRK 288

Query: 302 VFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVI 361
           VF RIL FY+ SLFF+GLLVP+ DP+L +T++    +SPF++AIQNSGT+ LP +FN VI
Sbjct: 289 VFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYS-ASSPFIIAIQNSGTRALPDIFNAVI 347

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           L TI+SA NSN+Y+GSRVLYGL+K GLAP +  + N+ GVP+  V   S+FG L YL++S
Sbjct: 348 LTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVS 407

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
             + K FDWLL ITA+AGFFAWL ISL HIRFMQ LK +GISR+DLPFKAK MPWGAYYA
Sbjct: 408 SGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYA 467

Query: 482 AFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDID 541
           AFFI +II+IQGF +FAP+F  S F A Y+SVFLFI  W+ FQV+FK+RLI + EDVDID
Sbjct: 468 AFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDID 527

Query: 542 TDRREIDALVWSDDDEPKTLLQKLWQSFS 570
           +DRREI+A VW +DDEP  L  K W + +
Sbjct: 528 SDRREIEAEVW-EDDEPTNLWGKFWAAMA 555

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/578 (61%), Positives = 454/578 (78%), Gaps = 16/578 (2%)

Query: 1   MVENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGND-- 58
           + + +ELE   A   H++ S   S  S  +H      ++ +  +++N   +E++  +   
Sbjct: 4   IAQQIELEELEA--LHSNLSQSQSARSG-MHVSNSKIDDPLRFSKDNNLTLEAIDDDSSR 60

Query: 59  --DPD-------VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGT 109
             DP+       VKR LKPRH+SMI+LGGTIGTGLF+ I+ P+  AGPVGSL+A++ +GT
Sbjct: 61  MFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGT 120

Query: 110 IAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQL 169
           +A+ VTQSLGEMATFIPVTSSFT+++QRF+SPA+GAANGY+YWFSW +TFALELSI+GQ+
Sbjct: 121 LAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQI 180

Query: 170 IQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCG 229
           IQYWT AVPL  WI +FW+LL + NM PV++YGE EFW+A++KV++I GFLIY+L MVCG
Sbjct: 181 IQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCG 240

Query: 230 GSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESK 289
              EG +GFRYW+ PGPWG G+I+ N  +ARFLGWVSSLI AAFTYQGTELVGITAGE+K
Sbjct: 241 AGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETK 300

Query: 290 NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSD-SDINTSPFVMAIQNS 348
           NPRK VP+AINKVFFRIL FYI SLFF+GLLVPY DP+L  + + S I  SPF++AI N 
Sbjct: 301 NPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNC 360

Query: 349 GTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLT 408
            T VLP +FN VIL TI+SAGNSN+Y+GSR+L+GLSK+ LAP  F KT K GVPF AVL 
Sbjct: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420

Query: 409 SSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLP 468
           +++FG LAYLN+S +A++VFDWLL ITA+AGF  WLLIS+SHIRFMQ LK RGISR+DLP
Sbjct: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480

Query: 469 FKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFK 528
           +KAKFMP+ AYYAAFFITVII+IQGF +FAP F  S+F A YISVFLF + W  FQ +++
Sbjct: 481 YKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYR 540

Query: 529 TRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLW 566
           T+L    ++VDID+DRR+ID ++W +++EPK L +K W
Sbjct: 541 TKLFRTLDEVDIDSDRRDIDVIIW-EEEEPKNLWEKFW 577

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/510 (65%), Positives = 417/510 (81%), Gaps = 2/510 (0%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
            D +VKR+LK RH+ MI+LG TIGTGLF+G+++P++ AGPVG+L++Y+FMGT+ + VTQS
Sbjct: 69  HDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQS 128

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGEMATFIPVTSSFT++ QRFLSP++GAA GY+YWFSW VTFALELS+IGQ+IQYWT+AV
Sbjct: 129 LGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAV 188

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALG 237
           PL+ WI +FW+++TA NM PV++YGE+EFWIA +KV++I GFL+Y L MVCG    G +G
Sbjct: 189 PLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPVG 248

Query: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297
           FRYW+NPGPWG G+IS +K EARFLGWVSSLI  AFTYQGTELVGI+AGE+ NPRK VP+
Sbjct: 249 FRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPR 308

Query: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357
           AI KV FRILFFYI SLFF+GLLVPY D  L+ T DS + +SPF++AI+NSGT VLP +F
Sbjct: 309 AIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNT-DSYVASSPFIIAIKNSGTPVLPHIF 367

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N VI  TI+SAGNSN+Y+GSR+L+GLSK+ LAP +  +T K GVP+ AVL +S+ G LAY
Sbjct: 368 NAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAY 427

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
           +  S   +  F+WLL ITAVAGFF WL ISLSHIRFMQ LK RGISR+DLPFKA  MP  
Sbjct: 428 METSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGL 487

Query: 478 AYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKED 537
           AYYA+F + VII+IQGF +FAP+F  S+F A YIS+FLFI  W  FQ++F+ R I + ED
Sbjct: 488 AYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVED 547

Query: 538 VDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
           VDIDTDRR+I+A+VW +D EPKT+  K W 
Sbjct: 548 VDIDTDRRDIEAVVW-EDAEPKTVWDKFWN 576

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/569 (60%), Positives = 440/569 (77%), Gaps = 12/569 (2%)

Query: 2   VENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD 61
           V + EL++  A  +   +S   + S  +    +   N G    +E++             
Sbjct: 43  VASFELKSTNA-SEAASQSTSPTGSELIPDCLQSATNTGTLCTEEHVKH---------RS 92

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           VKR LKPRH++MI+LGGTIGTGLFMGIA P+R AGPVG+L+AY+F+GTI F VTQSLGEM
Sbjct: 93  VKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQSLGEM 152

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSV 181
            TFIPVTSSFT+++ RFLSPA GAANGY+YWFSW +TFA+ELS++G++IQ+WT AVPL+ 
Sbjct: 153 VTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTAVPLAA 212

Query: 182 WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYW 241
           WIV+FW LLT SNM PV++YGEIEFWIA LKVLS+ GFLI+ L +  G    G  GFRYW
Sbjct: 213 WIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGPFGFRYW 272

Query: 242 KNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 301
           ++PG WG G+I+ ++ EARFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK VPKAI K
Sbjct: 273 RDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPKAIKK 332

Query: 302 VFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVI 361
           V  RILFFY+ SLFF+G+LVP+ DP+L T++ S +++SPF++AIQNSG  +LPS+FNGVI
Sbjct: 333 VILRILFFYVGSLFFIGMLVPFNDPKL-TSATSFVSSSPFIIAIQNSGVSLLPSIFNGVI 391

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           L+TI+SAGNSN+Y+GSR+L+GL+ S LAP  F +T K GVPF AVL +S+FG LA+L ++
Sbjct: 392 LITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAFLELT 451

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
            +  KVF+WLL+I A+AGFFAWLLISLSHIRFM+ L+ RGISRN LPFKA FMPW AYYA
Sbjct: 452 TDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWLAYYA 511

Query: 482 AFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDID 541
             FI +IILIQGF +FAP F  S+F+A YIS+ LF++ W  FQ + K R+  + ED+D+D
Sbjct: 512 TAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVEDIDLD 571

Query: 542 TDRREIDALVWSDDDEPKTLLQKLWQSFS 570
           +DR++I+ + W +DD PKT   K+WQ+ +
Sbjct: 572 SDRKDIEDIRW-EDDSPKTFWTKVWQTLA 599

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/567 (61%), Positives = 438/567 (77%), Gaps = 9/567 (1%)

Query: 7   LETYPAGKQHNDRSAES--SESSDVLHHRKE----TKNEGIFINQENMSEVESLYGNDDP 60
           L    A + H  R + S   E S  L+  +        +  F  +EN+ + E      + 
Sbjct: 24  LHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQD-EDEGEVQNA 82

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           +VKR+LK RH+ MI+LGGTIGTGLF+G+++P+  AGPVG+L+AYLFMG++AF VTQSLGE
Sbjct: 83  EVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGE 142

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           MATFIPVTSSFT+++QRFLSPA GAANGY+YWFSW +TFALELS++GQ+IQ+WT  VPL+
Sbjct: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLA 202

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240
            WI +FW+L+T  N+ PV++YGE EFW+A++KV++I GFLIY   MVCG    G +GFRY
Sbjct: 203 AWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRY 262

Query: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300
           W+NPG WG G+IS NK E RFLGWVSSLI AAFT+QGTELVGITAGE+ NPRKTVP+AI 
Sbjct: 263 WRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 322

Query: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360
           KV FRIL FYI SL F+GLLVPY DP+L T + S ++TSPF++AIQNSGTKVLP +FN V
Sbjct: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKL-TEATSYVSTSPFIVAIQNSGTKVLPHIFNAV 381

Query: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420
           IL TI+SA NSNIY+GSR+L+GLSK+ LAP    +T+K GVP+ AV  +++FG LAY+  
Sbjct: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMET 441

Query: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480
           S    KVF+WLL IT VAGFFAWL IS+SHIRFMQ LK RGISR++LPFKAK MP  AYY
Sbjct: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501

Query: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540
           ++FF+ +II+IQGF +FAP+F  S F+A YIS+FLFI  W+ F+ +F+ R I + EDVDI
Sbjct: 502 SSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDI 561

Query: 541 DTDRREIDALVWSDDDEPKTLLQKLWQ 567
           D+DRR+I+A+VW +D EPKT   K W 
Sbjct: 562 DSDRRDIEAIVW-EDHEPKTFWDKFWN 587

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/560 (61%), Positives = 429/560 (76%), Gaps = 6/560 (1%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLK 67
           ET     +   +S ES E  D L   ++        ++EN+SE E    ++  +VKRDL 
Sbjct: 10  ETLEGKSKIVIKSTESLEQHD-LQGNEDKNTPTTTPSKENVSENEK---DEYHEVKRDLS 65

Query: 68  PRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPV 127
            RH++MI+LGGTIGTGLF+GIA+P+ ++GPVGSL+AYLF+GT+ + VTQSLGEMATFIPV
Sbjct: 66  KRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPV 125

Query: 128 TSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFW 187
           T+SFT+++ RFLSPALGAANGY+YWFSW +TFALELS++GQ+IQ+WTFAVPL  WI +FW
Sbjct: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185

Query: 188 ILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPW 247
           ++LT SN+ PVR YGEIEFWIA LKV +I GF+IY   +VCG    G +GFRYW+NPGPW
Sbjct: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPW 245

Query: 248 GMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRIL 307
           G G+ISSN  EARFLGW SSLI AAFT+QGTELVGITAGE+ NPR+TVPKAI KV FRIL
Sbjct: 246 GTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRIL 305

Query: 308 FFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILS 367
            FYILSLFF+GLLVPY D +L  + +S +++SPF++AI+NSGTK+LP +FNGVILVTI+S
Sbjct: 306 VFYILSLFFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIIS 364

Query: 368 AGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKV 427
           AGNSN+YIGSR+L+GL+K+G  P LF KT K GVP +AV+ +S+FG LA++  S    + 
Sbjct: 365 AGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEA 424

Query: 428 FDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITV 487
           F WLL +  VAGFF+WLLIS +HIRFMQ L+ RGISRNDLPFKAKFMP+ AYYA   + +
Sbjct: 425 FQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMII 484

Query: 488 IILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREI 547
           II  QGF +FAP+F    F A YISVFLF + W  FQ+ FK R + +  D+DID DRREI
Sbjct: 485 IIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKDRREI 544

Query: 548 DALVWSDDDEPKTLLQKLWQ 567
           +  VW  D  P  L  K W 
Sbjct: 545 EDRVW-QDTTPANLWGKFWD 563

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/586 (58%), Positives = 441/586 (75%), Gaps = 28/586 (4%)

Query: 2   VENVELETYPAGKQHNDRSAESSESSDVLHHR------KETKNEGIF--------INQEN 47
           +E   +   P     +D  A  +      HHR      K+ K++ ++        +N E+
Sbjct: 10  IEEKHMYNEPVTTLFHDVEASQT------HHRRGSIPLKDEKSKELYPLRSFPTRVNGED 63

Query: 48  MSEVESLYGNDD------PDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSL 101
              +E   G++D       +VKR+LK RH+ MI+LGGTIGTGLF+G+++P+  AGPVG+L
Sbjct: 64  TFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGAL 123

Query: 102 LAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFAL 161
           ++YLFMG++A+ VTQSLGEMATFIPVTSSFT+++QRFLSPA GAANGY+YWFSW +TFAL
Sbjct: 124 ISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFAL 183

Query: 162 ELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLI 221
           ELS++GQ+IQ+WT+ VPL+ WI +FW+++T  N+ PV++YGE EFW+A++KVL+I GFLI
Sbjct: 184 ELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLI 243

Query: 222 YALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281
           Y   MVCG    G +GFRYW+NPG WG G+IS +K E RFLGWVSSLI AAFT+QGTELV
Sbjct: 244 YCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELV 303

Query: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPF 341
           GITAGE+ NPRK+VP+AI KV FRIL FYI SL F+GLLVPY DP+L T S S ++TSPF
Sbjct: 304 GITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTSPF 362

Query: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401
           ++AI+NSGTKVLP +FN VIL TI+SA NSNIY+GSR+L+GLSK+ LAP    +T K GV
Sbjct: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGV 422

Query: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461
           P+ AV  ++ FG LAY+  S    KVF+WLL IT VAGFFAWL IS+SHIRFMQ LK RG
Sbjct: 423 PYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRG 482

Query: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWL 521
           ISR++LPFKAK MP  AYYAA F+T+II+IQGF +FAP+F    F A YIS+FLF+  W+
Sbjct: 483 ISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWI 542

Query: 522 GFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
            FQ +F+ R I +  DVDID+DRR+I+A+VW +D EPKT   K W 
Sbjct: 543 LFQCIFRCRFIWKIGDVDIDSDRRDIEAIVW-EDHEPKTFWDKFWN 587

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/555 (63%), Positives = 432/555 (77%), Gaps = 7/555 (1%)

Query: 18  DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGN-DDPDVKRDLKPRHMSMISL 76
           +   + S SS +       K E   +   N SEVESL    +  DVKR+LKPRH++MISL
Sbjct: 7   EPKGDGSSSSTITAKPGAIKAE---VLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISL 63

Query: 77  GGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQ 136
           GGTIGTGLF+GIASPIR AGPVGSLLAY+F+ T+A+CVTQSLGEMATFIPVTSSFT++  
Sbjct: 64  GGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFAS 123

Query: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMI 196
           RF+SPALGAANGYLYW SWC+TFALE+S+IG+LI YW+ AVP++ W+ +FW+LLTA N+I
Sbjct: 124 RFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLI 183

Query: 197 PVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNK 256
           PV+FYGE EFWIA+LKV++I  FL Y LV+VCGGS  G +GFRYWK+PGPWG+G++S   
Sbjct: 184 PVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEI 243

Query: 257 YEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFF 316
           + A+FLGWVSSLIKAAFT+QGTELVG+TAGE+KNPR+TVPKAIN VFFRIL FYI SL  
Sbjct: 244 HTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLV 303

Query: 317 VGLLVPYTDPRL-STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYI 375
           +GLLV Y DP+L    S ++ N SPFV+AI  +GTKVLP + NGVI+VTI+SAGNSNIY+
Sbjct: 304 IGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363

Query: 376 GSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTIT 435
           GSRVLYGL +SGLAP+   +T  +GVP+ AVL +S+FG L YLN+S  +  VFDWLL+IT
Sbjct: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423

Query: 436 AVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFD 495
           AV+GFF WLLIS+SHIRFMQ LK RGISR+DLPFKAKFMP+GAYYAAFF+ VIIL+QGF 
Sbjct: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483

Query: 496 SFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDD 555
           +F P F   +F+A YIS F+F+V WL FQ LFK R      D       R     +  DD
Sbjct: 484 AFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRW-FHTVDEIDIDTDRRDIDAIIWDD 541

Query: 556 DEPKTLLQKLWQSFS 570
           D+P TL  K+W   S
Sbjct: 542 DKPTTLWGKIWYHLS 556

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/521 (62%), Positives = 423/521 (81%), Gaps = 3/521 (0%)

Query: 49  SEVESLYGN-DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFM 107
           S+ ES  G+  +  VKR LKPRH+SMI+LGGTIGTGLF+GIASP+  +GPVG+L+AY+FM
Sbjct: 101 SDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFM 160

Query: 108 GTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIG 167
           GT+ + VTQS+GEMATFIPVTSS T+++ RFLSPA G ANGY+YWF+W +TFA+ELS+ G
Sbjct: 161 GTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTG 220

Query: 168 QLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMV 227
           Q+I+YWT AVP + WI +FW+L+T +N  PV+FYGE+EFW+A++KVL+I G+LIYALV+V
Sbjct: 221 QVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIV 280

Query: 228 CGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGE 287
           CGGS +G +GFRYW+NPGPWG G+IS +K E RFLGWV+SLI A+FTYQGTELVGITAGE
Sbjct: 281 CGGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGE 340

Query: 288 SKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQN 347
           + NPR+TVP+AINKVFFRILFFYILSLFFVGLLVPY    L  T+ + I +SPFV++IQN
Sbjct: 341 AANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTT-TVIASSPFVISIQN 399

Query: 348 SGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVL 407
           +GT+ LP +FN V+LVTI+SA NSN+Y+GSRVL+ L+ +G+AP +F     QGVPF  V+
Sbjct: 400 AGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVI 459

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
            +S+ G LA+L ++ NA + F+WL+ I+ +AG  AWL IS+SHIRFMQ LK RGISR+DL
Sbjct: 460 VTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDL 519

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLF 527
           PFK+K MP+GAYYAAF++TVII +QGF +F+P F  +EF   YIS+ L +V + G Q+ +
Sbjct: 520 PFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFY 579

Query: 528 KTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQS 568
           + R   R ED+DID+DRRE DAL+W +DDEP TL  K W +
Sbjct: 580 RCRFFNRLEDIDIDSDRREADALIW-EDDEPTTLWGKFWTA 619

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/562 (61%), Positives = 431/562 (76%), Gaps = 19/562 (3%)

Query: 6   ELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRD 65
           EL+ YP  ++ N  S  S  S   +  ++E    G       + E E         VKR+
Sbjct: 20  ELDDYPLHRRTN--SVHSIPSQITIESQEEEIANG------QIREAE---------VKRE 62

Query: 66  LKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFI 125
           LK RH+ MI+LGGTIGTGLF+G+++P+  AGPVG+L+AYLFMGT+ + VTQSLGEMATFI
Sbjct: 63  LKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFI 122

Query: 126 PVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVV 185
           PVTSSFT+++QRFLSP+ GAANGY+YWFSW +TFALELS++GQ+IQ+WT AVP+  WI +
Sbjct: 123 PVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISI 182

Query: 186 FWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPG 245
           FW+LL A NM PVRFYGE EFW+A++KVL+I GFLIY L MVCG    G +GFRYW+NPG
Sbjct: 183 FWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPG 242

Query: 246 PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFR 305
           P G G+I+ N  EA+FLGWVSSLI AAFTYQGTELVGITAGE+ NPRK+VP+AI KV FR
Sbjct: 243 PMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFR 302

Query: 306 ILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTI 365
           ILFFYI SLFF+GLLVPY DP+L T+ DS +  SPF+++IQNSGT +LP +FN VIL TI
Sbjct: 303 ILFFYIGSLFFIGLLVPYNDPKL-TSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTI 361

Query: 366 LSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAK 425
           +SA NSN+Y+GSR+++GLSKS LAP +  +TNK GVP+ +V+ + +FG LAY+  S   +
Sbjct: 362 ISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGE 421

Query: 426 KVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFI 485
             F+WLL IT VAGFF+WL IS+SH+RFMQ L+ RGISR+DLPFKAKFMP  AYYA FF+
Sbjct: 422 AAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFM 481

Query: 486 TVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRR 545
           T+II+IQGF SF P F   +F+A YIS FLFI  W+ FQ+ F+ RLI + EDVDIDTDRR
Sbjct: 482 TLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRR 541

Query: 546 EIDALVWSDDDEPKTLLQKLWQ 567
           +I+ +VW +D  P T   K W 
Sbjct: 542 DIEEVVW-EDPPPVTFWDKFWN 562

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/534 (62%), Positives = 427/534 (79%), Gaps = 8/534 (1%)

Query: 34  KETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIR 93
           ++T + G  I  E+  EV       + +VKR+LK RH+ MI+LGGTIGTGLF+G++ P+ 
Sbjct: 62  EDTFSMGDVIRDEDQGEVR------NAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLA 115

Query: 94  VAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWF 153
            AGPVG+L++YLFMG++A+ VTQSLGEMATFIPVTSSFT+++QRFLSPA GAANGY+YWF
Sbjct: 116 NAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWF 175

Query: 154 SWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKV 213
           SW +TFALELS++GQ+I++WT  VPL+ WI +FW+++T  N+ PV++YGE EFW+A++KV
Sbjct: 176 SWAITFALELSVVGQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKV 235

Query: 214 LSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAF 273
           L+I GFLIY   MVCG    G +GFRYW+NPG WG G+IS +K E RFLGWVSSLI AAF
Sbjct: 236 LAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAF 295

Query: 274 TYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSD 333
           T+QGTELVGITAGE+ NPRKTVP+AI KV FRIL FYI SL F+GLLVPY DP+L TT+ 
Sbjct: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TTAT 354

Query: 334 SDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLF 393
           S ++ SPF++AI+NSGTKVLP +FN VIL TI+SA NSNIY+GSR+L+GLSK+ LAP   
Sbjct: 355 SYVSVSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414

Query: 394 KKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRF 453
            +T K GVP+ AV  +++FG LAY+  S    KVF+WLL IT VAGFFAWLLIS+SHIRF
Sbjct: 415 SRTTKGGVPYIAVFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRF 474

Query: 454 MQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISV 513
           MQ LK RGISR++LPFKAK MP  AY+AA F+ +IILIQGF +FAP+F   +F+A YIS+
Sbjct: 475 MQALKYRGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISI 534

Query: 514 FLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
           FLF+  W+ F+++F+ R I + EDVDID+DRR+I+A+VW +D EPKT   K W 
Sbjct: 535 FLFLAIWILFEIIFRCRFIWKIEDVDIDSDRRDIEAIVW-EDHEPKTFWDKFWN 587

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/509 (66%), Positives = 413/509 (81%), Gaps = 3/509 (0%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           DVKR+LK RH+SMI+LGGTIGTGLF+GIA P+ +AGP+G+L+AYLFMGT+ F VTQSLGE
Sbjct: 34  DVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQSLGE 93

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           M TFIPVT+SFT++ QRFLSPA GAANGY+YWFSW +TFALELS++GQ+IQ+WT AVPL+
Sbjct: 94  MCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLA 153

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240
            WI + W+LLT SN+ PVR YGEIEFWIA++KVL+I GF+IY + ++CG    G +GFRY
Sbjct: 154 AWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVTGPVGFRY 213

Query: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300
           WKNPGPWGMG+ISSN  EARF GWVSSLI AAFT+QGTELVGITAGE + PRKTVPKAI 
Sbjct: 214 WKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIK 273

Query: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360
           KV FRIL FYI SL  +GLLVPY DP+L  ++DS +++SPF++ IQN+GTK+LP +FN V
Sbjct: 274 KVVFRILVFYIGSLLVIGLLVPYNDPKLQ-SNDSYVSSSPFIITIQNAGTKILPHIFNAV 332

Query: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420
           IL+TI+SAGNSN+YIGSR+LYGL+K+  AP  F  T+K GVP+  VL +S+FG LAY+  
Sbjct: 333 ILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMET 392

Query: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480
           +    K F WLL I  VAGFFAWLLIS SHIRFM+ LK RGISRNDLP+KA  MPW AYY
Sbjct: 393 TTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYY 452

Query: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540
           A FF+ +II+IQGF SFAP+F  + F A YISVFLFI+ W+ FQ+ FK RL+ + +DVD+
Sbjct: 453 AVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDL 512

Query: 541 DTDRREIDALVWSDDDEPKTLLQKLWQSF 569
           DTDRR+I+  VWSDD E K   +  W  F
Sbjct: 513 DTDRRDIEEEVWSDDVEDKN--KNWWDRF 539

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/537 (62%), Positives = 423/537 (78%), Gaps = 12/537 (2%)

Query: 31  HHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIAS 90
           H++     E I   +E   EVE+        V+R+LK RHM MI+LGGTIGTGLF+G+++
Sbjct: 5   HNQDSKMKEEI---REISVEVEA------ETVRRELKQRHMGMIALGGTIGTGLFIGVST 55

Query: 91  PIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYL 150
           P+  AGPVG+L+AYLFM T+A+ VTQSLGEMATFIPVTSSFT+++QRF+SPA GAANGY+
Sbjct: 56  PLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYM 115

Query: 151 YWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAA 210
           YWFSWC+TFALELS++GQ+IQ+WTFAVPL+ WI +FW+LLT  NM PV++YGE EFW+A 
Sbjct: 116 YWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVAL 175

Query: 211 LKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIK 270
           +KV++I GFLIY   MVCG    G +GFRYW++PG +G G+I+ +K +ARFLGWVSSLI 
Sbjct: 176 VKVVAIMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLIN 235

Query: 271 AAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLST 330
           AAFT+QGTELVGITAGE+ NPRKTVP+AI KV FRILFFYILSLFF+GLLVPY D +L T
Sbjct: 236 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKL-T 294

Query: 331 TSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAP 390
           ++DS ++ SPF++AI+NSGT VLP +FN VI+ TI+SAGNSNIY+GSR++YGLS S LAP
Sbjct: 295 STDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAP 354

Query: 391 SLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSH 450
            +  +T + GVP+ AVL +S+FG LAY+  S   +K F+WLL IT VAGFF WL ISLSH
Sbjct: 355 GILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSH 414

Query: 451 IRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADY 510
           IRFMQ L+ RGISR+DLPFKAK+MP  AYY  FF+T+II+IQGF SF P +   +F+  Y
Sbjct: 415 IRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAY 473

Query: 511 ISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
           ISVF+FI  W+ FQ  F+ RLI R EDVDIDTDRR ++  VW  + EP+    K W 
Sbjct: 474 ISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWI-EQEPRGFWDKFWN 529

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/579 (58%), Positives = 447/579 (77%), Gaps = 26/579 (4%)

Query: 6   ELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGN-------- 57
           ++E  P+ +  N++   ++E++    H+K+T + G     + +S   +L  +        
Sbjct: 27  DIEIIPS-RYDNEKFYSATEAT----HKKKTGSTGF---DDTISLTHTLSRSRIPTSMED 78

Query: 58  --------DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGT 109
                    D  VKR LK RH+ MI+LGGTIGTGLF+GI++P+  +GPVG+L+AY+FMGT
Sbjct: 79  EDAEEAEVHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGT 138

Query: 110 IAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQL 169
           I + VTQSLGEMATFIPVTSS T++++RFLSPA G ANGY+YWF+W +T+A+E+S+IGQ+
Sbjct: 139 IIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQV 198

Query: 170 IQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCG 229
           IQYWTF VPL+ WI +FW+L+T  N  PV+ YGE EFW+A++KV++I G+LIYAL++VCG
Sbjct: 199 IQYWTFKVPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCG 258

Query: 230 GSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESK 289
           GS +G +GFRYW+NPG  G G+ISS+  EARFLGWVSSLI AAFTYQGTELVGITAGE+ 
Sbjct: 259 GSHQGPIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAA 318

Query: 290 NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSG 349
           NPRK+VP+AINKV FRI+ FYI+SLFFVGLLVPY DPRLS +S + I +SPFV++IQN+G
Sbjct: 319 NPRKSVPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASS-AVIASSPFVISIQNAG 377

Query: 350 TKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTS 409
           TKVLP +FN V+LVT++SA NSN+Y+GSRVLY L++SG AP  F    + GVP+  V+ +
Sbjct: 378 TKVLPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICT 437

Query: 410 SIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPF 469
           ++ G LA+L ++ NA   F+WL+ I+ +AG  AWL ISL+HIRFMQ LK RGISR+DLPF
Sbjct: 438 ALLGLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPF 497

Query: 470 KAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKT 529
           KAKFMPWGAYYA+FF+TVII IQGF +FAP+F  SEF   YIS+ L +V + G Q+ ++ 
Sbjct: 498 KAKFMPWGAYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRC 557

Query: 530 RLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQS 568
           R + + ED+DID+DRREIDA+VW +DDEP+ L +K W +
Sbjct: 558 RFLWKLEDIDIDSDRREIDAIVW-EDDEPQNLWEKFWAA 595

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/570 (57%), Positives = 439/570 (77%), Gaps = 22/570 (3%)

Query: 15  QHNDRSAES-------SESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLK 67
           QHND    S       SE + + H    ++ E    + E+  E +     +D  VKR+LK
Sbjct: 36  QHNDSKDNSIKKKIPNSELASLTHAYSRSRVEPE--HDEDAEEADY----EDKQVKRELK 89

Query: 68  PRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPV 127
            RH+ MI+LGGTIGTGLF+GIA+P+  AGPVG+L+AY+FMG+I + VTQ+LGEMATFIPV
Sbjct: 90  QRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPV 149

Query: 128 TSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFW 187
           TSS T+++QRFLSPA G ANGY+YWF+W +TFA+E+S++GQ+IQYWT AVPL+ WI +FW
Sbjct: 150 TSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFW 209

Query: 188 ILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSS-EGALGFRYWKNPGP 246
           +L+T  N  PV+ YGE+EFW+A +KV++I G+L+YAL++VCGGS  +G +GFRYW+NPG 
Sbjct: 210 VLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGA 269

Query: 247 WGMGMIS------SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300
           WG G+ S      S+KYE RFLGWV+SLI AAFTYQGTELVGITAGE+ NPRKTVP+AIN
Sbjct: 270 WGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 329

Query: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360
           KV FRI+ FYI+SLFF+GLLVP+TD RLS  + + I +SPFV++I+N+GTK+LP +FN +
Sbjct: 330 KVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDT-TVIASSPFVISIENAGTKILPDIFNAI 388

Query: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420
           ++VT+LSA NSN+Y+GSRVLY L+ + +AP +F +  +QGVPF  V+ +S+ G LA+L +
Sbjct: 389 VMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVV 448

Query: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480
             NA   F+WL+ I+ +AG  AWL ISL+H+RFMQVLK RGISR+DLPFKAKFMPWG+YY
Sbjct: 449 DNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYY 508

Query: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540
           AAF++ VII +QGF +F+P F  + F  DYIS+ L  V ++G Q+ ++ R + + EDVDI
Sbjct: 509 AAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDI 568

Query: 541 DTDRREIDALVWSDDDEPKTLLQKLWQSFS 570
           D+DRREI+  +W +DDEPKT+  K W + +
Sbjct: 569 DSDRREIEDAIW-EDDEPKTIWDKFWAAIA 597

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/584 (58%), Positives = 434/584 (74%), Gaps = 28/584 (4%)

Query: 3   ENVELETYPAGK--QHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGN--- 57
           ++V  E Y  G     ND  + S ++  + H +K   ++   ++       ESL G    
Sbjct: 6   QDVSEEGYELGNFSGMNDEDSSSGQAGAINHRKKSVVSKTTAVD-------ESLPGLSSS 58

Query: 58  --------------DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLA 103
                          + +VKR LK RH+ MI+LGGTIGTGLF+GI++P+  AGPVG L+A
Sbjct: 59  DLESSDDFVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIA 118

Query: 104 YLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALEL 163
           YLFM T+ + V QSLGEMATFIPVTS+FT+++ RFLSPA GAA+GY+YWFSW +TFALEL
Sbjct: 119 YLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALEL 178

Query: 164 SIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYA 223
           S++GQ+I++WT AVP++ WI +FW+LLT SN+ PV++YGE EFWIA +KV+++ GF+IY 
Sbjct: 179 SVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYC 238

Query: 224 LVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           L MVCG    G +GFRYW+NPG WG G+IS +K E RFLGWVSSLI AAFTYQGTELVGI
Sbjct: 239 LCMVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGI 298

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVM 343
           TAGE+ NPRK+VP+AI KV FRIL FY     F+GLLVPY DP+L+++  S +++SPF++
Sbjct: 299 TAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSD-SYVSSSPFII 357

Query: 344 AIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPF 403
           AI+NSGTKVLP +FN V+L TI+SAGNSN+Y+GSR++YGL+K  LAPS F +TN  GVP+
Sbjct: 358 AIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPY 417

Query: 404 YAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGIS 463
           +AV  +S FG LAY+ +S      F+WLL IT VAGFF W+LIS  HIRFMQ LK RGIS
Sbjct: 418 FAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGIS 477

Query: 464 RNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGF 523
           R+DLPFKAKFMPW AYYA FF+ VIILIQGF +FAP F   +F A Y+SVFLFI  WLG 
Sbjct: 478 RDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGA 537

Query: 524 QVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
           Q+ F+ R+  R ++VDIDTDRR+I+A+VW DD+ PKTL  K W 
Sbjct: 538 QIWFRCRIFHRLDEVDIDTDRRDIEAVVW-DDEPPKTLWDKFWN 580

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/556 (58%), Positives = 432/556 (77%), Gaps = 9/556 (1%)

Query: 18  DRSAESSESSDVLHHRKETKNEGIFIN--QENMSEVESLYGNDDPD-----VKRDLKPRH 70
           D+S+E S        R +     ++ N  Q   S   S + +D+ D     VKR LKPRH
Sbjct: 3   DKSSELSSPLTQGKTRSDEFQMYVYSNETQNGGSGHNSSFEDDEGDLQEGQVKRALKPRH 62

Query: 71  MSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSS 130
           +SMI+LGGTIGTGLF+GIASP+  AGPVG+L+AY+FMG+I + VTQS+GEMATFIPVTSS
Sbjct: 63  VSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVTSS 122

Query: 131 FTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILL 190
            T+++ RFLSPA G ANGY+YWF+W +T+A+E+S+IGQ+IQYWT AVPL+ WI +FW+ +
Sbjct: 123 ITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVAI 182

Query: 191 TASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMG 250
           T +N  PVRFYGE+EFW+A++KV++I G+L+YAL++VCGGS +G +GFRYW+NPGPWG G
Sbjct: 183 TLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSKQGPIGFRYWRNPGPWGDG 242

Query: 251 MISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFY 310
           +IS +K + RFLGWV+SLI A+FTYQGTELVGITAGE+ NPRKTVPKAINKVFFRILFFY
Sbjct: 243 IISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFY 302

Query: 311 ILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGN 370
           ILSLFFVGLLVPY  P L   + S I +SPFV++IQ++GT++LP +FN V+LVTI+SA N
Sbjct: 303 ILSLFFVGLLVPYNHPGLDKHT-SVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAAN 361

Query: 371 SNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDW 430
           SN+Y+GSR+L+ L+ +G+AP  F     QGVP+  V+ +++ G LA+L +  NA + F+W
Sbjct: 362 SNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNW 421

Query: 431 LLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIIL 490
           L+ I+ +AG  AWL IS+SHIRFMQ LK RGISR+DLPFK+K MP+GAYYAAF++ VII 
Sbjct: 422 LINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIF 481

Query: 491 IQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDAL 550
           +QGF +F P+F  +EF   YIS+ L  V +   Q+ ++ R   R ED+DID+DRREIDAL
Sbjct: 482 VQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDAL 541

Query: 551 VWSDDDEPKTLLQKLW 566
           +W +++EP TL  K W
Sbjct: 542 IW-EEEEPTTLWGKFW 556

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/508 (63%), Positives = 414/508 (81%), Gaps = 3/508 (0%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
            VKR LK RH+ MI+LGGTIGTGLF+GI++P+  AGPVGSL+AY+FMGT+ + +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           MATFIPVTSS T++++RFLSPA G +NGY+YWF+W +T+A+E+S+IGQ+IQYWT  VPL+
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240
            WI +FW+L+T  N  PV+ YGE EFW+A++KVL+I G+LIYALV+VCGGS +G +GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300
           W+NPG WG G+IS NK E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+AIN
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360
           KV FRI+ FYI+SLFF+GLLVPY +PRLS +S + I +SPFV++IQN+GT  LP +FN V
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSS-AVIASSPFVISIQNAGTYALPDIFNAV 403

Query: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420
           +L+T++SA NSN+Y+GSRVLY L++SG AP  F    KQGVP+  VL+++  G LA+L +
Sbjct: 404 VLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVV 463

Query: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480
           + NA   F+WL++I+ +AG  AWL ISL+HIRFMQ LK RGISR+DLPFKAK MP+GAYY
Sbjct: 464 NNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYY 523

Query: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540
           A+FF+T+II IQGF +F P F  SEF   YIS+ L  V ++  Q+ +K R I + ED+DI
Sbjct: 524 ASFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDI 582

Query: 541 DTDRREIDALVWSDDDEPKTLLQKLWQS 568
           D+DRREI+A++W +DDEPK L +K W +
Sbjct: 583 DSDRREIEAIIW-EDDEPKNLWEKFWAA 609

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/508 (64%), Positives = 423/508 (83%), Gaps = 2/508 (0%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           + +VKR LKPRH+SMI+LGGTIGTGLF+GIASP+  +GPVG+L+AY+F+G+I + VTQSL
Sbjct: 53  ETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSL 112

Query: 119 GEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVP 178
           GEMATFIPVTSS T++++RFLSPA G ANGY+YWF+W +T+A+E++++GQ+IQYWT AVP
Sbjct: 113 GEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVP 172

Query: 179 LSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF 238
           L+ WI +FW+L+T +N  PV+FYGE+EFW+A++KV++I G+LIYALV+VCGGS +G +GF
Sbjct: 173 LAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSHQGPIGF 232

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           RYW+NPGPWG G+IS +  E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+A
Sbjct: 233 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 292

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
           INKVFFRILFFYILSLFF+GLLVPY D RLS T+ + I +SPFV++IQN+GTKVLP +FN
Sbjct: 293 INKVFFRILFFYILSLFFIGLLVPYDDLRLSNTT-AVIASSPFVISIQNAGTKVLPHIFN 351

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            ++++TI+SA NSN+Y+GSRVLY L+ SG AP  F    KQGVP+  V+ +++ G LA+L
Sbjct: 352 AIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFL 411

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
            ++ NA + F+WL+ I+ +AG  AWL ISLSH+RFMQ LK RGISR DLPFKAK MPWGA
Sbjct: 412 VVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGA 471

Query: 479 YYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDV 538
           YYAAFFI VII+IQGF +F P+F  S+F   YIS+ L  V +LG Q+ ++ R I   +D+
Sbjct: 472 YYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWSLDDI 531

Query: 539 DIDTDRREIDALVWSDDDEPKTLLQKLW 566
           DID+DRREIDA+VW +DDEPK L +K W
Sbjct: 532 DIDSDRREIDAIVW-EDDEPKNLWEKFW 558

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/509 (66%), Positives = 422/509 (82%), Gaps = 2/509 (0%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           + +VKR LK RH+ MI+LGGTIGTGLF+GIA+P+  AGPVG+L+AYLFM TI F VTQSL
Sbjct: 94  EAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSL 153

Query: 119 GEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVP 178
           GEMATFIPVTSSFT+++ RFLSPA+GAANGY+YWFSW VTFALELS++GQ+IQ+WT AVP
Sbjct: 154 GEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVP 213

Query: 179 LSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF 238
           LS WIV++W++LT  N+ PV+FYGE EFW+A++KVL+I GFLIY L MVCG    G +GF
Sbjct: 214 LSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPVGF 273

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           RYW+NPGPWG G+IS +  E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+A
Sbjct: 274 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 333

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
           I KV FRIL FYILSLFF+GLLVPY D +L T++DS I+ SPF++AI+NSGTK+LP +FN
Sbjct: 334 IKKVTFRILIFYILSLFFIGLLVPYDDEKL-TSTDSYISASPFIIAIENSGTKILPHIFN 392

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            VIL TI+SAGNSN+Y+GSR+L+GL+K+ LAP  F  T++ GVP+Y+V  +S FG LA+L
Sbjct: 393 AVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFL 452

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
            +S    K F+WLL I +VAGFFAWLLIS++H+RFMQ LK RGISR+DLPFKA+FMP  A
Sbjct: 453 EVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLA 512

Query: 479 YYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDV 538
           YY+ FF+T+II+IQGF +FAP F  S+F+A YIS+FLF   WL FQ+ F+++L+   E+V
Sbjct: 513 YYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEEV 572

Query: 539 DIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
           DIDTDRR++DA++W +D  PKT   K W 
Sbjct: 573 DIDTDRRDVDAIIW-EDSGPKTFWDKFWD 600

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/571 (58%), Positives = 433/571 (75%), Gaps = 11/571 (1%)

Query: 3   ENVELETYPAGKQHNDR---SAESSESSDV--LHHRKETKNEGI--FINQENMSEVESLY 55
           E +EL    + K  +D+   +   S+ S++  LH        G     + E     E+ Y
Sbjct: 40  EVIELINTNSFKDSSDKPPITLRKSKLSEIGSLHSGSNLHQHGTTSLHDDEESDTEEAQY 99

Query: 56  GNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
              D  VKR LK RH+ MI+LGGTIGTGLF+GIA+P+  AGPVGSL+AY+FMG++ + VT
Sbjct: 100 --QDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVT 157

Query: 116 QSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175
           QSLGEMATFIPVTSS T++++RFLSPA G ANGY+YWF+W +T+A+E+S+IGQ+IQYWT 
Sbjct: 158 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTK 217

Query: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA 235
           AVPL+ WI +FW+++T  N  PV+ YGE EFWIA++KVL+I G+LIYAL++VCGGS +G 
Sbjct: 218 AVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGP 277

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295
           +GFRYW+NPGPWG G+IS    EARFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK+V
Sbjct: 278 IGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 337

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPS 355
           P+AINKV FRI  FYI+SLFF+GLLVP+ D RL+  S + I +SPFV++IQN+GT+ LP 
Sbjct: 338 PRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDS-AVIASSPFVISIQNAGTRALPD 396

Query: 356 VFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCL 415
           +FN V+L+TI+SA NSN+Y+GSRVLY L+ +G AP +F    K GVP+  V+ ++  G L
Sbjct: 397 IFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLL 456

Query: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475
           A+L ++ NA   F+WL+ I+ +AG  AWL ISLSHIRFMQ LK RGISR+DLPFKAK MP
Sbjct: 457 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMP 516

Query: 476 WGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK 535
           WGAYYA+FF+TVII IQGF +F P+F  S F   YIS+ L  V + G Q+ ++ R I + 
Sbjct: 517 WGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKV 576

Query: 536 EDVDIDTDRREIDALVWSDDDEPKTLLQKLW 566
           ED+DID+DRREI+A++W ++DEPK L +K W
Sbjct: 577 EDIDIDSDRREIEAIIW-EEDEPKNLWEKFW 606

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/511 (63%), Positives = 417/511 (81%), Gaps = 3/511 (0%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           +D  V+R LK RH+ MI+LGGTIGTGLF+GI++P+  AGPVGSL+AY+FMGT+ + VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGEMATFIPVTSS T++++RFLSPA G +NGY+YWF+W +T+A+E+S+IGQ+I+YWT  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALG 237
           PL VWI +FW+L+T  N  PV+ YGE EFW+A++KVL+I G+LIYALV+VCGGS +G +G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297
           FRYW+NPG WG G+ISS+K E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357
           AINKV FRI+ FYI+SLFF+GLLVPYTDPRLS +S + I +SPFV++IQN+GT  LP +F
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASS-AVIASSPFVISIQNAGTYALPDIF 400

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N ++L+T++SA NSN+Y+GSRVLY L+++G AP  F    KQGVP+  VL+++  G LA+
Sbjct: 401 NAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAF 460

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
           L ++ NA   F+WL+ I+ +AG  AWL ISLSHIRFMQ L  RGISR+DLPFKAKFMP+G
Sbjct: 461 LVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYG 520

Query: 478 AYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKED 537
           AYYA+FF+TVII IQGF SF P F  ++F   YIS+ L  V + G Q+ +K R I + ED
Sbjct: 521 AYYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLED 579

Query: 538 VDIDTDRREIDALVWSDDDEPKTLLQKLWQS 568
           +DID+DRREI+A++W +DDEPK L +K W +
Sbjct: 580 IDIDSDRREIEAIIW-EDDEPKNLWEKFWAA 609

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/513 (63%), Positives = 418/513 (81%), Gaps = 3/513 (0%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           +D  VKR LK RH+ MI+LGGTIGTGLF+GI++P+  AGPVGSL++Y+FMGT+ + +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGEMATFIPVTSS T++++RFLSPA G ANGY+YWF+W +T+A+E+S+IGQ+IQYWT  V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALG 237
           PL+VWI +FW+L+T  N  PV+ YGE EFW+A++KVL+I G+LIYALV+VCGGS +G +G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297
           FRYW+NPG WG G+ISS+K E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357
           AINKV FRI+ FYI+SLFF+GLLVPY +PRLS +S + I +SPFV++IQN+GT  LP +F
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASS-AVIASSPFVISIQNAGTYALPDIF 401

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N V+L+T++SA NSN+Y+GSRVLY L+++G AP  F    KQGVP+  VL+++  G LA+
Sbjct: 402 NAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAF 461

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
           L ++ NA   F+WL+ I+ +AG  AWL ISL+HIRFMQ L+ RGISR+DLPFKAK MP+G
Sbjct: 462 LVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYG 521

Query: 478 AYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKED 537
           AYYAAFF+TVII IQGF +F P F  S+F   YIS+ L  V + G Q+ +K R I + ED
Sbjct: 522 AYYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLED 580

Query: 538 VDIDTDRREIDALVWSDDDEPKTLLQKLWQSFS 570
           +DIDTDRREI+A++W +DDEPK L +K W + +
Sbjct: 581 IDIDTDRREIEAIIW-EDDEPKNLWEKFWAAVA 612

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/567 (57%), Positives = 435/567 (76%), Gaps = 5/567 (0%)

Query: 4   NVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVK 63
           +++ + Y   K+H   S +    +DV           +  ++ +++E E     +D  VK
Sbjct: 50  SIDEKQYNTKKKHG--SLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAHYEDKHVK 107

Query: 64  RDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT 123
           R LK RH+ MI+LGGTIGTGLF+GI++P+  AGPVGSL+AY+FMGTI + VTQSLGEMAT
Sbjct: 108 RALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMAT 167

Query: 124 FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWI 183
           FIPVTSS T++++RFLSPA G +NGY+YWF+W +T+A+E+S+IGQ+I+YWT  VPL+ WI
Sbjct: 168 FIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWI 227

Query: 184 VVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKN 243
            +FW+++T  N  PV+ YGE EFW+A++KVL+I G+LIYAL++VCGGS +G +GFRYW+N
Sbjct: 228 AIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRN 287

Query: 244 PGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVF 303
           PG WG G+ISS+K E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+AINKV 
Sbjct: 288 PGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVV 347

Query: 304 FRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILV 363
           FRI+ FYI+SLFF+GLLVPY D RLS +S     +SPFV++IQN+GT  LP +FN V+L+
Sbjct: 348 FRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIA-SSPFVISIQNAGTYALPDIFNAVVLI 406

Query: 364 TILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQN 423
           T++SA NSN+Y+GSRVLY L+++G AP  F    +QGVP+  V+ ++  G LA+L ++ N
Sbjct: 407 TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNN 466

Query: 424 AKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAF 483
           A   F+WL+ I+ +AG  AWL ISL+HIRFMQ LK RGISR+DLPFKAK MP+GAYYAAF
Sbjct: 467 ANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAF 526

Query: 484 FITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTD 543
           F+TVII IQGF +F P F  SEF   YIS+ L  V ++G Q+ +K R I + ED+DID+D
Sbjct: 527 FVTVIIFIQGFQAFCP-FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSD 585

Query: 544 RREIDALVWSDDDEPKTLLQKLWQSFS 570
           RREI+A++W +DDEPK L +K W + +
Sbjct: 586 RREIEAIIW-EDDEPKNLWEKFWAAVA 611

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/511 (62%), Positives = 411/511 (80%), Gaps = 2/511 (0%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
            D  VKR LK RH+ MI+LGGTIGTGLF+GIA+P+  +GPVGSL+AYLFMG+I + +TQS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGEMATFIPVTSS T++++RFLSPA G ANGY+YWF+W +TFA+E+S++GQ+I+YWT  V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALG 237
           PL+ WI +FW+L+T  N  PV+ YGEIEFWIA +KVL+I G+L+YAL++VCGGSS+G +G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297
           FRYW+NPGPWG G+IS +    RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357
           AINKV FRI  FYI+SLFF+G+LVPY D RL++TS + I +SPFV++IQN+GTKVLP +F
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTS-AVIASSPFVISIQNAGTKVLPDIF 387

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N ++++TI+SA NSN+Y+GSRVLY L+ SG AP  F    + GVP+  V+ +S  G LA+
Sbjct: 388 NAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAF 447

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
           L ++ NA   F+WL+ I+ +AG  AWL IS+SHIRFMQ LK RGISR+DLPFKAK MP+G
Sbjct: 448 LVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFG 507

Query: 478 AYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKED 537
           AYYA FF+TVII IQGF +F+P +  + F   YIS+ +  V ++G Q+ ++ R   R ED
Sbjct: 508 AYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVED 567

Query: 538 VDIDTDRREIDALVWSDDDEPKTLLQKLWQS 568
           +DID+DRREI+A++W +DDEPKTL  K W +
Sbjct: 568 IDIDSDRREIEAVIW-EDDEPKTLWDKFWAA 597

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/555 (60%), Positives = 433/555 (78%), Gaps = 10/555 (1%)

Query: 24  SESSDVLHHRKETKNEGIFINQENMS-----EVESLYGNDD---PDVKRDLKPRHMSMIS 75
           S  S  L  R +   + I ++   +S       ES  G  D    +VKR LKPRH+SMI+
Sbjct: 27  STDSGTLSKRSKAGEDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIA 86

Query: 76  LGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYT 135
           LGGTIGTGLF+GIA P+ ++GPVGSL+AY+FMG++ + VTQSLGEMATFIPVTSS T+++
Sbjct: 87  LGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFS 146

Query: 136 QRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNM 195
           +RFLSPA G ANGY+YWF+W +T+A+ELS++GQ+I YWT AVPL+ WI +FW+LLTA+N 
Sbjct: 147 KRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANF 206

Query: 196 IPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSN 255
            PV++YGE EF +A++KV++I G+L+YAL++VCGGSS+G +GFRYW+NPGPWG G I+ N
Sbjct: 207 FPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTIAKN 266

Query: 256 KYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLF 315
             +ARFLGWV SL+ A+FTYQGTELVGITAGE+ NPRKTVPKAINKVFFRIL FYI SLF
Sbjct: 267 VNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLF 326

Query: 316 FVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYI 375
           FVGLLVPY  P+L + S + I +SPFV++IQN+GTKVLP +FN V+LVTILSAGNSN+Y+
Sbjct: 327 FVGLLVPYNSPQLESNS-AVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYV 385

Query: 376 GSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTIT 435
           GSRVLY L+ SG AP  F    KQGVP+  V+ +++ G LA+L  ++NA   F+WL+ I+
Sbjct: 386 GSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINIS 445

Query: 436 AVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFD 495
            +AG  AW  IS++HIRFMQ LK RGISR+ LPFKAK MPWGAYYAAFF+ +I+ IQGF 
Sbjct: 446 TLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFT 505

Query: 496 SFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDD 555
           +FAP F  SEF   YIS+ L +V ++  Q+ ++ R + + ED+DID+DRREIDA++W +D
Sbjct: 506 AFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAIIW-ED 564

Query: 556 DEPKTLLQKLWQSFS 570
           DEPK L +K W + +
Sbjct: 565 DEPKNLWEKFWVALA 579

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/541 (59%), Positives = 422/541 (78%), Gaps = 4/541 (0%)

Query: 27  SDVLHHRKETKNEGIFINQE-NMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLF 85
           SD L +     +     N + ++S+ E      D  VKR LK RH+ MI+LGGTIGTGLF
Sbjct: 58  SDQLSYNVSVADNSSAANGDLDLSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLF 117

Query: 86  MGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGA 145
           +GI++P+  AGPVG+L+AY+FMG+I + +TQSLGEMATFIPVTSS T++++RFLSPA G 
Sbjct: 118 VGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGV 177

Query: 146 ANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIE 205
            NGY+YWF+W +T+A+E+S++GQ+IQYWT AVPL+ WI +FW+ +T  N  PV+ YGE+E
Sbjct: 178 TNGYMYWFNWAITYAVEISVVGQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVE 237

Query: 206 FWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWV 265
           FW+A++KVL+I G+LIYALV+VCGGSS+G +GFRYW+NPGPWG G+IS +  E RFLGWV
Sbjct: 238 FWVASIKVLAIIGYLIYALVIVCGGSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWV 297

Query: 266 SSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTD 325
           SSLI AAFTYQGTELVGITAGE+ NPRK+VP+AINKV FRI  FYI+SLFF+GLLVPY D
Sbjct: 298 SSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYND 357

Query: 326 PRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSK 385
             LS + DS I +SPFV++IQN+GT  LP +FN V+++TI+SA NSN+Y+GSRVLY L++
Sbjct: 358 HTLS-SGDSYIASSPFVISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQ 416

Query: 386 SGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLL 445
           +G AP  F    K GVP+  V+ ++  G LA+L ++ NA   F+WL+ I+ +AG  AW  
Sbjct: 417 TGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFF 476

Query: 446 ISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSE 505
           I+LSHIRFMQ LK RGISR+DLPFKAK MPWGAYY+AFF+ VII IQGF++F P +  + 
Sbjct: 477 IALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTT 535

Query: 506 FIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKL 565
           F   YIS+ L +V ++G Q+ ++ R +L+ ED+DIDTDRREI+A++W +DDEPK L +K 
Sbjct: 536 FFTSYISLILLVVVFIGCQLYYRCRFLLKVEDIDIDTDRREIEAIIW-EDDEPKNLWEKF 594

Query: 566 W 566
           W
Sbjct: 595 W 595

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/559 (58%), Positives = 433/559 (77%), Gaps = 9/559 (1%)

Query: 11  PAGKQHNDRSAESSESSDVLHHR---KETKNEGIFINQENMSEVESLYGNDDPDVKRDLK 67
           P GK   D+        D +  +   +   N    + +E+  E     G  D  VKR LK
Sbjct: 17  PVGKTEQDKYGYELHPLDPVTQQVTLRTVTNVCDGLEEEDAEEA----GYHDTRVKRALK 72

Query: 68  PRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPV 127
            RH+ MI+LGGTIGTGLF+GIA+P+  AGPVGSL+AYLFMG+I + +TQSLGEMATFIPV
Sbjct: 73  QRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGEMATFIPV 132

Query: 128 TSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFW 187
           TSS T++++RFLSPA G ANGY+YWF+W +T+A+E+S+IGQ+IQ+WT AVPL+ WI +FW
Sbjct: 133 TSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAVPLAAWIAIFW 192

Query: 188 ILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPW 247
           + ++  N  PV+ YGEIEFW+A++KV++I G+LIYALV+VCGGSS+G +GFRYW+NPGPW
Sbjct: 193 VFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGSSQGPIGFRYWRNPGPW 252

Query: 248 GMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRIL 307
           G G+IS +K E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK+VP+AINKV FRI+
Sbjct: 253 GPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIV 312

Query: 308 FFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILS 367
            FYI+SLFFVG+LVP+ DPRL++   + I +SPFV++IQN+GT+VLP +FN V+++TI+S
Sbjct: 313 IFYIMSLFFVGMLVPFNDPRLASNV-AVIASSPFVISIQNAGTRVLPHIFNAVVMLTIIS 371

Query: 368 AGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKV 427
           A NSN+Y+GSRVLY LS++G AP  F    + GVP+  V+ +S+ G LA+L ++ NA   
Sbjct: 372 AANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVNNNANTA 431

Query: 428 FDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITV 487
           F+WL+ I+ +AG  AWL ISLSHIRFMQ LK RGISR+DLPFKAK MPWGAYYAAFF+TV
Sbjct: 432 FNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTV 491

Query: 488 IILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREI 547
           II IQGF++F+P+F  S F   YIS+ + +V  +G Q+ ++ R + + ED+DIDTDRREI
Sbjct: 492 IIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDIDTDRREI 551

Query: 548 DALVWSDDDEPKTLLQKLW 566
           + ++  +++EP+ L +K W
Sbjct: 552 ECII-WEEEEPQNLWEKFW 569

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/510 (61%), Positives = 411/510 (80%), Gaps = 2/510 (0%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           D +VKR LK RH+ MI+LGGTIGTGLF+GI+ P+  +GPVGSL+AYLFMG+I + +TQSL
Sbjct: 98  DTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSL 157

Query: 119 GEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVP 178
           GEMATFIPVTSS T++++RFLSPA G ANGY+YWF+W +T+A+E+S++GQ+I+YWT  VP
Sbjct: 158 GEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVP 217

Query: 179 LSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF 238
           L+ WI +FW+ +T  N  PV+ YGEIEFWIA +KVL+I G+L+YAL++VCGGSS+G +GF
Sbjct: 218 LAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIGF 277

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           RYW+NPGPWG G+IS +K  +RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK+VP+A
Sbjct: 278 RYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 337

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
           INKV FRI  FYI+SLFF+GLLVPY DPRLS+ S + + +SPFV++IQN+GTK+LP +FN
Sbjct: 338 INKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDS-AVVASSPFVISIQNAGTKILPDIFN 396

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            ++++T++SA NSN+Y+GSRVLY L+++G AP  F    + GVP+  VL ++  G LA+L
Sbjct: 397 AIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFL 456

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
            ++ NA   F+WL+ I+ +AG  AWL IS+SHIRFMQ LK RGISR+DLPFKAKFMPW A
Sbjct: 457 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAA 516

Query: 479 YYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDV 538
           YYA FF+TVII IQGF +F+P F  + F   YIS+ +  V ++G Q+ ++ R   + ED+
Sbjct: 517 YYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDI 576

Query: 539 DIDTDRREIDALVWSDDDEPKTLLQKLWQS 568
           DIDTDRREI+ ++W +DDEPKT   K W +
Sbjct: 577 DIDTDRREIEEVIW-EDDEPKTYWDKFWAA 605

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/565 (56%), Positives = 437/565 (77%), Gaps = 15/565 (2%)

Query: 16  HNDRSAESSESSDVLHHRKETKNEGIF--INQENMSEVESLYGNDDPD----------VK 63
           ++D+   +    + +  +K++K++ IF  +N+      E+   +D+ D          VK
Sbjct: 45  YDDKKDMTVTYDNEILEKKDSKSD-IFTSVNRYASHPSEARISSDEYDHQEAEFKDTKVK 103

Query: 64  RDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT 123
           R LKPRH+ MI+LGGTIGTGLF+GI+ P++ +GPVGSL+AY+FMGT+ + VTQ+LGEMAT
Sbjct: 104 RALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMAT 163

Query: 124 FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWI 183
           FIPVTSS T+++ RFLSPA G +NGYLYWF+W +T+A+E+S++GQ+I++WT  VPL+ WI
Sbjct: 164 FIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKVPLAAWI 223

Query: 184 VVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKN 243
            +FW+L+TA N  PV  YGEIEFW+A++KVL+I G+LIYALV+VCGGS +G +GFRYW++
Sbjct: 224 SIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSKQGPIGFRYWRH 283

Query: 244 PGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVF 303
               G GMIS +K EARFLGWV+SLI AAFTYQGTELVGITAGE+ NPRK+VP+AINKV 
Sbjct: 284 GYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVV 343

Query: 304 FRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILV 363
           FRI+ FYILSLFF+GLLVPY DP+L++ + S I +SPFV++I+N+GT+ LP +FN +I++
Sbjct: 344 FRIVIFYILSLFFIGLLVPYNDPKLNSAT-SYIASSPFVISIENAGTRALPHIFNAIIMI 402

Query: 364 TILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQN 423
           TI+SA NSN+Y+ SRVLY L+ SG AP +F +   QGVPF  V+ +++ G LA+L ++ N
Sbjct: 403 TIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNNN 462

Query: 424 AKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAF 483
           A + F+WL+ I+ +AG  AWL IS+SH+RFM+ LK RGISR+DLPFKA+FMP+G+YYA F
Sbjct: 463 ANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYACF 522

Query: 484 FITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTD 543
           FITVII IQGF +F+P+F  + F   YIS+ L  V ++G Q+ ++ R   + ED+DIDTD
Sbjct: 523 FITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDIDTD 582

Query: 544 RREIDALVWSDDDEPKTLLQKLWQS 568
           RREID +VW +DDEPKT   K W +
Sbjct: 583 RREIDEIVW-EDDEPKTAWDKFWAA 606

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/552 (59%), Positives = 425/552 (76%), Gaps = 10/552 (1%)

Query: 15  QHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMI 74
           Q +  S   S +   L+ R +   E      +   E+E+     +  VKR LK RH+ MI
Sbjct: 52  QADVHSVTGSLTRSRLNSRVDDGAE-----SDGSDELEAEV--HETKVKRALKQRHIGMI 104

Query: 75  SLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMY 134
           +LGGTIGTGLF+GI++P+ VAGPVGSL+AY+FMGTI + VTQSLGEMATFIPVTSS T++
Sbjct: 105 ALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVF 164

Query: 135 TQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASN 194
           ++RFLSPA G ANGY+YWF+W +T+A+E+S+IGQ+IQYWT AVPL+ WI +FW+L+T  N
Sbjct: 165 SKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMN 224

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISS 254
             PV+ YGE+EFWIA +KVL+I G+LIYALV+VCGGS +G +GFRYW++PG +G G+IS 
Sbjct: 225 FFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGIISK 284

Query: 255 NKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSL 314
           NK   +FLGWV+SLI AAFTYQGTELVGITAGE+ NPRKTVP+AINKV FRI+ FYI+SL
Sbjct: 285 NKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSL 344

Query: 315 FFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIY 374
           FF+G+L+PY D RLS   D+ I +SPFV++I+N+ TKVLP +FN V++VT++SA NSN+Y
Sbjct: 345 FFIGMLLPYNDKRLS-AQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVY 403

Query: 375 IGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTI 434
           +GSRVLY L+ +G AP  F    + GVP+  V+ ++  G LA+L ++ NA   F+WL+ I
Sbjct: 404 VGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINI 463

Query: 435 TAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGF 494
           + +AG  AWL ISL+HIRFMQ LK RGISR+DLPFKAK MPWGAYYAAFF+TVII IQG+
Sbjct: 464 STLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGY 523

Query: 495 DSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSD 554
            +F P  V S F   YIS+ L  V  +G Q+ ++ R +L+ ED+DIDTDRREI+++VW +
Sbjct: 524 QAFCPWDV-STFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVW-E 581

Query: 555 DDEPKTLLQKLW 566
           DDEPKTL  K W
Sbjct: 582 DDEPKTLWDKFW 593

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/557 (57%), Positives = 421/557 (75%), Gaps = 13/557 (2%)

Query: 21  AESSESSDVLHHRKETKNEGIFINQENMSEVESLYGND--------DPDVKRDLKPRHMS 72
           +E+S  S  +   K  +N+   I  ++++     +  D        + +VKR LK RH+S
Sbjct: 9   SETSTRSRYIKKGKTLEND---IELQSVTPATGEFPEDHTEEGDYQETEVKRALKARHIS 65

Query: 73  MISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFT 132
           MI+LGGTIGTGLF+ IASP+R AGPVGSLLAY+F+GT+ + +TQSLGEMATFIPVTSS T
Sbjct: 66  MIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVT 125

Query: 133 MYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTA 192
           ++++RFLSPA G ANGY+YWF+W +TFA+ELS++GQ+IQYWT  VP++ WIV+FW+L+T 
Sbjct: 126 VFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVIFWVLVTL 185

Query: 193 SNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKN-PGPWGMGM 251
            N  PVRFYGEIEFWIA++KVL+I G+LIYA ++VCGGS +G +G       P       
Sbjct: 186 VNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIPARGARAS 245

Query: 252 ISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYI 311
             + +    FLGWVSSLIKAAFTYQGTELVGITAGES NPRK VPKAINKVFFRILFFYI
Sbjct: 246 SRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYI 305

Query: 312 LSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNS 371
            SL FVGLLVPY DPRL++ S +D+N SPFV++I+N+GTK+LP +FN V+L+T++SA NS
Sbjct: 306 GSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANS 365

Query: 372 NIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWL 431
           N+YIGSRV Y L+ +G AP       KQGVP++ VL +S+ G +++L ++ NA   FDWL
Sbjct: 366 NVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWL 425

Query: 432 LTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILI 491
           + I+ +AG  AWL ISL+HIRFMQ LK RGISR+DLPFKAKFMPW AYYA FF+TVII I
Sbjct: 426 VNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFI 485

Query: 492 QGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALV 551
           QG+ +F P+F  + F   YIS+FL ++ ++G Q+ +K R +   ED+DID+DRREIDA+V
Sbjct: 486 QGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDAIV 545

Query: 552 WSDDDEPKTLLQKLWQS 568
           W ++DEPK +  K W +
Sbjct: 546 W-EEDEPKNIWDKFWSA 561

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/579 (59%), Positives = 439/579 (75%), Gaps = 15/579 (2%)

Query: 1   MVENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDP 60
           M ENV++ T   GK+  + SA + +  +++  + E ++    I   +  E +   G +  
Sbjct: 1   MNENVDICTSKEGKREAN-SAPTIKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETS 59

Query: 61  -----DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
                +V+R LK RH+ MI+LGGTIGTGL +GI  P+  AGPVG+L++YLFMGT+ + VT
Sbjct: 60  PRSRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVT 119

Query: 116 QSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175
           QSLGEMATFIPVTSSF+++ QRFLSPALGA NGY+YW SWC TFALELS++GQ+IQYWT 
Sbjct: 120 QSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTH 179

Query: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCG-GSSEG 234
           AVPL+ WIV+FW LLT  NM PV++YGE EF IA++KV+++ GF+I++  +VCG G  +G
Sbjct: 180 AVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDG 239

Query: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294
            +GFRYW+NPG WG G+ISSNK E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK 
Sbjct: 240 PIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 299

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSD---INTSPFVMAIQNSGTK 351
           VP+AI KV  RIL FYILSLFF+GLLVPY DP+L    DSD   ++ SPF+++I+NSGTK
Sbjct: 300 VPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKL----DSDGTFVSASPFMISIENSGTK 355

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
           VLP +FN V+L+TI SAGNSN+YIGSRVLY LSK+ LAP       + GVP+ AVL +S+
Sbjct: 356 VLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSL 415

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
           FG LA+L  S  + K F+WLL IT VAGFFAWLLIS SHIRFMQ +K RGISR+DLP+KA
Sbjct: 416 FGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKA 475

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRL 531
           + MP+ AYYA+FFI +I+LIQGF +FAP F   +F+A YISVFLF + WL FQ+ FK RL
Sbjct: 476 RMMPFLAYYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRL 535

Query: 532 ILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSFS 570
           I + +D+DID+DRREI+  VW  + E KT  Q++W   S
Sbjct: 536 ICKLQDIDIDSDRREIEEQVWI-EPECKTRWQRVWDILS 573

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/573 (58%), Positives = 436/573 (76%), Gaps = 14/573 (2%)

Query: 7   LETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMS---EVESLYGN---DDP 60
           ++T  +  Q   R  +S   +     + +   +   I Q + S   E E +  +    D 
Sbjct: 1   MDTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           +VKR+LK RH+ MI+LGGTIGTGLF+GI++P+  +GPVGSL+AY+F+GT+ + VTQSLGE
Sbjct: 61  EVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           MATFIPVTSSFT++  RFLSP++GAA GY+YWFSW VTFALELS++GQ++ YWTFAVP++
Sbjct: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIA 180

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240
            WI +FW++LTA NM PV+FYGEIEFW+AA+KV++I GFLIY L MVCG    G +GFRY
Sbjct: 181 AWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRY 240

Query: 241 WKNPGPWGMGM------ISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294
           W+NPGPWG G+      IS NK   RFLGW +SLI AAFTYQGTELVGITAGE+ NPRKT
Sbjct: 241 WRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKT 300

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLP 354
           VP+AI KV FRIL FYI SLFF+GLLVP+ DP+LS+   S +++SPF++AI+NSGTK+LP
Sbjct: 301 VPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDD-SYVSSSPFIIAIENSGTKILP 359

Query: 355 SVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGC 414
            +FN +IL+TI+SAGNSNIY+GSR+L+ L+K+GLAP +  +T K+GVP+ +VL +++FG 
Sbjct: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419

Query: 415 LAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM 474
           LAY+  +Q  + VFDWL+ ITA+AGF+AWL I +SHIRFMQVLK RGISR+DLPFKA  M
Sbjct: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479

Query: 475 PWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILR 534
           P  AYYA F + +II+ QGF +F P F  S+F A YISV LF + W  FQ+ FK R I +
Sbjct: 480 PGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK 539

Query: 535 KEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
            EDVDID++RR+++ ++W +D EPKT   K W 
Sbjct: 540 LEDVDIDSNRRDVEKIIW-EDPEPKTFWDKFWN 571

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/579 (58%), Positives = 440/579 (75%), Gaps = 15/579 (2%)

Query: 1   MVENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDP 60
           M E V ++    G Q+   S+   +  + +  +   +N    I  E   E ++    +  
Sbjct: 1   MDETVNIQMSKEG-QYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESS 59

Query: 61  -----DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
                +VKR LK RH+ MI+LGGTIGTGL +GI  P+  AGPVG+L++YLFMGT+ + VT
Sbjct: 60  PQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVT 119

Query: 116 QSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175
           QSLGEM TFIPVTSSF+++ QRFLSPALGA NGY+YW SWC TFALELS++G++IQYWT 
Sbjct: 120 QSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTE 179

Query: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCG-GSSEG 234
           AVPL+ WIV+FW LLT+ NM PV++YGE EF IA++KV+++ GF+I++  +VCG G S+G
Sbjct: 180 AVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDG 239

Query: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294
            +GFRYW+NPG WG G+ISS+K E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK 
Sbjct: 240 PIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 299

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSD---INTSPFVMAIQNSGTK 351
           +P+AI KV  RIL FYILSLFF+GLLVPY DP+L    DSD   +++SPF+++I+NSGTK
Sbjct: 300 LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL----DSDGIFVSSSPFMISIENSGTK 355

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
           VLP +FN V+L+TILSAGNSN+YIGSRVLY LSK+ LAP       + GVP+++VL++S+
Sbjct: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSV 415

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
           FG LA+L +S  + K F+WLL IT VAGFFAWLLIS SHIRFMQ ++ RGISR+DLP+KA
Sbjct: 416 FGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKA 475

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRL 531
           + MP+ AYYA+FFI +I+LIQGF +FAP F   +F+A YIS+FLF+  WL FQV FK RL
Sbjct: 476 QMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRL 535

Query: 532 ILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSFS 570
           + + +D+DID+DRR+I+ LVW  + E KT  Q++W   S
Sbjct: 536 LWKLQDIDIDSDRRQIEELVWI-EPECKTRWQRVWDVLS 573

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/510 (66%), Positives = 417/510 (81%), Gaps = 2/510 (0%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
            D +VKR+LK RH+ MI+LGGTIGTGLF+GI++P++ AGPVGSL+AYLFM TI F VTQS
Sbjct: 85  QDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQS 144

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGEMATFIPVTSSFT+++ RF+SP++GAANGY+YWFSW +TFALELS++GQ+IQ+WT AV
Sbjct: 145 LGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALG 237
           PLS WIV++W +LT  NM PV+FYGE EFW+A++KV++I GFLIY L MVCG    G +G
Sbjct: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264

Query: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297
           FRYW+NPGPWG G+ISS   E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+
Sbjct: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324

Query: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357
           AI KV FRIL FYILSLFF+GLLVP+ DP+LS+   S +++SPF++AIQNSGTKVLP +F
Sbjct: 325 AIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDD-SYVSSSPFIIAIQNSGTKVLPHIF 383

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N VIL TI+SAGNSNIY+GSRV++GL+K+ LAP  F  T K GVP+ AVL +S FG LA+
Sbjct: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
           L +S    K F+WLL I  VAGFFAWLLIS++H+RF+Q L+ RGISR+DLPFKA  MPW 
Sbjct: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503

Query: 478 AYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKED 537
           AYYA FF+ +II+IQGF +FAP F  S+F+A YISVFLF   W+ FQ+ F+ +L    ++
Sbjct: 504 AYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDE 563

Query: 538 VDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
           VDIDTDRR+IDA++W +D  PKT   + W 
Sbjct: 564 VDIDTDRRDIDAIIW-EDSAPKTFWDRFWD 592

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/601 (56%), Positives = 433/601 (72%), Gaps = 44/601 (7%)

Query: 4   NVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD-- 61
           ++EL +Y    +  + S+   +  D +  R E   +  F+++   SE E  Y   D D  
Sbjct: 8   SIELHSYHESLETQEASSWDKKLKDKV--RNEWARDRRFLHRHRGSEGEVEYAKSDEDAT 65

Query: 62  ------------------------------------VKRDLKPRHMSMISLGGTIGTGLF 85
                                               VKR+LKPRH+ MI+LGGTIGTGLF
Sbjct: 66  LTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLF 125

Query: 86  MGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGA 145
           +GIA+PI+ AGPVGSL+AY+FMGT+ F VTQSLGEMATFIPVTSSFT++  RF+S   GA
Sbjct: 126 IGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGA 185

Query: 146 ANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIE 205
           A GY+YWFSW +TFALELS++GQ+I++WTF VPL+ WI +FW+L+   N  PV+ YGE E
Sbjct: 186 ACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFE 245

Query: 206 FWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWV 265
           FW+A++KV++I GF+IY L MVCG    G +GFRYW++PGPWG G+IS +K EARFLGWV
Sbjct: 246 FWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWV 305

Query: 266 SSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTD 325
           SSLI AAFTYQGTELVGITAGE+ NPRK+VP+AI KV  RIL FYILSLFF+GLLVPY D
Sbjct: 306 SSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYND 365

Query: 326 PRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSK 385
           P+LS+T DS ++ SPF++AIQNSGTKVLP +FN VIL TI+SA NSN+Y+GSR+LYGLS 
Sbjct: 366 PKLSST-DSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSS 424

Query: 386 SGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLL 445
           + LAP  F+KT + GVPF AVL ++ FG LAY+  S   +  F+WLL IT VAGFFAWL 
Sbjct: 425 AKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLS 483

Query: 446 ISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSE 505
           IS+SHIRFMQ LK RG+SR+DLP+KA  MP  AYY AFF+T+IILIQGF +FAP+F  + 
Sbjct: 484 ISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA 543

Query: 506 FIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKL 565
           F+  YIS FLF+  ++  Q  F+TRL    +DVDIDTDRR+ID ++W  ++ P+T   K 
Sbjct: 544 FLTAYISCFLFLFIYIVAQCYFRTRLWRTLDDVDIDTDRRDIDTVIW--EEGPQTFWDKF 601

Query: 566 W 566
           W
Sbjct: 602 W 602

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/529 (63%), Positives = 417/529 (78%), Gaps = 4/529 (0%)

Query: 43  INQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLL 102
           IN ++  E E+       +VKR LK RH+ MI+LGGTIGTGL +GI  P+  AGPVG+L+
Sbjct: 48  INNDSAKETET-SPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALI 106

Query: 103 AYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALE 162
           +YLFMGT+ + VTQSLGEMATFIPVTSSF+++ QRFLSPALGA NGY+YW SWC TFALE
Sbjct: 107 SYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALE 166

Query: 163 LSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIY 222
           LS++GQ+IQYWT AVPL  WIV+FW LLT  NM PV++YGE EF IA++KV+++ GF+ +
Sbjct: 167 LSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFF 226

Query: 223 ALVMVCG-GSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281
           +  +VCG G S G +GFRYW+NPG WG G+IS NK E RFLGWVSSLI AAFTYQGTELV
Sbjct: 227 SFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELV 286

Query: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPF 341
           GITAGE+ NPR+ VP+AI KV  RIL FYILSLFF+GLLVPY DP+L +   + +++SPF
Sbjct: 287 GITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS-EGTFVSSSPF 345

Query: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401
           +++I+NSGTKVLP +FN V+L+TILSAGNSN+YIGSRVLY LSK+ LAP       K GV
Sbjct: 346 MISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGV 405

Query: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461
           P++AVL++S FG LA+L  S  + KVF+WLL IT VAGFFAWLLISLSHIRFMQ +K RG
Sbjct: 406 PYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRG 465

Query: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWL 521
           ISR+DLP++A+ MP+ AYYA+FFI +I+LIQGF +FAP F   +FIA YISVFLFI  WL
Sbjct: 466 ISRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWL 525

Query: 522 GFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSFS 570
            FQV FK R + + +DVDID+DRR+I+  VW  + E KT  Q +W   S
Sbjct: 526 LFQVWFKCRFVWKLQDVDIDSDRRDIEEQVWI-EPECKTRWQHVWDILS 573

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/507 (62%), Positives = 397/507 (78%), Gaps = 2/507 (0%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           +VKR LKPRH+ MI+LGGTIGTGLF+GI+ P++ AGPVG L+AYLFM TIAF V QSLGE
Sbjct: 73  EVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGE 132

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           MAT+IPVTS+F++++QRFLSPA GAANGY+YWFSW +TFALELS+IGQ++QYWTF VP++
Sbjct: 133 MATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPVA 192

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240
            WI +FW+L+   N  PV+FYGE EFWIA +KV++I GF+IY  +MVCG    G +GFRY
Sbjct: 193 AWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTGPVGFRY 252

Query: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300
           W++   +G G+IS NK EARFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVPK+I 
Sbjct: 253 WRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIK 312

Query: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGV 360
           +  +RIL FYI SL FVGLLVP+ D  L   S S   +SPF++AI+NSGTK LP +FN V
Sbjct: 313 RTLWRILIFYIFSLLFVGLLVPFNDHGLQ-DSRSYAASSPFILAIKNSGTKALPDIFNAV 371

Query: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420
           IL T++SA NS++Y+GSRV+Y ++++ LAP +  K +K GVP+ AVL +S  G LAYL  
Sbjct: 372 ILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLET 431

Query: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480
           S +   VF+WL+ IT VAGFF+W LIS SH+RFM+ LK RGISRNDLPFKA FMPW A Y
Sbjct: 432 SSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIY 491

Query: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540
           + FF+T+IIL+QGF  F P F  S+F+A YISV LF V W  FQ+ F+  L++   ++DI
Sbjct: 492 SFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDI 551

Query: 541 DTDRREIDALVWSDDDEPKTLLQKLWQ 567
           DTDRR++DA VW +D+ PKTL  K W 
Sbjct: 552 DTDRRDVDAEVW-EDEPPKTLWDKFWN 577

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/510 (60%), Positives = 399/510 (78%), Gaps = 3/510 (0%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           D  VKR LKPRH+ MI+LGGTIGTGLF+GI+ P+  +GPVGSL+AY+FMG++ + VTQSL
Sbjct: 99  DTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQSL 158

Query: 119 GEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVP 178
           GEMATFIPVTSS T++T+RFLSPALG +NGY+YWF+W +TFA ELS+ GQ+IQYWT+ VP
Sbjct: 159 GEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTYKVP 218

Query: 179 LSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF 238
           L+ WI +FW+++   N  PV+ YGEIEFW++++KVL+I G+LIYALV+VCGGS +G +GF
Sbjct: 219 LAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQGPIGF 278

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           RYW++   +G G IS NK EARFLGWVSSLI AAFTYQGTELVGI+AGE+ NPRKTVP+A
Sbjct: 279 RYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRKTVPRA 338

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
           INKV FRI  FYILSLFF+GLLVPY D RLS  S + I +SPFV+++ N+GT  LP +FN
Sbjct: 339 INKVIFRIALFYILSLFFIGLLVPYNDKRLSDGS-AIIASSPFVISMLNAGTSALPDIFN 397

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            VIL+T+LSA NS++YI SRVLY L+  G AP  F   N+ GVP+  V  + + G LA+L
Sbjct: 398 AVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGWLAFL 457

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
            +S NA   F+WL+ I+ +AG  AW  I  +HIRFMQ LK +GISR+DLPFKA+FMPWGA
Sbjct: 458 VVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFMPWGA 517

Query: 479 YYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDV 538
           YYAAFF+ +II IQG+D+F P +    F   YIS+ LF V +LG  + ++ RL+++ ED+
Sbjct: 518 YYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIKIEDI 576

Query: 539 DIDTDRREIDALVWSDDDEPKTLLQKLWQS 568
           DIDTDR+E++A VW ++D P+   +K W +
Sbjct: 577 DIDTDRKEVEAYVW-EEDAPRNWWEKFWAA 605

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/478 (64%), Positives = 383/478 (80%), Gaps = 3/478 (0%)

Query: 91  PIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYL 150
           P+  AGPVG+L++Y+FMGT+ + VTQSLGEMATFIPVTSSF+++ QRFLSPALGA NGY+
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 151 YWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAA 210
           YW SWC TFALELS++GQ+IQYWT AVPLS WIV+FW LLT  NM PV++YGE EF IA+
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 211 LKVLSIFGFLIYALVMVCG-GSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLI 269
           +KV+++ GF+IY+  MVCG G  +G +GFRYW+NPG WG G+ISS+K E RFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 270 KAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLS 329
            AAFTYQGTELVGITAGE+ NPRK VP+AI KV  RIL FYI+SLFF+GLLVPY DP+L 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 330 TTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLA 389
           +   S ++ SPF+++I+NSGTKVLP +FN V+L+TI+SAGNSN+YIGSRVLY LSK+ LA
Sbjct: 259 S-DGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 390 PSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLS 449
           P       K GVP++AVL +S+FG LA+L  S  + K F+WLL IT VAGFFAWLLIS S
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 450 HIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIAD 509
           HIRFMQ +  RGISRNDLP+KA+ MP+ AYYA+FFI +I+LIQGF +FAP F   +F+A 
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAA 437

Query: 510 YISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
           YISVFLF+  W  FQ+ FK  +IL+ +DVDID+DRREI+  VW +    KT  Q +W 
Sbjct: 438 YISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLR-KTKWQCVWD 494

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  394 bits (1013), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/527 (37%), Positives = 323/527 (61%), Gaps = 7/527 (1%)

Query: 27  SDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFM 86
            D++   K T +      QE+ S   S    D   +K++LK RH+SMI++GG++GTGL +
Sbjct: 15  EDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLI 74

Query: 87  GIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAA 146
           G  + +R  GP   L+AY F+G + F V   LGEMAT+IP+   FT Y  R+  PALG A
Sbjct: 75  GTGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFA 133

Query: 147 NGYLYWFSWCVTFALELSIIGQLIQYWT--FAVPLSVWIVVFWILLTASNMIPVRFYGEI 204
            GY Y F + +    +L+    +IQYW     V   VWI +F +++   N + VR++GE 
Sbjct: 134 VGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEF 193

Query: 205 EFWIAALKVLSIFGFLIYA-LVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLG 263
           EFW+++ K++ +FG +++  ++M+ GG +   LGFRYWKNPG +     S    + +F+ 
Sbjct: 194 EFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVS 253

Query: 264 WVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPY 323
           +V+  + A F Y G EL GI A E++NPR+ +P+AI    +RI+ FYI+++F +G+ V Y
Sbjct: 254 FVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAY 313

Query: 324 TDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLY 381
            DPRL  +  + +    SPFV+AIQNSG + LP +FN  +L+ + SA NS++Y+G+R LY
Sbjct: 314 NDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLY 373

Query: 382 GLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFF 441
            L+  G AP LF KTN+ GVP+ A+    +F  LAY+N+S  + ++F++ + + ++ G  
Sbjct: 374 SLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGIL 433

Query: 442 AWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEF 501
           +W+ I +++I F +    + + RN   ++A F P+GAY   FF  +I  I+ F  F  EF
Sbjct: 434 SWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEF 493

Query: 502 VFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREID 548
            +  FI  YI + L+++ + G+++++KT+L+ + E+ D+ + +  ID
Sbjct: 494 DYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  383 bits (984), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/574 (37%), Positives = 340/574 (59%), Gaps = 30/574 (5%)

Query: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLY----GNDD----PD------- 61
           NDR   S + +      KE +   I + + N+S   S        DD    PD       
Sbjct: 20  NDRDGYSMKQNPDKFPVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAVPDGKDETTR 79

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +++DLK RH+SMI++GG++GTGL +G  + +   GPV  L+AY F+G + F     LGEM
Sbjct: 80  LRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMACLGEM 139

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA--VPL 179
           A++IP+   FT Y  R++ PALG A GY Y F + +    +L+    +IQYW     V  
Sbjct: 140 ASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNP 198

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVL-SIFGFLIYALVMVCGGSSEGALGF 238
            VWI +F +++ A N++ VRF+GE EFW+++ KV+  +   L+  ++M+ GG     LGF
Sbjct: 199 GVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGF 258

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           RYW++PG +     +    + +F+ + S  + + F+Y G EL GI   E+KNPRK+VPKA
Sbjct: 259 RYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKSVPKA 318

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT--SPFVMAIQNSGTKVLPSV 356
           I    +RI+ FY+ ++F +G+ V Y DPRL +T    ++   SPFV+AIQNSG KVLP +
Sbjct: 319 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKVLPHI 378

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
           FNG +LV + SA NS++Y+ SR LY L+  G AP +F KT+K GVP+YA++ S +F CLA
Sbjct: 379 FNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLFCCLA 438

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           Y+N+S  + K+F++ + + ++ G  +W+ I + +I F +  + +G+ ++   + A    +
Sbjct: 439 YMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAPGQRY 498

Query: 477 GAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK 535
           GAY+A FF  +I LI+ F  F    F +  FI  YI + +++  W+G+++++KT+ +++ 
Sbjct: 499 GAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTK-VVKP 557

Query: 536 EDVDIDT-----DRREIDALVWSDDDEPKTLLQK 564
            D D+ T     DR E    +   D E +  LQ+
Sbjct: 558 ADADLYTLKEIYDREEEQGKL--QDQEKEERLQR 589

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  380 bits (976), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/574 (36%), Positives = 342/574 (59%), Gaps = 30/574 (5%)

Query: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLY----GNDD----PD------- 61
           +DR A  S+ +      KE +   I + + N+S   S +      DD    PD       
Sbjct: 21  SDRDAYYSKQNPDSFPVKEQEIYNIDLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTR 80

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +++DLK RH+SMI++GG++GTGL +G  + +   GPV  L+AY F+G + F     LGEM
Sbjct: 81  LRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEM 140

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA--VPL 179
           A++IP+   FT Y  R++ PALG A GY Y F + +    +L+    +IQYW     V  
Sbjct: 141 ASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNP 199

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGF 238
            VWI +F +++ A N+I V+F+GE EFW+++ KVL + G ++   +++  GG     LGF
Sbjct: 200 GVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGF 259

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           RYW++PG +     +    + +F+ +++  + + F+Y G EL GI   E++NPRK+VPKA
Sbjct: 260 RYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKA 319

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT--SPFVMAIQNSGTKVLPSV 356
           I    +RI+ FY+ ++F +G+ V Y DPRL +T    ++   SPFV+AIQNSG KVLP +
Sbjct: 320 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHI 379

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
           FN  +LV + SA NS++Y+ SR LY L+  G AP +F KTNK GVP+ A++ S +F CLA
Sbjct: 380 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLA 439

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           Y+N+S  + K+F++ + + ++ G  +W+ I + +I F +  + +GI ++   + A    +
Sbjct: 440 YMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 499

Query: 477 GAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK 535
           GAY+A  F   I LI+ F  F   +F +  FI  YI + +++  W+G+++++KT++I + 
Sbjct: 500 GAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTKVI-KS 558

Query: 536 EDVDIDT-----DRREIDALVWSDDDEPKTLLQK 564
            DVD+ T     DR E    +  +D E +  L+K
Sbjct: 559 TDVDLYTFKEIYDREEEQGKI--EDQEKEERLKK 590

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  380 bits (975), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/557 (36%), Positives = 333/557 (59%), Gaps = 29/557 (5%)

Query: 14  KQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSM 73
           K H   S   S+  +V+ H  E   +                 +D   +K+ L+ RH+SM
Sbjct: 48  KVHGITSGHGSDVKNVVTHTSEFDGK-----------------HDGIRLKKALEARHVSM 90

Query: 74  ISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTM 133
           I++GG++GTGL +G  S + +AGP   L+AY F+G + F V   LGEMA +IP+   FT 
Sbjct: 91  IAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMAAYIPL-DGFTS 149

Query: 134 YTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF--AVPLSVWIVVFWILLT 191
           Y+ R+  PALG A GY Y F + +    +L+    +IQYW     V   VWI +  + + 
Sbjct: 150 YSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAII 209

Query: 192 ASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMG 250
             N + VRF+GEIE++I+A+K+  + G +I  LV+ CGG  +   LGF+YWKNPG +   
Sbjct: 210 TINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEY 269

Query: 251 MISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFY 310
             +    + RF+ + S  + A F Y GTEL GI   E KNPRK VPKAI    +RI+ FY
Sbjct: 270 STAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFY 329

Query: 311 ILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSA 368
           ++S+F +G+ VP+ DP L  + ++ +  + SPFV+AI N+G  VLP + N  IL+ + SA
Sbjct: 330 LISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSA 389

Query: 369 GNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVF 428
            NS++Y+ SR LYGL+    AP +F KTNKQGVP++++L   +F  LAY+N+S  + +VF
Sbjct: 390 ANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVF 449

Query: 429 DWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVI 488
            + +   ++ G  +W+ I +++IRF +  + +GI ++ L +++   P+GA+++ FF  +I
Sbjct: 450 TYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509

Query: 489 ILIQGFDSFAPE-FVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREI 547
            LI+ F +F  + F +  FI  YI +  +I+ ++G+++ +KT+ I+  E+VD+ + +  +
Sbjct: 510 GLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTK-IIPSEEVDLVSFKEAV 568

Query: 548 DALVWSDDDEPKTLLQK 564
           D     +++E K L ++
Sbjct: 569 DL----EEEEGKMLDEE 581

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  377 bits (969), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 192/512 (37%), Positives = 318/512 (62%), Gaps = 15/512 (2%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
           +D   +K+DLK RH+SMI++GG++GTGL +G  + +R AGP   L+AY F+GT+ F    
Sbjct: 77  DDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMA 136

Query: 117 SLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF- 175
           +LGEMA +IP+   FT Y  R+  PALG A GY Y F + +    +L+    +IQYW   
Sbjct: 137 ALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDR 195

Query: 176 -AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV-MVCGGSSE 233
             V   VWI +F +++ A N I V+++GE EFW+++ K++ + G +I+  V M+ GG + 
Sbjct: 196 DTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNH 255

Query: 234 GALGFRYWKNPG---PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKN 290
             LGFRYWK PG   P+   +++      +F+ +V+  + A F Y G EL GI A E++N
Sbjct: 256 DRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAEN 315

Query: 291 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNS 348
           PR+ +P+AI    +RILFFY+ ++F +G+ V Y DP L  +  + +    SPFV+AIQNS
Sbjct: 316 PRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNS 375

Query: 349 GTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLT 408
           G  VLP +FN  +L+ + SA NS++Y+G+R LY L+  G AP +F KTN+ GVP+ A+  
Sbjct: 376 GVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGG 435

Query: 409 SSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLP 468
             +F  LAY+N+S  + ++F++ + + ++ G  +W  I ++ I F + ++ +GI R+   
Sbjct: 436 CVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFA 495

Query: 469 FKAKFMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLF 527
           + A F P+G+Y+A FF  ++ LI+ F  F   EF +  FI  YI + ++   ++G+++ +
Sbjct: 496 YVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYY 555

Query: 528 KTRLILRKEDVDIDTDRREIDALVWSDDDEPK 559
           KT+ + +  + D+++ +  +D     +++E K
Sbjct: 556 KTKTV-KPHEADLNSYKAAVD----REEEEGK 582

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  377 bits (967), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 198/519 (38%), Positives = 322/519 (62%), Gaps = 15/519 (2%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
           +++  +K++LK RH+SMI++GG++GTGL +G  + +   GPV  L+AY F+G + F    
Sbjct: 75  DENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMA 134

Query: 117 SLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
            LGEMA++IP+   FT Y  R++ PALG A GY Y F + +    +L+    +IQYW   
Sbjct: 135 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193

Query: 177 --VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVL-SIFGFLIYALVMVCGGSSE 233
             V   VWI +F +++ A N++ V+F+GE EFW+++ KV+  +   L+  ++M+ GG   
Sbjct: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDH 253

Query: 234 GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 293
             LGFRYW++PG +     +      +F  +V+  + + F+Y G EL GI   E++NPRK
Sbjct: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313

Query: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT--SPFVMAIQNSGTK 351
           +VPKAI    +RI+ FY+ ++F +G+ V Y DPRL +T    ++   SPFV+AIQNSG K
Sbjct: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
           VLP +FN  +LV + SA NS++Y+ SR LY L+  G AP +F KT+K GVP+ A++ S +
Sbjct: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
           F CLAY+N+S  + K+F++ + + ++ G  +W+ I + +I F +  + +GI ++   + A
Sbjct: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTR 530
               +GAY+A  F  +I LI+ F  F   +F +  FI  YI + ++I+ W G+++++KT+
Sbjct: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553

Query: 531 LILRKEDVDIDT-----DRREIDALVWSDDDEPKTLLQK 564
           +I +  DVD+ T     DR E +  +   D E +  LQ+
Sbjct: 554 VI-KSTDVDLYTFKEIYDREEEEGRI--KDQEREERLQR 589

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  376 bits (965), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 199/532 (37%), Positives = 323/532 (60%), Gaps = 22/532 (4%)

Query: 37  KNEGIFINQ-ENMSEVESL---------YGNDDPD----VKRDLKPRHMSMISLGGTIGT 82
           K +G+ IN  +N+S V S          Y +D  D    +++DLK RH+SMI++GG+IGT
Sbjct: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGT 106

Query: 83  GLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPA 142
           GL +G  + +  AGP+   +AY F+G + F    +LGEMA++IP+   FT Y  R+  PA
Sbjct: 107 GLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPA 165

Query: 143 LGAANGYLYWFSWCVTFALELSIIGQLIQYW--TFAVPLSVWIVVFWILLTASNMIPVRF 200
           LG A GY Y   + +    +L+    +IQYW     V   VWI +F +++ A N I V+F
Sbjct: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225

Query: 201 YGEIEFWIAALKVLSIFGFLIYALV-MVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEA 259
           +GE EFW++  KV+ + G +I   V M+ GG +   LGFR++ +PG +     S +  + 
Sbjct: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285

Query: 260 RFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGL 319
           +F+ +V+ L+ A F Y G EL GI A E+ NPRK++PKAI    +RI+ FY++++F +G+
Sbjct: 286 KFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345

Query: 320 LVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGS 377
            V Y DP L  + TS +    SP+V+AI NSG K LP +FN  +L+ + SA NS++Y+ S
Sbjct: 346 CVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405

Query: 378 RVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAV 437
           R LYGL+    AP +F  TN+ GVP+Y++L SS F  LAY+++S  + K+F++ + + ++
Sbjct: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465

Query: 438 AGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSF 497
            G  +W+ I ++++ F + +K + + R+   ++A F P+G+Y+   F  +I  I+ F  F
Sbjct: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525

Query: 498 -APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREID 548
               F +  FI  YI + +F++ + G++ + KT+ I + E+VD+ T +  ID
Sbjct: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAID 576

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  375 bits (962), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 198/539 (36%), Positives = 322/539 (59%), Gaps = 27/539 (5%)

Query: 16  HNDRSAES--SESSDVLHHR-KETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMS 72
            +D+S++S    +SDVL     + K EGI                    +K+ LK RH+S
Sbjct: 35  QSDQSSKSLCDSASDVLASEIGDGKYEGI-------------------RLKKQLKSRHIS 75

Query: 73  MISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFT 132
           MI++GG++GTGL +     ++VAGPV +L+AY F+G + F     LGEMATFIP+   FT
Sbjct: 76  MIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMATFIPL-DGFT 134

Query: 133 MYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWT--FAVPLSVWIVVFWILL 190
            Y  R+  PALG A GY Y   + +    +L+    ++QYW     V   +W+ + + ++
Sbjct: 135 SYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIWVTLVFAVI 194

Query: 191 TASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGM 249
           T  N+  VRF+GE EFW+++LKVL + G +I   V++ GG+ S   LGFRYWK+PG +  
Sbjct: 195 TVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYWKHPGAFND 254

Query: 250 GMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFF 309
                +    +F+ +V+ L+   F Y G EL GI A E+ NPR++VPKAI   F+RIL F
Sbjct: 255 YSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKLTFYRILVF 314

Query: 310 YILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAG 369
           Y++S+F +G+ VPY D +L TT+++ +  SPF +AI N+G  VLP +FNG +L+ + SA 
Sbjct: 315 YVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITVLPDIFNGCLLIFVFSAA 374

Query: 370 NSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFD 429
           NS++Y+ SR LY L+    AP +F  TN+ G+P+ ++  S +F  LAY+ +S ++ +VF 
Sbjct: 375 NSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTVSSSSAQVFK 434

Query: 430 WLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVII 489
           + + + ++AG   W+ I +++I F + ++ + + ++   + A F P+GAY + FF  +I 
Sbjct: 435 YFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYVSLFFCCLIA 494

Query: 490 LIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREID 548
           +I+ F  F   F +  FI  YI + +F++C+ G+++  K+  I     VD+ + +  +D
Sbjct: 495 IIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSE-IRSARYVDLVSQKSLVD 552

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  373 bits (958), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 193/514 (37%), Positives = 322/514 (62%), Gaps = 13/514 (2%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
           +++  +++DLK RH+SMI++GG++GTGL +G  + +   GPV  L+AY F+G + F    
Sbjct: 77  DENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMA 136

Query: 117 SLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
            LGEMA++IP+   FT Y  R++ PALG A GY Y F + +    +L+    +IQYW   
Sbjct: 137 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195

Query: 177 --VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVL-SIFGFLIYALVMVCGGSSE 233
             V   VWI +F +++ A N++ V+F+GE EFW+++ KV+  +   L+  ++M+ GG + 
Sbjct: 196 DRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNH 255

Query: 234 GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 293
             LGFRYW++PG +     +    + +F+ +V+  + + F+Y G EL GI   E++NPRK
Sbjct: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315

Query: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT--SPFVMAIQNSGTK 351
           +VPKAI    +RI+ FY+ ++F +G+ V Y DPRL +T    ++   SPFV+AIQNSG +
Sbjct: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
           VLP +FN  +LV + SA NS++Y+ SR LY L+  G AP +F KT++ GVP+ A++ S +
Sbjct: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
           F  LAY+N+S  + K+F++ + + ++ G  +W+ I + +I F +  + +GI ++   + A
Sbjct: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTR 530
               +GAY+A FF  +I LI+ F  F   +F +  FI  YI + ++I+ W G+++++KT+
Sbjct: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555

Query: 531 LILRKEDVDIDT-----DRREIDALVWSDDDEPK 559
           +I +  DVD+ T     DR E +  +   + E +
Sbjct: 556 VI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  372 bits (955), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 201/544 (36%), Positives = 336/544 (61%), Gaps = 15/544 (2%)

Query: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD-----VKRDLKPRHM 71
           N  ++   +++ VL+   ET  EGI +  E+  +V S+    D       +K++L+ RH+
Sbjct: 2   NSDTSMEKKNAGVLYS-NETLEEGI-VTLESEGQVRSVSEGVDGKHEGIRLKKELEARHV 59

Query: 72  SMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSF 131
           SMI++GG++GTGL +G  S +  AGPV  L++Y F+G + + V   LGEMA FIP+   F
Sbjct: 60  SMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGF 118

Query: 132 TMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA--VPLSVWIVVFWIL 189
           T Y  R++ PA+G A GY Y F + +    +L+    ++Q+W     V   VWI +F  L
Sbjct: 119 TSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLAL 178

Query: 190 LTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWG 248
           +   N + VRF+GE EFW++++KVL + G ++   +++  GG +    GFR+W++PG + 
Sbjct: 179 IVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFK 238

Query: 249 MGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILF 308
               + +  + +F+ + S    A F Y GTEL GI A E+KNPR++VP+AI    +RI+ 
Sbjct: 239 PYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVV 298

Query: 309 FYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTIL 366
           FY++++  +G+ V Y DPRL  +    +    SPFV+AI+N+   VLP +FN  +LV + 
Sbjct: 299 FYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVF 358

Query: 367 SAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKK 426
           SA NS++Y+ SR LYGL+  G AP +F  TNK GVP+Y++  S +F  LAY+N+S  + +
Sbjct: 359 SACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQ 418

Query: 427 VFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFIT 486
           VF++ + + ++ G  +W+ I +++IRF + ++ +   ++ L + A F PW  Y A FF  
Sbjct: 419 VFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCC 478

Query: 487 VIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRR 545
           +I LI+ +  F   +F +  FI+ YI + ++++C++G++V+++T+LI + EDVD+ T + 
Sbjct: 479 LIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKD 537

Query: 546 EIDA 549
            IDA
Sbjct: 538 AIDA 541

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  372 bits (956), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 192/512 (37%), Positives = 314/512 (61%), Gaps = 16/512 (3%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +K++LK RH+SMI++GG++GTGL +G  + +  AGP    + Y F+G + F     LGEM
Sbjct: 64  LKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEM 123

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS- 180
           A FIP+   FT Y  R++ PALG A GY Y   + +  A +L+    ++QYW     L+ 
Sbjct: 124 AAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNP 182

Query: 181 -VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGF-LIYALVMVCGGSSEGALGF 238
            V+I +F IL+   N+  V+ +GE EFW+++ KVL + G  L+  ++M+ GG +   LGF
Sbjct: 183 GVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGF 242

Query: 239 RYWKNPG---PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295
           RYW++PG   P+   +IS +    +F+ + S  + A F Y G EL GI A E++NPRK +
Sbjct: 243 RYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNI 302

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVL 353
           PKAI    +RI+ FY++++  + + V Y DP L  +T   +    SPFV+AI+NSG  +L
Sbjct: 303 PKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINIL 362

Query: 354 PSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFG 413
           P +FN  +L  +LSA NS++Y+ SR LY L+    AP  F KTNK G+P++++  S+ F 
Sbjct: 363 PHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFS 422

Query: 414 CLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKF 473
           CLAY+N+S +A  VF++ +   ++ G  +W+ I +++I F +  K +G+ +++  + A +
Sbjct: 423 CLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPW 482

Query: 474 MPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLI 532
            P+GAY+A FF  V+ L++ F  F   +F +  FI  YI + +F +C++G+++++KT+  
Sbjct: 483 QPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTK-T 541

Query: 533 LRKEDVDIDT-----DRREIDALVWSDDDEPK 559
            R E+VD+ T     D+ E D  +   + E +
Sbjct: 542 HRPEEVDLVTLKALIDQEEEDGKIEDAEREER 573

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  370 bits (949), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 195/518 (37%), Positives = 320/518 (61%), Gaps = 18/518 (3%)

Query: 44  NQENMSEVESLYG----NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVG 99
           NQ+++S  ES       +D   +K++L+ RH+SMI++GG++GTGL +G  + + +AGPV 
Sbjct: 33  NQDDISSQESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVS 92

Query: 100 SLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTF 159
            L+AY F+G + + V   LGEMAT+IP+   FT Y  R+  PALG A GY Y F + +  
Sbjct: 93  ILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIIT 151

Query: 160 ALELSIIGQLIQYWTF--AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIF 217
             +L+    ++QYW     V   VWI +F +++   N++ V+F+GE EFW+++ KVL + 
Sbjct: 152 PNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVML 211

Query: 218 GFLIYALV-MVCGGSSEGALGFRYWKNPG---PWGMGMISSNKYEARFLGWVSSLIKAAF 273
             ++   V M+ GG S   LGFR++K+PG   P+   +  S   + +F+ +V+  + A F
Sbjct: 212 CLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGS---KGKFVSFVAVFVYALF 268

Query: 274 TYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL--STT 331
            Y GTEL GI A E KNPR+ VP+AI    +RI+ FY++++F +G+ V Y DP L  +  
Sbjct: 269 AYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKK 328

Query: 332 SDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPS 391
             +    SPFV+AI+N+G  VLP +FN  +L+ + SA NS++Y+ SR LYGL+    AP 
Sbjct: 329 KSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPK 388

Query: 392 LFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHI 451
           +F KTNK GVP+ +++   +F  LAY+N+S  + +VF++ + + ++ G  +W+ I +++I
Sbjct: 389 IFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYI 448

Query: 452 RFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADY 510
            F + L+ +G+ ++ L + A     GAY+A FF  +I LI+ F  F   +F +  FI  Y
Sbjct: 449 YFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGY 508

Query: 511 ISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREID 548
           I + +FI+C+ G++ +  T+ + + E+ D+ T +  ID
Sbjct: 509 IGIPVFIICFFGYKYIRGTKFV-KPEEADLYTFKELID 545

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  368 bits (944), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 198/496 (39%), Positives = 305/496 (61%), Gaps = 17/496 (3%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           ++R LK RH+ MI++GG IGTGLF+G +  +R AGP G L+ +  M T+  C+  SLGEM
Sbjct: 84  LQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEM 143

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS- 180
           A   PV+  +T Y  RF+  + G AN   Y     V   LE+      + YW    P S 
Sbjct: 144 AVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWG---PKSQ 200

Query: 181 ---VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236
               ++ +FW+ + + NM  V+ YGE EF  + +KV+++ GF+I  +++VCGG  +   +
Sbjct: 201 YRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYI 260

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G ++W NPG + +G  +  K++    G  S  + AAF++  TELVG+ A E+++PRK+VP
Sbjct: 261 GSKFWSNPGAF-VGDTAGQKFK----GICSVFVTAAFSFANTELVGLAAAETEDPRKSVP 315

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
           KA  +VF+RI  FYILSL  VGLLVPYTDPRL  +S  D   SPFV+A++N G K LPSV
Sbjct: 316 KAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSV 375

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL  +LS GNS+++  SR L  LS+ G  P++F   +++G P  +++ SS FG L 
Sbjct: 376 INVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLC 435

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +L +S   +++FDW+L+++ ++  F WL ISL HIRF + L  +  S ++L F +    W
Sbjct: 436 FLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIW 495

Query: 477 GAYYAAFFITVIILIQGFDSFAPEF---VFSEFIADYISVFLFIVCWLGFQVLFKT-RLI 532
           G+YY+ F I V++++Q + +  P       S F   Y+S+ + +  +LG ++  K  +L+
Sbjct: 496 GSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLL 555

Query: 533 LRKEDVDIDTDRREID 548
           +  + +DIDT RRE+D
Sbjct: 556 IDPKYMDIDTGRRELD 571

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  368 bits (944), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 199/548 (36%), Positives = 333/548 (60%), Gaps = 10/548 (1%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDD-PDVKRDL 66
           E Y   ++  D     ++  ++LH   E  N  +  + E+ ++  ++ G  +   +K+ L
Sbjct: 17  EEYFDPQKKVDSKTFPTQERELLHDDLE-NNISLSTSAEDQNDSYNVDGKTEGTRLKKVL 75

Query: 67  KPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP 126
           + R +SM+++GG++GTGL +G  + +  AGPV  L+AY F+G + F    SLGEMA++IP
Sbjct: 76  EGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIP 135

Query: 127 VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW--TFAVPLSVWIV 184
           +   FT Y  R+  PALG A GY Y F + +    +L+    +IQYW     V   VWI 
Sbjct: 136 L-DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWIT 194

Query: 185 VFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKN 243
           +F +++ A N + V+F+GE EFW+++ KVL +F  +I   +++ GG  +   LGFR+WK+
Sbjct: 195 IFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKH 254

Query: 244 PGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVF 303
           PG +     +      +F+ +VS  + A F Y GTELVGI  GE++NPRK+VPKAI    
Sbjct: 255 PGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTM 314

Query: 304 FRILFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVI 361
           +RI+ FY++S+  +G+ V Y DP L  + T  +    SPFV+AI NSG KVLP +FN  +
Sbjct: 315 YRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACV 374

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           LV + SA NS++Y+ SR LY L+    AP +F +TN+ G+P+Y++  S +F  LAY+++S
Sbjct: 375 LVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVS 434

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
             + K+F++ + + ++ G  +W+ I ++++ F + ++ +GI ++   + A    +GAY+A
Sbjct: 435 SGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFA 494

Query: 482 AFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540
            FF ++I LI+ F  F   +F +  FI  YI + +F + + G+++++KT++I   E VD+
Sbjct: 495 LFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKIIDPLE-VDL 553

Query: 541 DTDRREID 548
            T +  ID
Sbjct: 554 YTFKAAID 561

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  363 bits (932), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/564 (36%), Positives = 310/564 (54%), Gaps = 26/564 (4%)

Query: 4   NVEL-ETYP-----AGKQHNDRSAESSESSDVLHHRKETKNEGIFINQE------NMSEV 51
           NV++ ET P     A  +H D   +  E        K+ K+   F   E      N++E 
Sbjct: 15  NVQVKETLPDVETGASYEHYDNYIDEEEQGPPDSRWKKIKDS--FKRAEVPELDPNLTEA 72

Query: 52  ESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTI 110
           E +        ++  LK RH+ MIS+GG IGTGLF+G  + +R AGP G L+ ++  G++
Sbjct: 73  EKIAIATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSM 132

Query: 111 AFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLI 170
            +C+  S+ E+A   PV   FT Y  RF+  + G AN + Y   W VT  LE+      +
Sbjct: 133 IYCMVMSVAELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITV 192

Query: 171 QYW-TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCG 229
            YW T       ++ +FW+++   NM  VR YGE EF  +  K+L I GF+I A++++CG
Sbjct: 193 NYWHTDKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICG 252

Query: 230 GSSEGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGES 288
           G         RYW +PG +  G  S  K++    G+ S  + AAF++ G+ELVG+ A E+
Sbjct: 253 GGPGTGYIGARYWYHPGAFA-GDTSGRKFK----GFCSVFVTAAFSFAGSELVGLAAAEA 307

Query: 289 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNS 348
            NPRK VP A  +VF+RI  FY+L L  +G+LVPYTDPRL   S  D   SPFV+AI+N 
Sbjct: 308 SNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQ 367

Query: 349 GTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLT 408
           G   LP++ N VIL+ +LS GNS +Y  SR L  L+  G  P  F   ++ G P   +  
Sbjct: 368 GISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAV 427

Query: 409 SSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLP 468
           +S FG +A++  S    +VFDWL+ ++ ++  F W  I L HIRF + L  +G S N+L 
Sbjct: 428 TSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELA 487

Query: 469 FKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFV---FSEFIADYISVFLFIVCWLGFQV 525
           F +    WGA +  F   +++  Q + +  P       ++F   Y+S+ + +  WLG ++
Sbjct: 488 FASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKI 547

Query: 526 LFKT-RLILRKEDVDIDTDRREID 548
             K  +L ++ ED+DIDT RRE+D
Sbjct: 548 WKKNWKLFIKAEDMDIDTGRRELD 571

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  363 bits (933), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 186/514 (36%), Positives = 318/514 (61%), Gaps = 15/514 (2%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +K++L+ RH+SMI++GG++GTGL +G  + +  AGP    +AY F+G + F    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF--AVPL 179
           A++IP+   FT Y  R++ PALG A GY Y F + +    +L+    +IQYW     V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSE-GALGF 238
            VWI +F +++   N+  V+F+GE EFW+++ KVL + G ++   +++ GG  +   LGF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           RYW++PG +     + +    +F+ +VS  + A F Y G EL GI A E+ NPRK+VP+A
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSV 356
           +    +RI+ FY++++F +G+ V Y DPRL  +  + +    SPFV+AIQNSG +VLP +
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
           FN  +L+ + SA NS++Y+GSR LY L+  G AP++FK+T   G+P Y++    +F  LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           Y+N+S  + +VF++ + + ++ G  +W+ I +++I FM+ +K +G+ R+   + A F P+
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 477 GAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK 535
           G Y++  +   I  I+ F  F    F +  FI  YI + +F++ + G++ + KT+ I++ 
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK-IVKS 576

Query: 536 EDVDIDT-----DRREIDALVWSDDDEPKTLLQK 564
            +VD+ T     D++EI+  +   D E +  L++
Sbjct: 577 HEVDLFTGKEVFDQQEIEGKIL--DQEKQIRLRE 608

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  362 bits (929), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/513 (38%), Positives = 316/513 (61%), Gaps = 16/513 (3%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +K+DL+ RH+SMI++GG++GTGL +G  S +  AGP+  L+AY  MG + F V   LGEM
Sbjct: 58  LKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGEM 117

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF--AVPL 179
           A +IP+   FT Y  R+  PALG A GY Y F + V    +L+    ++QYW     V  
Sbjct: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGF 238
            VWI VF  ++   N++ V+F+GE EFW+++ KVL +   +   LV+V GG  S   LGF
Sbjct: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNRLGF 236

Query: 239 RYWKNPG---PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295
           RYWK+PG   P+  G +S    + +F+ + S  + A F Y GTEL GI A E KNPR+ V
Sbjct: 237 RYWKDPGGFKPYS-GAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNV 295

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT--SPFVMAIQNSGTKVL 353
           P+AI    +RI+ FY+ ++F +GL V Y DP L  T  +  +   SP+V+AI+N+G  VL
Sbjct: 296 PRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIPVL 355

Query: 354 PSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFG 413
           P +FN  +L  + SA NS++Y+GSR LYGL+    AP +F KTN  GVP+ ++   ++F 
Sbjct: 356 PHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFC 415

Query: 414 CLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKF 473
           CLAY+N+S +A+ +F + + +T++ G  +W+ I +++I F +  + +GI +N L ++A F
Sbjct: 416 CLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPF 475

Query: 474 MPWGAYYAAFFITVIILIQGFDSFAPE-FVFSEFIADYISVFLFIVCWLGFQVLFKTRLI 532
            P  A+ A  F  ++ L++ F  F  + F +  FI  YI + ++I+C++ ++++ KT+ I
Sbjct: 476 QPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI 535

Query: 533 LRKEDVDIDTDRREIDALVWSDDDEPKTLLQKL 565
            +  +VD+ T +  ID     +++E K  + +L
Sbjct: 536 -KSANVDLFTYKTAIDL----EEEEGKLEMMRL 563

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  354 bits (909), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 181/494 (36%), Positives = 295/494 (59%), Gaps = 9/494 (1%)

Query: 46  ENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           E+  E E +    + ++ R+LKPR +S+++LG  +GTGL +G  S +   GP+   +AYL
Sbjct: 17  EDECESEEI-DEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYL 75

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
           F G++   V  SL EMA+F P+   F+ Y  R++ PA G A G+ Y+  + +  +  L+ 
Sbjct: 76  FTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTA 135

Query: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225
            G +I YW   V + VW+ V ++ +   N + V+++GEIE  +   K+L +    I  L+
Sbjct: 136 FGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLI 195

Query: 226 MVCGGS-SEGALGFRYWKNPG--PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVG 282
           + CGG+ +    GFRYW+  G  P+ +G         +FLGW + ++++ F + G+E++G
Sbjct: 196 ITCGGAPNHTTTGFRYWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIG 250

Query: 283 ITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFV 342
           I  GE+ NP+KT+PK+   VFFRI F Y+  +F +GL +   + +L     +D N SPFV
Sbjct: 251 IVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFV 310

Query: 343 MAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVP 402
           +AI +SG KVLP+  N  +LV I+S+ N++IYI SR LYGL+K G AP +F   N+  VP
Sbjct: 311 IAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVP 370

Query: 403 FYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGI 462
               +T S+ G LAY+N  ++A  VF ++ +  +V G   W  I +++I + + +K +GI
Sbjct: 371 VVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGI 430

Query: 463 SRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLG 522
           S +D+PF+  F P+ AY   FF+T+I    G+++F  +F +  FI  YI VF  I+  +G
Sbjct: 431 SIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIG 490

Query: 523 FQVLFKTRLILRKE 536
           +++ FKT+ +   E
Sbjct: 491 YKLYFKTKFVKPSE 504

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  357 bits (915), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/557 (36%), Positives = 326/557 (58%), Gaps = 29/557 (5%)

Query: 19  RSAESSESSDVLHH------RKETK---NEGIFIN---QENMSEVESLYGNDDPDV---- 62
           R   S+ +SD          +KE K    E   IN   + N+S   S   ND  ++    
Sbjct: 4   RQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKT 63

Query: 63  -----KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
                K+ LK RH+SMI++GG++GTGL +G  + + +AGPV +L+AY F+G + F     
Sbjct: 64  EGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMAC 123

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWT--F 175
           LGEMAT+IP+   FT Y  R+  PALG A GY Y F + +    +L+    +IQYW    
Sbjct: 124 LGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKE 182

Query: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSE-G 234
            V   VW+ +F +++ + N+  VRF+GE EFW+++ KVL + G ++   +++ GG  +  
Sbjct: 183 KVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHD 242

Query: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294
            LGFRYW++PG +     +      RF+ +VS  + A + Y G EL GI A E++NPRK+
Sbjct: 243 RLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKV 352
           +PKAI    +RI+ FY++S+F +G+ V Y DP L  +  S +    SPFV+AI NSG   
Sbjct: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINA 362

Query: 353 LPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIF 412
           LP + N  +LV + SA NS++Y+ SR LY L+    AP +F KTN+ G+P+YA+  S +F
Sbjct: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422

Query: 413 GCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAK 472
             LAY+ +S  + K+F++ + + ++ G  +W+ I +++I F + ++ +G+ ++   + A 
Sbjct: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482

Query: 473 FMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRL 531
           F P+GA+++ FF  +I LI+ F  F   +F +  FI  YI + +F  C+ G++  +KT++
Sbjct: 483 FQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKV 542

Query: 532 ILRKEDVDIDTDRREID 548
           I     VD+ T +  ID
Sbjct: 543 I-DPLKVDLYTFKAAID 558

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  356 bits (913), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 191/539 (35%), Positives = 320/539 (59%), Gaps = 26/539 (4%)

Query: 35  ETKNEGIFINQENMSE------VESLY------------GNDDPDVKRDLKPRHMSMISL 76
           E KN GI  + E + E      +E                ++   +K+ L+ RH+SMI++
Sbjct: 6   EKKNAGILYSNETLEEDVAFDKLERGASGASAAGASVDGKHEGIRLKKALEARHVSMIAI 65

Query: 77  GGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQ 136
           GG++GTGL +G  S +  AGP   L++Y F+G + + V   LGEMA FIP+   FT Y  
Sbjct: 66  GGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYAS 124

Query: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF--AVPLSVWIVVFWILLTASN 194
           R++ PALG A GY Y F + +    +L+    ++QYW     V   VWI +F +L+   N
Sbjct: 125 RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLIN 184

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWGMGMIS 253
            + VRF+GE EFW++++KVL + G ++   +++  GG +    GFRYW++PG +     +
Sbjct: 185 TVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRYWRDPGAFKPYSEA 244

Query: 254 SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313
            +  + +F+ + S    A F Y GTEL GI A E+KNPR++VP+AI    +RI+ FY++S
Sbjct: 245 ISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVIS 304

Query: 314 LFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNS 371
           +  +G+ V Y DP L  +    +    SPFV+AI+N+G  VLP +FN  +L+ + SA NS
Sbjct: 305 ILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIFNACVLLFVFSACNS 364

Query: 372 NIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWL 431
           ++Y+ SR LYGL+    AP +F KTN  GVP+Y++  S +F  LAY+N+S  + ++F++ 
Sbjct: 365 DLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYF 424

Query: 432 LTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILI 491
           + + ++ G  +W+ I ++++RF + +  +   ++   + A F PW  + + FF  +I LI
Sbjct: 425 VNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLI 484

Query: 492 QGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDA 549
           + +  F    F +  FI+ YI + ++ +C++G++++ +++LI + EDVD+ T +  IDA
Sbjct: 485 KNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KPEDVDLYTFKAAIDA 542

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  353 bits (907), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/590 (33%), Positives = 332/590 (56%), Gaps = 28/590 (4%)

Query: 4   NVELETYPAGKQH----NDRSAESSESSDVLHHRKETKNEGI--FINQENMSEVESLYGN 57
           N ELE  P+ K       D  A+     D L  R   K+ G+   +   + +   SL  +
Sbjct: 11  NYELEDIPSSKNELKELGDMEAQQMNLDDSLDDRFNKKDSGLNKVLTVSSDTSTNSLEED 70

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
               +K+ LK RH+ +I+LGG IGTGLF+G +S +   GP G  +AY  + ++ + +  +
Sbjct: 71  YTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNA 130

Query: 118 LGEMATFIP-----VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQY 172
           +GEM  ++P        S T   +R++  +L  A G+ Y++ + +  A E +    +++Y
Sbjct: 131 VGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEY 190

Query: 173 WTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS- 231
           WT AVP + WI +F  ++   NM  V+++GE EFW A++K+L I G +I + ++  GG  
Sbjct: 191 WTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGP 250

Query: 232 SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKN 290
           S   LGFRYWKNPG +   +  ++     FL   S +IK AF +  G ELV +T+ E  +
Sbjct: 251 SHDRLGFRYWKNPGAFAHHV--TDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSD 308

Query: 291 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDI---NTSPFVMAIQN 347
            R+ + KA  +  +R++FFYIL    +G++V + DP L++   ++     +SPFV+ IQN
Sbjct: 309 QRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQN 368

Query: 348 SGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVL 407
           +G +VLP + N  IL +  S+GN+ ++  SR L+ ++++G AP +F + NK GVP+ AV+
Sbjct: 369 AGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVI 428

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
            S++  CLAYLN S +A +VF WL  I+ ++GF  W+   ++++RF + +    +  + +
Sbjct: 429 LSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRM 487

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLGFQVL 526
           PFK    P+   ++   +++I +  G+ +F P+F   S+FIA YI++ +F+  ++G +V 
Sbjct: 488 PFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVY 547

Query: 527 --FKTRLILRK-----EDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSF 569
             FK    L K     ED+D+ T   EI+     + DE + L    W+ F
Sbjct: 548 NHFKNDYPLMKLAYSVEDIDVITGLDEIETKT-CELDENRILPTNRWERF 596

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  352 bits (903), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/521 (35%), Positives = 305/521 (58%), Gaps = 17/521 (3%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +K+ L+ RH+ +I+LGG IGTGLF+G +S +   GP G L +Y+ +  + + V  +LGEM
Sbjct: 49  LKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEM 108

Query: 122 ATFIPVTS-----SFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
             ++P +      S +    R+  P+LG A G+ Y++ + +  A E +    ++ YWT  
Sbjct: 109 VCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTV 168

Query: 177 VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMV-CGGSSEGA 235
           VP + WI +F  ++T  N  PV+FYGE EFW A LK+L I G L  + ++   GG S   
Sbjct: 169 VPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDR 228

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKT 294
           LGFRYW+ PG +   + + N    RFL   + +IK  F +  G ELV +T+ E+ + R+ 
Sbjct: 229 LGFRYWQKPGAFAYHITTGNT--GRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRN 286

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLS---TTSDSDINTSPFVMAIQNSGTK 351
           + KA  +  +R++FFY+ S   +G++V   DP L     +  +   +SPFV+AIQN+  K
Sbjct: 287 IEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIK 346

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
           +LP + N  IL +  S+GNS ++  SR L  +++ G+AP +FKK N+ GVP+ AV  S+ 
Sbjct: 347 ILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAA 406

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
           F CLAYLN+S  + K F W   I+ ++GF  W+ I ++++RF + +  RG+  + +PFK+
Sbjct: 407 FSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKS 465

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLGFQVLFKT- 529
            F P+G Y+    +++I L  G+ +F P F   ++F+A YI++ +F+V W+G ++  +T 
Sbjct: 466 PFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTL 525

Query: 530 -RLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSF 569
              ++   +VD+ T   EI+ L   + D  +      W+ F
Sbjct: 526 STWVIPVAEVDVTTGLAEIEELT-KELDALRVPPNSAWEKF 565

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  350 bits (898), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/566 (35%), Positives = 315/566 (55%), Gaps = 17/566 (3%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLK 67
           ETY    + ND S  +SE+ D       + NE   +  EN+         +D    +DL 
Sbjct: 19  ETYKQSSR-NDMSPLTSEAPDFKKADAASGNESWAL--ENVESTSGTSDAEDSRYNKDLS 75

Query: 68  PRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPV 127
            RH+  +++GG IGTGLF+   S +   GP   ++ ++ + T  F +  +LGE+++  PV
Sbjct: 76  VRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPV 135

Query: 128 TSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFW 187
              F +Y  RF+ P+ G A    Y   W V   LEL      I+YW   +    W+ +F+
Sbjct: 136 VGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFY 195

Query: 188 ILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGP 246
            ++  +N++ V+ +GE EF ++ +K+L+I GF I  +V+ C GG   G +G +YW NPG 
Sbjct: 196 TIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGA 255

Query: 247 WGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRI 306
           + +G  SS     RF G  S  + AAF+Y GTEL+ ++A ES NPR T+PKA  + F+ I
Sbjct: 256 F-VGNTSSQ----RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLI 310

Query: 307 LFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFNGVILVTI 365
              YI+ L  VG LVP  DPRL   S S D+  SP V+AI+N G K LPS+ N +IL+ +
Sbjct: 311 TVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAV 370

Query: 366 LSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAK 425
           LS  NS +Y  SR +  +++ G  P  F   +++G P YA+L + IFG L+++  S   +
Sbjct: 371 LSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQE 430

Query: 426 KVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFI 485
            VF WL  ++ ++  F W  I++SHIRF   +K RG S ++LPF +    WG+YY    I
Sbjct: 431 TVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWGSYYGCVII 490

Query: 486 TVIILIQGFDSFAP--EFVFS--EFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDI 540
            V++++  + +  P  E V S   F   Y+S  + +VC++G ++  K+ RL+    ++DI
Sbjct: 491 FVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDI 550

Query: 541 DTDRREIDALVWSDDD--EPKTLLQK 564
           D+ RR +D  V  D+   E + + +K
Sbjct: 551 DSGRRAVDIEVLKDEKRMEEQAMREK 576

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  348 bits (893), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/539 (36%), Positives = 318/539 (58%), Gaps = 17/539 (3%)

Query: 19  RSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGG 78
           + A + E   + H    T  E   ++     + E +       +K+DL+ RH+SMI++GG
Sbjct: 22  KLAAAGEGRGLRHTHSSTDQEAQSVDWNYDGKHEGI------RLKKDLQARHVSMIAIGG 75

Query: 79  TIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRF 138
           ++GTGL +G  S +  AGP   L+AY  MG + F V   LGEMA +IP+   FT Y  R+
Sbjct: 76  SLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGEMAAYIPL-DGFTSYATRY 134

Query: 139 LSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS--VWIVVFWILLTASNMI 196
             PALG A G+ Y F + V    +L+    +IQ+W  A  +S  VWI V   ++   N +
Sbjct: 135 ADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTV 194

Query: 197 PVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSN 255
            VRF+GE EFW+++ KVL +   +I  LV+  GG  +   LGFRYW +PG +        
Sbjct: 195 GVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDT 254

Query: 256 KYEA---RFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYIL 312
             +    +F+ ++S  + A F Y GTEL GI A E K+PR+ VP+AI    +RI+ FY++
Sbjct: 255 HIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLV 314

Query: 313 SLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGN 370
           ++F +G+ V Y DP L  +++++     SP+V+AI+N+   VLP++FN  +L  + SA N
Sbjct: 315 TIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACN 374

Query: 371 SNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDW 430
           S++Y+GSR LYGL+  G AP LF +TNK GVP+ A+   ++F CLAY+++S++A+  F +
Sbjct: 375 SDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGY 434

Query: 431 LLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIIL 490
            + +T++ G  +W+ I +++I F +  + +GI ++ L + A   P+  + A  F   + L
Sbjct: 435 FVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVAL 494

Query: 491 IQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREID 548
           I+ FD+F   E     FI  YI + ++I C++G++++ KT+ I  KE VD+ T +  ID
Sbjct: 495 IKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKIVHKTKWIPSKE-VDLFTFKEAID 552

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  347 bits (890), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/531 (36%), Positives = 308/531 (58%), Gaps = 14/531 (2%)

Query: 22  ESSESSDVLHHRKETK-NEGIF-INQENM-SEVESLYGNDDPDVKRDLKPRHMSMISLGG 78
           E+S S    +  KE K NE  +  +  N+ S+   +  + + ++K+ L  RH+ +I+LGG
Sbjct: 8   EASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIALGG 67

Query: 79  TIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRF 138
            IGTGLF+G +S +   GP    L+++ + T+ +C+  +L EM  ++P   S      R+
Sbjct: 68  CIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRY 127

Query: 139 LSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPV 198
           + P+LG A G+ Y +S+ +  A EL+    +++YWT  VP  VWI +F I++   N   V
Sbjct: 128 VDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAV 187

Query: 199 RFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKY 257
           RFYGE EFW A+LK++ I   L+ ++V+  GG+ +   +GFRYW+NPG +G  +   N  
Sbjct: 188 RFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGGNL- 246

Query: 258 EARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFF 316
             RFL   +++IK+AF +    ELVG+   E+K+ R+ + KA  +  +RI+FFY+ S   
Sbjct: 247 -GRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLM 305

Query: 317 VGLLVPYTDPRLSTTSDSD---INTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNI 373
           +G++V   D  L    + +     +SPFV  I NSG  VL  V N  IL +  SAGNS  
Sbjct: 306 IGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFF 365

Query: 374 YIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLT 433
           Y  SR +  LSK G AP +F K N+ GVP+ AV   S+  CLAYLN+S  + KVF WL  
Sbjct: 366 YASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSN 425

Query: 434 ITAVAGFFAWLLISLSHIRFMQ-VLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQ 492
           I  ++GF  W LI +++IRF + +L +R + R  +P+++   P+ AY+    + +I L  
Sbjct: 426 ICTISGFIGWFLIGVAYIRFRKAILFNRLLDR--IPYRSPLQPFSAYFFTIVVAIITLTN 483

Query: 493 GFDSFAP-EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDT 542
           G+  F    + + +F+  YIS+ +F+  +LG + ++KTR  +  + +D+ T
Sbjct: 484 GYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVIT 534

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  348 bits (894), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/566 (36%), Positives = 318/566 (56%), Gaps = 20/566 (3%)

Query: 9   TYPAGKQHNDRSAESSES----SDVLHHRKETKNEGIFINQENMSEVESLYGND-DPDVK 63
           T  A    ND + + S+S    + +    K  + E +     N++E E +  N     +K
Sbjct: 40  TTTASIDSNDATIDHSKSVSRWTRIKDSFKRAEKEEV---DPNLTEAERIAINTAKAPLK 96

Query: 64  RDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT 123
             LK RHM M+++GG IG+GLF+G ++ +R AGP G ++ +    T+ +C+  +LGE+A 
Sbjct: 97  HTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAV 156

Query: 124 FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFAVPLSVW 182
             PV+  FT Y  RF+  + G A+ + Y   W  T  LE+      + YW T       +
Sbjct: 157 VFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDGF 216

Query: 183 IVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF-RYW 241
           + +FW+++   N+  VR +GE EF  + +KVL++ GF+I  +V+V GG  EG     RYW
Sbjct: 217 VALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYW 276

Query: 242 KNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 301
            NPG +       +    +F G  S  + AAF++ G+ELVGITA E+ NPRK+VP+A  +
Sbjct: 277 HNPGAF-----VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQ 331

Query: 302 VFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVI 361
           V +RI+ FY+ SL  +GLLVPYTDPRL   S  D + SPFV+AI   G + LPSV N VI
Sbjct: 332 VVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVI 391

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           L+ +LS GNS I+ GSR +  LS+ G  P +F   +++G P   ++  S FG +A++  S
Sbjct: 392 LIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAAS 451

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
           +   +VF WL+ ++ ++  F W  I L HIRF   LK +G S N+LPF +     G+ + 
Sbjct: 452 KKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWG 511

Query: 482 AFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKED 537
            F + ++ + Q + +  P   +     F   Y+S  + +  + G ++  K  +L ++ ED
Sbjct: 512 LFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAED 571

Query: 538 VDIDTDRREID-ALVWSDDDEPKTLL 562
           +DIDT RRE D  L+  + +E K +L
Sbjct: 572 MDIDTGRRETDLELLKQEIEEEKAIL 597

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  347 bits (891), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/575 (35%), Positives = 315/575 (54%), Gaps = 21/575 (3%)

Query: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVE--SLYGNDDP 60
           ++    +Y  G       A  S   D     K  + E +     N++E E  ++     P
Sbjct: 20  QDAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVELEEL---DPNLTEAEKIAIITAQSP 76

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
            ++R LK RH+ MI++GG IGTGLF+G    +R  GP G L+ +  +G + +CV  S+GE
Sbjct: 77  -LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGE 135

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFAVPL 179
           +A   PV+  FT Y  RF+  + G A  Y Y   W V   LE+      + +W T     
Sbjct: 136 LAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYR 195

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF- 238
             ++ +F+I++   N   VR YGE EF  + +KV+++ GF+I  +V+VCGG   G     
Sbjct: 196 DGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGG 255

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           +YW NPG +     S +   +RF G  S  + AAF++ GTELVG+ + E+ NPRK +P+A
Sbjct: 256 KYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRA 310

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
             +VF+RIL FYI+SL  +GLLVP+T  RL  TS  D   SPFV+AIQ  G K LPSV N
Sbjct: 311 AKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVIN 370

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            VIL+++LS GNS +Y  SR +  L++ G  P +F   +++G P  A++T+ +FG L+++
Sbjct: 371 VVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFI 430

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
             S+    VF+WLL ++ ++  F+W  I + HIRF + L  +G S ++L F +     G+
Sbjct: 431 AQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGS 490

Query: 479 YYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKT-----RLIL 533
           Y+    + ++++ Q + +  P    S    D+ S +L     L F +  K      +L  
Sbjct: 491 YFGVILVLLVLIAQFWVAVWP-IGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFT 549

Query: 534 RKEDVDIDTDRREID--ALVWSDDDEPKTLLQKLW 566
           R +D+DIDT RRE+D  AL     +E   L  + W
Sbjct: 550 RAKDIDIDTGRREMDTEALRQEIAEEKMLLSTRPW 584

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  347 bits (891), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/529 (37%), Positives = 302/529 (57%), Gaps = 13/529 (2%)

Query: 47  NMSEVESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           NMSE++ + +   +  ++  LK RH+ MI++GG IGTGLF+G  + +R AGP G L+ + 
Sbjct: 65  NMSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWG 124

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
             GT+ + +  +LGE+A   PV+  FT Y  RF+  + G AN   Y   W V   LE+  
Sbjct: 125 LTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVA 184

Query: 166 IGQLIQYW-TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
               + YW T       ++ +FW+ +   N+  V+ YGE EF  + +KV+++ GF+I  +
Sbjct: 185 ASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGI 244

Query: 225 VMVCGGSS-EGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           ++ CGG   +G +G RYW +P     G    +   ARF G  S  + AAF++ G+ELVG+
Sbjct: 245 ILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGL 300

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVM 343
            + E+ NPRK+VPKA  +VF+RI  FY+L+L  VGLLVPYT+ RL   S  D   SPFV+
Sbjct: 301 ASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVI 360

Query: 344 AIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPF 403
           AI   G + LPSV N VIL+ +LS GNS IY  SR L  L++    P  F   ++ G P 
Sbjct: 361 AITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPL 420

Query: 404 YAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGIS 463
           Y++L +S FG +A++  S+   +VF+WLL ++ ++  F W  I L HIRF + L  +G  
Sbjct: 421 YSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRG 480

Query: 464 RNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFV---FSEFIADYISVFLFIVCW 520
            ++L F +    +G+Y+  F I ++ + Q + +  P         F   Y+S  + I C+
Sbjct: 481 TDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACY 540

Query: 521 LGFQVLFKT-RLILRKEDVDIDTDRR--EIDALVWSDDDEPKTLLQKLW 566
           LG ++  K  ++ ++ ED+DIDT R+  ++D L     +E   L  K W
Sbjct: 541 LGHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQEVAEERAVLATKPW 589

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 186/500 (37%), Positives = 285/500 (57%), Gaps = 16/500 (3%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           +D  + +DL  RH+  +++GG IGTGLF+   + +   GP   ++A++ + T  F +  +
Sbjct: 84  NDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNA 143

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGE+A   PV   F +Y  RF+ P+ G A    Y   W V   LEL      I+YW   +
Sbjct: 144 LGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTI 203

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
               W+ +F+  +  +NM+ V+ +GE EF ++ +K+L+I GF I  +V+ CGG   G  +
Sbjct: 204 NSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYI 263

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G RYW +PG +       +    RF G  +  + AAF+Y GTELV ++A ES NPR T+P
Sbjct: 264 GGRYWNDPGAF-----VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLP 318

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPR-LSTTSDSDINTSPFVMAIQNSGTKVLPS 355
           KA  + F+ I   YI  L  +G LVPY D R L+  S  D   SP V+AI+N G K LPS
Sbjct: 319 KASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPS 378

Query: 356 VFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCL 415
           + N +IL+ ILS  NS +Y  SR +  +++ G  P      +K+G P YA+  + IFG L
Sbjct: 379 LMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLL 438

Query: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475
           +++  S   ++VF WL  ++ ++  F W  I+LSHIRF Q +K +  S N+LPF +    
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGV 498

Query: 476 WGAYYAAFFITVIILIQGFDSFAPEFVFSE------FIADYISVFLFIVCWLGFQVLFKT 529
           +G++Y    I ++++   + S  P  V S+      F   Y+S+ +FIVC+LG +V  K 
Sbjct: 499 YGSWYGCIVIFLVLIASFWTSLFP--VGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKD 556

Query: 530 -RLILRKEDVDIDTDRREID 548
            RL ++ +D+D+DT RREID
Sbjct: 557 WRLYVKTKDMDLDTGRREID 576

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 182/499 (36%), Positives = 295/499 (59%), Gaps = 16/499 (3%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +K+ L+ RH+ +I+LGG IGTGLF+G +S +   GP G L +Y+ +  + + V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 122 ATFIPVTS-----SFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
             F+P ++     S +    R+  P+LG A G+ Y++ + +  A E +    ++ YWT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 177 VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMV-CGGSSEGA 235
           VP   WI +F  ++T  N  PV+ YGE EFW A LK+L I G L  + ++   GG +   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKT 294
           LGFRYW++PG +   + + N    RFL   + +IK  F +  G ELV IT+ E+ + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTGNT--GRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTT---SDSDINTSPFVMAIQNSGTK 351
           + KA  +  +R++FFY+ S   +G++V  TDP L        +   +SPFV+AIQN+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
           VLP + N  IL +  S+GNS ++  SR L  +++ G AP +  + N+QGVP+YAV  S+ 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
           F CLA+LN+S  + K F W   I+ ++GF  W+ I +++++F + +  RG+    +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYER-VPFKS 521

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKT-- 529
              P+G Y+    +++I L  G+ SF   +  S+F+A YI++ +F+V W+G ++  +T  
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 530 RLILRKEDVDIDTDRREID 548
             +L   +VD+ T   EI+
Sbjct: 581 TWLLPVAEVDVTTGLAEIE 599

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  342 bits (878), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/558 (34%), Positives = 308/558 (55%), Gaps = 21/558 (3%)

Query: 1   MVENVELETYPAGKQHNDRSAESSESSDVLHHRKET--KNEGIFINQENMSEVESL-YGN 57
           +VEN+  E       ++     S+E+       KE+  + E + ++  N++E E +    
Sbjct: 20  VVENISQEPV----SYDQSQGSSTEAHSRWGRFKESFKRAEEMELD-PNLTEAERIAIKT 74

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
               +K  LK RH+ MI++GG IGTGLF+G  + +R AGP G L+ +   GT+ + +  +
Sbjct: 75  AQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMA 134

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFA 176
           +GE+A   PV   FT Y  RF+  + G A  ++Y   W V   LE+      + YW T  
Sbjct: 135 VGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDP 194

Query: 177 VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA- 235
                ++ +F++++   NM  V+ YGE EF  + +KV+++ GF+I A+V++CGG  +   
Sbjct: 195 KYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKY 254

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295
           +G +YW NPG +       +    +F G+ +  + AAF++ G+ELVG+   E++ PRK+V
Sbjct: 255 IGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSV 309

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPS 355
           P A  +VF+RI  FYIL L  +G+LVP   PRL   S  D   SPFV+AI N G K LPS
Sbjct: 310 PGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGLPS 369

Query: 356 VFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCL 415
           V N VIL+ +LS GNS IY  SR L  L+  G  PS+    ++ G P   +  S+ FG +
Sbjct: 370 VVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLI 429

Query: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475
           A++  S+    VF+WL+ ++ ++  F W  I L HIR+   L  +G S ++LPF+A    
Sbjct: 430 AFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGV 489

Query: 476 WGAYYAAFFITVIILIQGFDSFAPEFVFS---EFIADYISVFLFIVCWLGFQVLFKT--R 530
           WG+Y+  F   ++ + Q +    P        +F   Y+S  +FI  +  F  ++K   +
Sbjct: 490 WGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALY-AFHKIWKRNWK 548

Query: 531 LILRKEDVDIDTDRREID 548
           L +  +D+DIDT RRE+D
Sbjct: 549 LFIPLKDLDIDTGRREVD 566

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  342 bits (876), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/560 (32%), Positives = 308/560 (55%), Gaps = 15/560 (2%)

Query: 7   LETYPAGKQHNDRSAESSESSDVLHHR--KETKNEGIFINQENMSEVESLYGNDDPDVKR 64
           ++++   +Q N+    S+ S D       K+ K       QEN    E      + ++K+
Sbjct: 50  VDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEK-SNQKNKELKQ 108

Query: 65  DLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-T 123
            +KPRH+ +ISLG  IGTGL +G A  +  AGP G L+ Y  MGT  +C+ Q+ GE+A +
Sbjct: 109 TIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVS 168

Query: 124 FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWI 183
           +  ++  F +Y    + PA G +  ++Y   W     LEL      I+YWT  V   +++
Sbjct: 169 YSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFV 228

Query: 184 VVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWK 242
            +F++L+   N    R Y E EF+    K+L + GF I  +V+  GG+ ++G +G RYW 
Sbjct: 229 GIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWH 288

Query: 243 NPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKV 302
            PG +     + ++    F G +++++ AAF +  TE + +TA E  NPRK +P A  KV
Sbjct: 289 TPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKV 343

Query: 303 FFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVIL 362
            +RILF ++ S+  VG LVPY   +L  +  S    SP+V+A+   G KV+P   N VIL
Sbjct: 344 LYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFINAVIL 403

Query: 363 VTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQ 422
           +++LS GNS  Y  SR+LY L++ G AP  F   +++G PF A++ + +F  +++   S 
Sbjct: 404 LSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASP 463

Query: 423 NAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAA 482
             ++VF WLL I+ ++  F W  I LSHIRF + +  +  S  ++ FKA+   WG+YY  
Sbjct: 464 KEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVC 523

Query: 483 FFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKED 537
           F + +I++ Q + + AP    +     F  +Y+++ + I+ ++G+++  K   L +R  +
Sbjct: 524 FMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANN 583

Query: 538 VDIDTDRREIDALVWSDDDE 557
           +D+D  R+  D  +   +DE
Sbjct: 584 IDLDKHRQIFDEELLKQEDE 603

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  340 bits (873), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/494 (37%), Positives = 291/494 (58%), Gaps = 17/494 (3%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +KR LK RH+ MI++GG+IGTGLF+G    +R+ GP   ++A++  G++ + V Q+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS- 180
           A  +PV+ S+  Y  RF+ P+ G A  Y Y     +T  LEL      + YW      + 
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG--SSEGALGF 238
            ++ +F+I++   N+  V+ YGE EF  + +KV +I GF+I  +V+VCGG  S EG +G 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           RYW NPG +  G          F G+ +  + +AF++ G+E+  + A E++NPRK +P+A
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
             +VF+RI  FY++SL  +G LVPYTD  L   S  D + SPFV+AI  +G K LPSV N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            VIL+ +LS GN  +Y  SR +  L+  G  P  F   +++G P   +L  +IFG L++L
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
           + S N  +VFDW+L I+ +  FF W  I + H+RF + L  +G S ++L +KA+   WG+
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 479 YYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILR 534
            Y    I +++  Q + +  P       + F + Y+S+ + I  +   ++  ++   +++
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIK 558

Query: 535 KEDVDIDTDRREID 548
             D+DIDT RRE+D
Sbjct: 559 SSDIDIDTGRREMD 572

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  338 bits (868), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/518 (36%), Positives = 308/518 (59%), Gaps = 12/518 (2%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           D+ ++++ L  RH+ +I+LGG IGTGLF+G +S +   GP+   L+++ +  I + V  +
Sbjct: 42  DENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNT 101

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           L EM  ++P   +    T R++ P+LG A G+ Y +S+ +  A ELS    ++QYWT  V
Sbjct: 102 LAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKV 161

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236
            ++VWI +F +++   N  PV+FYGE EFW A+LK++ I G LI ++V+  GG+ S   L
Sbjct: 162 HVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRL 221

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKTV 295
           GFRYW NPGP+   +   N    RFL   +++IK+ F +    EL+G+   E+K+ R+ +
Sbjct: 222 GFRYWNNPGPFAYHITGGNT--GRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNI 279

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRL--STTSDS-DINTSPFVMAIQNSGTKV 352
            KA  +  +RI+FFYI S   +G ++   DP+L  + TSD+    +SPFV  I N+G  V
Sbjct: 280 EKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPV 339

Query: 353 LPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIF 412
           L  + N VIL +  S+ NS +Y  SR +  L+K G AP +F + N+ GVP+ AV  S+  
Sbjct: 340 LNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAV 399

Query: 413 GCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAK 472
            CL YLN S ++ +VF WL  I  ++GF  W LI ++++RF + +    +    +PFK+ 
Sbjct: 400 SCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNLYER-VPFKSA 458

Query: 473 FMPWGAYYAAFFITVIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLGFQVLFKTRL 531
             P+  Y+   F+ ++ L  G+ +F P++   S+F+A YI++ +F + +LG ++ FKTR 
Sbjct: 459 LQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRW 518

Query: 532 ILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSF 569
            +   ++D+ T     DA   +   +P+T  + +W+ F
Sbjct: 519 YIPFREIDVITGLA--DAEEEAKMTQPRT-PKNMWEKF 553

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  337 bits (864), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 173/491 (35%), Positives = 286/491 (58%), Gaps = 9/491 (1%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
            ++  + R+L P  +S+++LG  +GTGL +G  + +   GP+   LAYLF G+I   V  
Sbjct: 28  TNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYLFTGSILAVVIF 87

Query: 117 SLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
           SL EMA F P+   F+ Y  +++ PA G A G+ Y+  + +  +  L+  G +I YW   
Sbjct: 88  SLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 147

Query: 177 VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA- 235
           + ++VW+ V +      N + VR++G++E ++   K+  +    I  LV+ CGG  +   
Sbjct: 148 INVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLVITCGGGPDHTT 207

Query: 236 LGFRYWKNPG--PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 293
           +GFRYW+  G  P+   ++  N    +FLGW + +I++ F + G+E++GI  GE+ NPRK
Sbjct: 208 IGFRYWRESGFLPY---LVKGN--TGKFLGWWACVIQSIFGFMGSEMIGIIYGETANPRK 262

Query: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVL 353
           T+PKA   V  RI  FYI  +F +GL V   + +L     +D N SPFV+AI  SG KVL
Sbjct: 263 TIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANASPFVIAISTSGIKVL 322

Query: 354 PSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFG 413
           PS  N  +LV I S+  ++IYI SR LYGL+K G AP +F + NK  +P    +  S+ G
Sbjct: 323 PSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMVGCVVGSLLG 382

Query: 414 CLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKF 473
            LAY+N  ++A  VF ++ +  +V G   W  I +++I + +V+K  G+  +++PF+  F
Sbjct: 383 FLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRLDEIPFRMPF 442

Query: 474 MPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLIL 533
            P+ AY A FF++VI    G+ +F  +F +  FI  YI +F  ++  LG+++ +KT+ + 
Sbjct: 443 QPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVLGYKLYYKTKWV- 501

Query: 534 RKEDVDIDTDR 544
           + E++  +  +
Sbjct: 502 KPEEITFEKKQ 512

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/545 (35%), Positives = 321/545 (58%), Gaps = 15/545 (2%)

Query: 11  PAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGN-DDPDVKRDLKPR 69
           P+   H+D      E   +   ++ T  E + ++  N    E   G   D  +K+DLK R
Sbjct: 16  PSFSNHSDNIDNKKEPFQIDIEKEST--ESVALDDTN----EQFDGKCSDQRLKKDLKAR 69

Query: 70  HMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTS 129
           H+SMI++GG++GTGL +G  + + VAGPV  L++Y F+G + F V   +GEMA +IP+  
Sbjct: 70  HVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPL-D 128

Query: 130 SFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW--TFAVPLSVWIVVFW 187
            FT Y  R+  PALG A GY Y   + +    +L+    +IQYW     V   VWI +  
Sbjct: 129 GFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVL 188

Query: 188 ILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGP 246
           +++   N   V+F+GE EFW+++ KV+ + G +I   +++ GG+ +   LGFRYWK+PG 
Sbjct: 189 VVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGA 248

Query: 247 WGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRI 306
           +     S +    RF+ +VS  +   F Y G EL GI A E++NPRK +PKAI    +RI
Sbjct: 249 FKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRI 308

Query: 307 LFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVT 364
           + FYI+++F +G+ V   DP L  + T  +    SPFV+AI NSG + LP +FN  +L+ 
Sbjct: 309 IIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMF 368

Query: 365 ILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNA 424
           + SA NS++Y+ SR LY L+    AP +F KTN+ G+P+ ++  + +F  LAY+++S  +
Sbjct: 369 VFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGS 428

Query: 425 KKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFF 484
            K+F++ + + ++ G   W+ I +++I F + ++ +GI ++   + A   P+GAY++ FF
Sbjct: 429 AKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFF 488

Query: 485 ITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTD 543
             ++ LI+ F  F   +F +  FI  YI + LF +C+ G++ + KT+ I + E+VD+ + 
Sbjct: 489 CCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTK-IRKPEEVDLFSF 547

Query: 544 RREID 548
           +  ID
Sbjct: 548 KAAID 552

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/572 (31%), Positives = 314/572 (54%), Gaps = 19/572 (3%)

Query: 7   LETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQE-----NMSEVESLYGNDDPD 61
           ++++   +    R   +    D    R ++K + +    E     N+        + D  
Sbjct: 12  IDSFKPAETQPSRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVEDQDAR 71

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
             +DL  RH+  +++GG IGTGLF+   + +   GP   ++ ++ + T  F +  +LGE+
Sbjct: 72  YNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGEL 131

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSV 181
           ++  PV   F +Y  RF+ P+ G A    Y   W V   LEL      I+YW   +    
Sbjct: 132 SSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDA 191

Query: 182 WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF-RY 240
           W+ +F+ ++  +N++ V+ +GE EF ++ +K+L+I GF I  +V+ CGG  +G     +Y
Sbjct: 192 WVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKY 251

Query: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300
           W NPG + +G  + +    RF G  S  + AAF+Y GTEL+ ++A ES NPR T+PKA  
Sbjct: 252 WSNPGAF-VGHTAGD----RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACK 306

Query: 301 KVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFNG 359
           + F+ I   YI+ L  VG LV   DPRL   S S D+  SP V+AI+N G K LPS+ N 
Sbjct: 307 RTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNA 366

Query: 360 VILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLN 419
           +IL+ +LS  NS +Y  SR +  +++ G  P +F   +++G P YA++ + IFG L+++ 
Sbjct: 367 IILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIA 426

Query: 420 ISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAY 479
            S   ++VF WL  ++ ++  F W  I++SHIRF + +K+RG + ++LPF +    WG+Y
Sbjct: 427 ASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSY 486

Query: 480 YAAFFITVIILIQGFDSFAP---EFVFSE-FIADYISVFLFIVCWLGFQVLFKT-RLILR 534
           Y    I +++++  + S  P   E   +E F   Y+S  + + C+ G ++  ++ RL+  
Sbjct: 487 YGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTP 546

Query: 535 KEDVDIDTDRREIDALVWSDDD--EPKTLLQK 564
            +++D+D+ RR +D  +  D+   E + + QK
Sbjct: 547 TKEIDLDSGRRAVDLELMKDEKRIEEQAMRQK 578

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  338 bits (866), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/494 (36%), Positives = 294/494 (59%), Gaps = 17/494 (3%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +KR LK RH+ MI++GG+IGTGLF+G    +R+ GP   +LA++  G++ + V Q++GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSV 181
              +PV+ S+  Y  RF+ P+ G A  Y Y     VT  LE+      + YW      + 
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 182 -WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSE--GALGF 238
            ++ +F++ +   N + V+ YGE EF  + +KVL+I GF+I  +V+VCGG S   G +G 
Sbjct: 204 GFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGT 263

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           +YW NPG +  G          F G+ +  + +AF++ G+E+  + A ESKNPR+ +PKA
Sbjct: 264 KYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKA 313

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
             +VF+RI  FY++SL  +G LVPYT+  L  +S  D + SPFV+AI+ +G   LPSV N
Sbjct: 314 AKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVIN 373

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            VILV +LS GN+ ++  SR    L+  G  P  F   +++G P   ++ S +FG L++L
Sbjct: 374 VVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFL 433

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
           + S++   VF+W+L ++ +  FF W  I + H+RF Q L+ +G S ++L FKA+   WG+
Sbjct: 434 SSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGS 493

Query: 479 YYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILR 534
            Y    I+V++  Q + +  P         F   Y+S+ + IV ++G +V  +  RL++ 
Sbjct: 494 IYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIP 553

Query: 535 KEDVDIDTDRREID 548
            +++D+DT RRE+D
Sbjct: 554 AKELDLDTGRREVD 567

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 177/505 (35%), Positives = 291/505 (57%), Gaps = 12/505 (2%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           D  +K+ +K RH+ MISLG  IGTG+ +G    +R  GP G ++ Y  MG+  +C+ Q+ 
Sbjct: 93  DNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAA 152

Query: 119 GEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           GE+A  +  ++  F  Y    + PALG +  ++Y   W     LEL      I+YWT +V
Sbjct: 153 GELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSV 212

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236
              +++ +F++++   N+   R Y E EF+    KVL I GFLI  +++ CGG+ ++G +
Sbjct: 213 NPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYI 272

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG +     S +K    F G VS+L+ AAF +  TE + +TA E  NPRK++P
Sbjct: 273 GGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIP 327

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            A  K+ +RIL  Y+ S+  +G LVP+    L  +  S  + SP+V+AI + G KV+P +
Sbjct: 328 SAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHL 387

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL++++S GNS  Y  SR+L  L++ G APS  K  +++G P  A++ SS+FG ++
Sbjct: 388 INAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGLIS 447

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           ++  S   + VF WLL I+ ++  F W  I LSHIRF + +K +G S  +L FK++   W
Sbjct: 448 FVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVW 507

Query: 477 GAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RL 531
           G+YYA   + +I++ Q + + AP    +     F  +Y+++ + I  + G++V  +   L
Sbjct: 508 GSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTL 567

Query: 532 ILRKEDVDIDTDRREIDALVWSDDD 556
            +    +D+ ++RR  D  V   +D
Sbjct: 568 YIPASKIDLISNRRIFDEDVLKQED 592

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  336 bits (862), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/505 (35%), Positives = 290/505 (57%), Gaps = 16/505 (3%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
             D  +K+ LK RH+ +I+LGG IGTGLF+G +S +   GP G   +Y  +  I + V  
Sbjct: 46  QGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMN 105

Query: 117 SLGEMATFIPVTSSFTMY-----TQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQ 171
           +LGEM  ++P   S +         R++ P+LG A G+ Y++ + +  A E +    ++Q
Sbjct: 106 ALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQ 165

Query: 172 YWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS 231
           YWT AVP   WI +F  ++   N   V+FYGE EFW A++K+L I G L  + ++  GG 
Sbjct: 166 YWTTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGG 225

Query: 232 -SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESK 289
                LGFRYW+ PG +   + S N    RFL   + +IK  F +  G ELV +T+ E++
Sbjct: 226 PHHDRLGFRYWQKPGAFAYHITSGNT--GRFLDIWTGVIKGGFAFILGPELVALTSAEAQ 283

Query: 290 NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSD---INTSPFVMAIQ 346
           + R+ + KA  +  +R++FFY+ S   +G +V Y D  LST  D       +SPFV+ IQ
Sbjct: 284 DARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQ 343

Query: 347 NSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAV 406
           N+G KVLP + N  IL +  S+GNS ++  SR L  +S+ G AP +  + N+ GVP+ AV
Sbjct: 344 NAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAV 403

Query: 407 LTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRND 466
             +S+  C+AYLN+S +   VF W   I+ ++GF  W+ I ++++RF + +  + +    
Sbjct: 404 ALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNLYER- 462

Query: 467 LPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-EFVFSEFIADYISVFLFIVCWLGFQV 525
           +PFK  F P+G ++    ++VI L  G+  F P  +  S+FIA Y+++ +F+V W+G ++
Sbjct: 463 VPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKL 522

Query: 526 LFKT--RLILRKEDVDIDTDRREID 548
             +T     +   ++D+ T  +EI+
Sbjct: 523 WTRTWKTWAIPVPEIDVTTGLKEIE 547

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  338 bits (867), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 183/543 (33%), Positives = 303/543 (55%), Gaps = 15/543 (2%)

Query: 23  SSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGT 82
           +++SS  L +  E   +G F+ +  + +       +  ++K+ +KPRH+ M+SLG  IGT
Sbjct: 106 TNDSSSQLDN--ELNPKGSFVTESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGT 163

Query: 83  GLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRFLSP 141
           GL +G +  +  AGP G ++ Y  MG+  +C+ Q+ GE+A  +  +   F  Y    + P
Sbjct: 164 GLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDP 223

Query: 142 ALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFY 201
           ALG +  ++Y   W     LEL      I+YWT  V   V++V+F++L+   N+   + Y
Sbjct: 224 ALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGY 283

Query: 202 GEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEAR 260
            E +F+    K+L I GF I A+++ CGG+ ++G +G RYW NPG +       N    R
Sbjct: 284 AEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAF-----RGNTGIQR 338

Query: 261 FLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLL 320
           F G V++ + AAF +  +E + +TA E  NPRK +P A  K+ +RILF ++ SL  VG L
Sbjct: 339 FKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFL 398

Query: 321 VPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVL 380
           VPYT  +L   S S    SP+V+A+ + G +V+P   N VIL+++LS  N   Y  SR+L
Sbjct: 399 VPYTSDQLLGASGSATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRIL 458

Query: 381 YGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGF 440
             L+K G AP  F   +++G P  A+L SSIFG +A+   S   + VF WLL I+ ++  
Sbjct: 459 MSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQL 518

Query: 441 FAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP- 499
           F W+ I LSHIRF + +K +G S  ++ +K++   WG+ YA   + + ++ Q + + +P 
Sbjct: 519 FTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPI 578

Query: 500 ----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSD 554
               +     F  +Y+++ + I  ++ ++V  K   L +  + +D+ TDR+  D  +   
Sbjct: 579 GGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELLKQ 638

Query: 555 DDE 557
           +DE
Sbjct: 639 EDE 641

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 179/522 (34%), Positives = 301/522 (57%), Gaps = 19/522 (3%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           ++K+ LK RH+ +I+LGG IGTGLF+G +S +   GP G  ++Y  + ++ + + Q +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 121 MATFIPVTSS----FTMY-TQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175
           M  ++P + S    F  Y   +++  +LG A+ + Y++ + +  A E +    +++YWT 
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEG 234
           +VP + WI +F   +   N   V+FYGE EFW A++K+L I G +I + ++  GG  +  
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRK 293
            LGFRYW+NPG  G            FL   + +IK  F +  G E++ +T+ E ++ R+
Sbjct: 254 RLGFRYWQNPG--GFAHHIRGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRR 311

Query: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTT---SDSDINTSPFVMAIQNSGT 350
            + KA  +  +R++FFYIL    + ++V Y DP L      +     +SPFV+ IQN+G 
Sbjct: 312 NIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGI 371

Query: 351 KVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSS 410
           KVLP + N  IL +  SAGN+ ++  SR L  ++++G AP +F K N+ GVP+YAV  SS
Sbjct: 372 KVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSS 431

Query: 411 IFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFK 470
              CLAYLN S +   VF+W   I+ ++GF  W+ + +++IRF + +   G+ ++ LP+ 
Sbjct: 432 AISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYT 490

Query: 471 AKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSE-FIADYISVFLFIVCWLGFQVLFKT 529
           A+ MP+  Y+    I++I L  G++ F P F  ++ F+A YI++ +F V W+G +V  + 
Sbjct: 491 ARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRK 550

Query: 530 RLILR----KEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567
              L+     E++D+ T   EI+     + D  + L  K W+
Sbjct: 551 IFTLKWWKSIEEIDVVTGVEEIEEKT-RECDASRVLPTKWWE 591

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  334 bits (856), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/564 (32%), Positives = 312/564 (55%), Gaps = 25/564 (4%)

Query: 18  DRSAESS-ESSDVLHHRKETKNEGIFINQENMSEVESL-YGNDDPDVKRDLKPRHMSMIS 75
           DR++ +S E +D   +  + K      ++ ++ E+E+   G++   + + L+ RH+ +I+
Sbjct: 3   DRASSASIEKADNGGYMHKVKTPH---SRTSLEELETQSAGSEYNTLHKGLQSRHIQLIA 59

Query: 76  LGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYT 135
           LGG IGTGLF+G +  +   G    LL+++ + TI + +  SL EM  ++P   S     
Sbjct: 60  LGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELV 119

Query: 136 QRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNM 195
            R++ P+LG A G+ Y +++ +  A ELS    ++ YW   VP++ WI +F +++   N 
Sbjct: 120 SRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNF 179

Query: 196 IPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISS 254
             V++YGE EFW A++K++ I G L+ ++V+  GG+ +    GFRYWKNPGP+ M +   
Sbjct: 180 TAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPG 239

Query: 255 NKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313
           +    RFL    ++IK+AF +    EL+GI   E+++ R+   KA  +  +RI+FFY+  
Sbjct: 240 ST--GRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSC 297

Query: 314 LFFVGLLVPYTDPRLS---TTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGN 370
              +G+++  TDP+L     T      +SPFV  I N+G  VL  V N  IL +  SAGN
Sbjct: 298 ALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGN 357

Query: 371 SNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDW 430
           S +Y  +R++  L++ G AP    K N+ GVP+ AV+  ++  CLAYLN+   +  VF W
Sbjct: 358 SFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQW 417

Query: 431 LLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL----PFKAKFMPWGAYYAAFFIT 486
           L  I  ++GF  W  + ++ IRF      RGI  N+L    P++    P+ AYY  F   
Sbjct: 418 LSNICTISGFIGWFAMGIAFIRF-----RRGIVFNNLQSRIPYQGPLQPYIAYYFTFMTV 472

Query: 487 VIILIQGFDSFAP-EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRR 545
           V+ L  GF  F    +   +F+A Y+++ +++V +LG ++ F+TR  +  E +D+ T   
Sbjct: 473 VVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGLV 532

Query: 546 EIDALVWSDDDEPKTLLQKLWQSF 569
           E +         P  + + LW+ F
Sbjct: 533 EAEE---ESKMTPPRIPKNLWEKF 553

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  334 bits (856), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/529 (35%), Positives = 294/529 (55%), Gaps = 14/529 (2%)

Query: 47  NMSEVESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           N+++ E +        ++R LK RH+ MI++GG IGTGLF+G  S +R  GP   L+ + 
Sbjct: 64  NLTQAEKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWG 123

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
            +G + + V  ++GE+A   PV   FT Y  RF+  + G A  Y+Y   W V   LE+  
Sbjct: 124 LIGLMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVA 183

Query: 166 IGQLIQYW-TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
               + YW T A     ++ +F++++   NM  V+ YGE EF  + +KV ++ GF+I  +
Sbjct: 184 ASITVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGI 243

Query: 225 VMVCGGSSEGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           V++CGG   G     +YW NPG +     + +    RF    S  + AAF++ GTELVG+
Sbjct: 244 VLICGGGPVGGYVGGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELVGL 298

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVM 343
            A E++NPRK +P+A  +VF+RI  FYI+SL  +GLLVPYT   L  +S  D   SPFV+
Sbjct: 299 AAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVL 358

Query: 344 AIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPF 403
           AI+  G   LPSV N VIL+++LS GNS++Y  SR L  L+  G  P +F   +++G P 
Sbjct: 359 AIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPL 418

Query: 404 YAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGIS 463
             +L +  FG L ++  S+    VF+WL+ ++ ++  F W  I + H+RF + L  +G S
Sbjct: 419 VGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRS 478

Query: 464 RNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCW 520
            ++L F +    WG+Y+    I ++ + Q + +  P       S+F   Y+SV + +  +
Sbjct: 479 TDELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFY 538

Query: 521 LGFQVLFKT-RLILRKEDVDIDTDRRE--IDALVWSDDDEPKTLLQKLW 566
           L  ++  +      R +D+DIDT RRE  +DAL     +E   L  K W
Sbjct: 539 LAHKLYTRNWTFAKRAKDIDIDTGRRELDLDALKQEIAEEKLRLSTKPW 587

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/593 (32%), Positives = 325/593 (54%), Gaps = 39/593 (6%)

Query: 8   ETYPA----GKQHNDRSAESSESSDVLHHRKETKNEGI-FINQENMSEVESLY------- 55
           E YP     G   +D +   +  S      K+  N+ I F++ E+     S         
Sbjct: 4   EKYPGLTVVGSSSDDAATTHTIGSAGALPAKDKYNKTIEFVDVESQQSTSSATISEKLGD 63

Query: 56  --GNDDP-----DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMG 108
             G+ DP      +++ LK RH+ MI+LGG IGTGLF+G +S + + GP G  ++Y+ + 
Sbjct: 64  GDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIIS 123

Query: 109 TIAFCVTQSLGEMATFIP-----VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALEL 163
           ++ + +    GEM  ++P      + S      R++  +LG A  + Y++ + +  A E 
Sbjct: 124 SVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAEC 183

Query: 164 SIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYA 223
           +    +++YWT AVP  VWI++F  ++   N  PV++YGE EFW A++K+L I G +I +
Sbjct: 184 TAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILS 243

Query: 224 LVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELV 281
            ++  GG  +   LGFRYW+ PG +   ++       RFL   S +IK  F +  G ELV
Sbjct: 244 FILFWGGGPNHDRLGFRYWQRPGAFTEHIMKGG--FGRFLDIYSGVIKGGFAFILGPELV 301

Query: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLST---TSDSDINT 338
            +T+ E ++ R+ + KA  +  +R++FFY+L    + ++V Y DP L +   +      +
Sbjct: 302 CLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGS 361

Query: 339 SPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNK 398
           SPFV+ IQN+G +VLP + N  IL +  SAGN+ ++  +R L  ++++G AP +F K N+
Sbjct: 362 SPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINR 421

Query: 399 QGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLK 458
            GVP+ A+  S    CLA+LN+S +   VF+W   I+ ++GF  W+   +++IRF + + 
Sbjct: 422 FGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIF 481

Query: 459 DRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPE-FVFSEFIADYISVFLFI 517
             G+  + LPFK    P+  YY+ F I++I L  G+ +F P+ +  S+F+A YI++ +F+
Sbjct: 482 FNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFV 540

Query: 518 VCWLGFQV---LFKTRLILRKEDVDIDTDRREIDALVWSDDD---EPKTLLQK 564
           V W+G ++    F  R   R + +D+ T   +I+      D+   EP T  QK
Sbjct: 541 VLWVGHKLWTRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQK 593

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/561 (35%), Positives = 313/561 (55%), Gaps = 15/561 (2%)

Query: 16  HNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESL-YGNDDPDVKRDLKPRHMSMI 74
           +++ S E S  S     +   K   +     N++E E +     +  +KR LK RH+ MI
Sbjct: 30  NHEASNEESSGSKWQDFKNSFKRMEVVELDPNLTEAEKIAIATANSPLKRHLKNRHLQMI 89

Query: 75  SLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMY 134
           ++GG IGTGLF+G    +R AGP G L+ +   GT+ +C+  ++GE+A   PV+  FT Y
Sbjct: 90  AIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVSGGFTTY 149

Query: 135 TQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFAVPLSVWIVVFWILLTAS 193
             RF+  + G AN + Y   W V   LE+      + YW T       ++ +F++++ + 
Sbjct: 150 ATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVSI 209

Query: 194 NMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY-WKNPGPWGMGMI 252
           NM  V+ YGE EF  + +KV+++ GF+I  +++VCGG   G       W NPG +     
Sbjct: 210 NMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGANWHNPGAF----- 264

Query: 253 SSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYIL 312
             N    RF G  S  + AAF++ G+ELVG+ + E+ NPRK++P+A  +VF+RI  FYI+
Sbjct: 265 VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAAKQVFWRITLFYII 324

Query: 313 SLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSN 372
           SL  +GLLVPY D RL   S  D   SPFV+AI+N G K LPSV N VIL+ +LS GNS 
Sbjct: 325 SLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVNVVILIAVLSVGNSA 384

Query: 373 IYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLL 432
           ++  SR L  L++ G  P +F   +++G P   +  +S FG L+++  S    +VFDWLL
Sbjct: 385 VFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIAASPKEGEVFDWLL 444

Query: 433 TITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQ 492
            ++ ++  F W+ I + H+RF + L  +G S ++L F +    WG+ Y    I +I+  Q
Sbjct: 445 ALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWGSIYGTVLIMLILAAQ 504

Query: 493 GFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
            + +  P        +F   Y+S+ + +V ++G +   +  +L +R E++DIDT RRE+D
Sbjct: 505 FWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRAENIDIDTGRREVD 564

Query: 549 --ALVWSDDDEPKTLLQK-LW 566
             AL     +E   L  K LW
Sbjct: 565 IEALKVELAEEKAVLASKSLW 585

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  331 bits (849), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/512 (35%), Positives = 293/512 (57%), Gaps = 9/512 (1%)

Query: 32  HRKETKNEGIFINQENMS----EVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMG 87
            R +T + G    Q+N      + +   G     ++R  K RH+ M+++ G IGTGL +G
Sbjct: 12  KRVDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIG 71

Query: 88  IASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAAN 147
             + ++  GP   L+A++F G++   V  SL EMA+F P+  SF+ Y  R++ PALG A 
Sbjct: 72  TGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFAT 131

Query: 148 GYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFW 207
           G+ Y+  + +  A ELS IG L+QYW   + ++++IVVF ++L + N + ++FYGE+EFW
Sbjct: 132 GWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFW 191

Query: 208 IAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVS 266
            A LK L +    +  LV+ CGG  S+  +GFRYW+    +            RFLGW +
Sbjct: 192 SALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWRE---YAFVPYLVKGTTGRFLGWWA 248

Query: 267 SLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDP 326
            +I++ + Y G+E +G+  GE+ NP+KT+P A   V FRI  FYI+ +  +GL++   D 
Sbjct: 249 CVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDK 308

Query: 327 RLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKS 386
            L+    SD + SPFV+A  N+G K LPS  N ++++ I SA N+ +Y+ SR  YGL+K 
Sbjct: 309 TLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKD 368

Query: 387 GLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLI 446
           G+AP +F   N+ GVPF   L + +   L+++NIS ++  +F +L +   V G   WL +
Sbjct: 369 GMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSV 428

Query: 447 SLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEF 506
            +S+I + +      + R+ +PF+  F P+ AY   FF+++II   G+ +F   F +  F
Sbjct: 429 LISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSF 488

Query: 507 IADYISVFLFIVCWLGFQVLFKTRLILRKEDV 538
           I  YI + +FI   L F   +K     R ED+
Sbjct: 489 IVSYIGIAVFIGNTL-FWKFWKKSAATRPEDL 519

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/542 (33%), Positives = 303/542 (55%), Gaps = 23/542 (4%)

Query: 43  INQENMSEVESLYGNDDPDV----KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPV 98
           +  E  S    + GN D  +    ++ L  RH+ +I+LGG IGTGLF+G +S +   GP 
Sbjct: 33  LTPEGSSTNRGINGNKDAKLEGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPA 92

Query: 99  GSLLAYLFMGTIAFCVTQSLGEMATFIP-----VTSSFTMYTQRFLSPALGAANGYLYWF 153
           G  ++Y+ + T+ + +  + GEM  ++P        S +    R++ P+L  A G+ Y++
Sbjct: 93  GLFISYVIISTVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFY 152

Query: 154 SWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKV 213
            + +  A E +    +++YWT AVP + WI +F  ++   N+  V++YGE EFW A++KV
Sbjct: 153 CYVILVAAECTAASGVVKYWTDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKV 212

Query: 214 LSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAA 272
           L I G +I + ++  GG  +   LGFRYWKNPG +   +   N     FL   S +IK A
Sbjct: 213 LCIVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHITGGNL--GNFLDVYSGIIKGA 270

Query: 273 FTY-QGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLST- 330
           F +  G EL+ + + E K+ R+ + KA  +  +R++FFYIL    + ++V   DP L++ 
Sbjct: 271 FAFILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSA 330

Query: 331 --TSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGL 388
             +      +SPFV+ IQN+G K+LP + N  IL +  SAGN+ ++  SR L  ++ +G 
Sbjct: 331 LASGKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQ 390

Query: 389 APSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISL 448
           AP +F K N+ GVP+ AV  S++  CLAYLN+S +   VF W   I+ ++GF  W    +
Sbjct: 391 APKIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLV 450

Query: 449 SHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEF-VFSEFI 507
           +++RF + +K  G+  N LP+  +F  +  +++   +T++I   G+  F P F   S+FI
Sbjct: 451 AYLRFRKAIKYNGL-ENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFI 509

Query: 508 ADYISVFLFIVCWLGFQVLFK--TRLILRKEDVDIDTDRREIDALVWSDDD---EPKTLL 562
           A YI++ LF+V W+G ++  +   +     E++D+ T   EI+      D+   EPK   
Sbjct: 510 AAYITLPLFVVLWIGHKIYTRDFKKWWYPVEEIDVVTGLTEIEERTRILDEERVEPKGAF 569

Query: 563 QK 564
            K
Sbjct: 570 PK 571

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  332 bits (852), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/567 (31%), Positives = 314/567 (55%), Gaps = 16/567 (2%)

Query: 7   LETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQ-ENMSEVESLYGNDDPDVKRD 65
           L+++    Q  ++ AE ++ +D+      +  +   + + E   ++    G+    +K+ 
Sbjct: 60  LDSFKRADQDQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGHKSDSLKKT 119

Query: 66  LKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TF 124
           ++PRH+ MI+LG  IGTGL +G  + +  AGP G L+ Y  MG+I +C+ Q+ GEMA  +
Sbjct: 120 IQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVY 179

Query: 125 IPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIV 184
             +T  +  Y    +    G A  ++Y   W     LEL      I+YWT +V   V+++
Sbjct: 180 SNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVI 239

Query: 185 VFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKN 243
           +F++L+   N+   R Y E EF+    K+L + GF I  +++  GG+ ++G +G +YW  
Sbjct: 240 IFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHE 299

Query: 244 PGPW-GMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKV 302
           PG + G+  I       RF G V++L+ AAF + G+E + IT  E  NPRK +P A  ++
Sbjct: 300 PGAFNGVHAID------RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQM 353

Query: 303 FFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVIL 362
            +RILF ++ ++  VG LVPY   +L  +S      SP+V+AI + G +V P   N VIL
Sbjct: 354 IYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVIL 413

Query: 363 VTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQ 422
           +++LS  NS+ Y  +R+   LS+ G AP +F   ++ G P  A+  S++F  +A+   S 
Sbjct: 414 LSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASP 473

Query: 423 NAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAA 482
              +VF WLL I+ ++  F W  I LSHIRF + +K +G S  +L FK++   WG+ Y+ 
Sbjct: 474 KEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSC 533

Query: 483 FFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKED 537
             + +I++ Q + + AP    +     F  +Y+++ + IV ++G+++  K  +L +R + 
Sbjct: 534 IMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADK 593

Query: 538 VDIDTDRREID-ALVWSDDDEPKTLLQ 563
           +D+ + R+  D  L+  +DDE +  L+
Sbjct: 594 IDLTSHRQIFDEELIKQEDDEYRERLR 620

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/526 (33%), Positives = 294/526 (55%), Gaps = 13/526 (2%)

Query: 47  NMSEVE-SLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           +M++VE ++Y   D  + +DL  RH+  +++GG IGTGLF+     +   GP   ++A+ 
Sbjct: 48  DMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWT 107

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
            + T  F +  SLGE++   PV   F +Y  RF+ P+ G A  + Y   W +   LEL  
Sbjct: 108 IISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCA 167

Query: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225
               I+YW  ++    W+ +F++ +  +NM+ V+ +GE EF ++ +K+L+I GF I  +V
Sbjct: 168 ASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIV 227

Query: 226 MVC-GGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGIT 284
           ++C GG S G +G +YW +PG +       +    RF G  +  I AAF+Y G ELVG++
Sbjct: 228 LICGGGPSGGFIGGKYWNDPGAF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVS 282

Query: 285 AGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDP-RLSTTSDSDINTSPFVM 343
           A ES+NPR T+PKA  + F+ I   Y++ L  +G LVP  DP  L+ TS  D   SP V+
Sbjct: 283 AAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVI 342

Query: 344 AIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPF 403
           AIQN G K LPS+ N +IL+ +LS  NS +Y  SR +  +++ G  P      +K+G P 
Sbjct: 343 AIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPL 402

Query: 404 YAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGIS 463
           YA+  + + G L+++  S    +VF WL  ++ ++  F W  I+L+H+RF   +K +  S
Sbjct: 403 YAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRS 462

Query: 464 RNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPE----FVFSEFIADYISVFLFIVC 519
             +LP+ +    WG++Y    I ++++   + S  P        + F   Y+S+ +FI C
Sbjct: 463 LEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIAC 522

Query: 520 WLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQK 564
           +LG ++  +  RL ++  +VD+D+ R + DA     + E +  L K
Sbjct: 523 YLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMK 568

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/587 (32%), Positives = 323/587 (55%), Gaps = 29/587 (4%)

Query: 2   VENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFIN----------QENMSEV 51
           VE++E   Y +GK+    S + +    +    +  K    F++            N+SE 
Sbjct: 12  VEDIEKSFYVSGKEQARVSTDLAVDEPISVQPEPRKGWNGFVDTFRRAEMPVIDPNLSEA 71

Query: 52  ESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTI 110
           E L        + R LK RH+ MI++GG IG GLF+G    +  AGP G L+ +    T+
Sbjct: 72  EKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATM 131

Query: 111 AFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLI 170
              +  SLGE+A   PV+  +  Y  RF+  + G AN + Y     V   LE+      +
Sbjct: 132 ILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTV 191

Query: 171 QYWTFAVPLSV-WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCG 229
            YW       + ++ +FW+++ + N+  VR +GE E   + +KV++I GF+I  +V++ G
Sbjct: 192 GYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISG 251

Query: 230 GSSEG-ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGES 288
           G  +   +G +YW +PGP+ +G   S+K++    G  S  + AAF++ G+EL+G+ A E+
Sbjct: 252 GGPDHEVIGGKYWNDPGPF-VGNAPSDKFK----GVCSVFVTAAFSFAGSELIGLAAAET 306

Query: 289 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNS 348
           + PRK++PKA  +VF+RI  FYILSL  VGLLVP  +  L      D   SPFV+A+   
Sbjct: 307 REPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMH 366

Query: 349 GTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLT 408
             +VLPS+ N VIL  ++S GNS++Y  SR +  L++ G  P +F   +++G P +A+  
Sbjct: 367 RIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICF 426

Query: 409 SSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLP 468
           +S+FG L ++  ++   ++FDWLL I+ ++ FF WL I+L+H+RF   LK +G + N+L 
Sbjct: 427 TSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELS 486

Query: 469 FKAKFMPWGAYYAAFFITVIILIQGFDSF---APEFVFSE-----FIADYISVFLFIVCW 520
           F +     G+ YA   I V+++ Q + +    +P+   ++     F   Y+S  + IV +
Sbjct: 487 FTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMY 546

Query: 521 LGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDD--DEPKTLLQK 564
           L  ++  +  +  ++ +++DIDT RRE+D  ++ ++   E   L QK
Sbjct: 547 LAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEELAQERALLAQK 593

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/578 (32%), Positives = 308/578 (53%), Gaps = 30/578 (5%)

Query: 6   ELETYPAGKQHNDRSAESSESSDVLHH------RKETKNEGIFINQE-NMSEVESLYGND 58
           E E Y      +D   E +  S V H       R +  N  I  N E  ++  +SL    
Sbjct: 41  EAEYYEKTFSQSDE--EYAAKSSVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLPEK 98

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
              +KRD+KPRH+ M+SL   IGTGL +G    +   GP G  + Y  MG+  + + Q+ 
Sbjct: 99  GASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAA 158

Query: 119 GEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           GE+A   P +T +F  Y    + PA+  A   LY   W   F LE+      I+YW  ++
Sbjct: 159 GELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSI 218

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
             +VW V+F++++   NM     Y E +F+    K+L   GF I  +++ CGG+ +   +
Sbjct: 219 NPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYI 278

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG +     + +   +RF   VS+L+ AAF +  +E V +TA E  NPRK +P
Sbjct: 279 GGKYWNDPGAF-----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIP 333

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            A  +V +RI+  Y+ S+  VG LVPY  P L  +  S +++SP+V+A+ + G KV+PS 
Sbjct: 334 SAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSF 393

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS GN + Y  SR+L  LS+ G AP  F+  ++QG P YA++  ++ GC+ 
Sbjct: 394 INAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCIC 453

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +++ S   + VF WL+ ++ ++  F W  I +SH+RF + ++ +  S  +L F+++   W
Sbjct: 454 FVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVW 513

Query: 477 GAYYAAFFITVIILIQ---------GFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLF 527
           G+YY  F + ++ + Q         G D    E     F A+Y+++ +F+  + GF++  
Sbjct: 514 GSYYGIFMMILVFIGQFWVALFPVGGTDGADAE----NFFANYLAMPVFLALYFGFKIWK 569

Query: 528 KT-RLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQK 564
           K  RL +   ++D+ + R+  D  +   +DE   +  K
Sbjct: 570 KDWRLYIPASEIDLISHRKIFDEEILKQEDEEYKIKMK 607

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/558 (32%), Positives = 310/558 (55%), Gaps = 22/558 (3%)

Query: 15  QHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMI 74
           Q ND ++  S SS     R+E +        E+   + +  GN    +K+ ++PRH+ MI
Sbjct: 78  QMNDLASAISPSS---RQRQELEK------NESSDNIGARTGNKSDSLKKTIQPRHVLMI 128

Query: 75  SLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTM 133
           +LG  IGTGL +G  + +  AGP G L+ Y  MG+I +C+ Q+ GEMA  +  +T  +  
Sbjct: 129 ALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYNA 188

Query: 134 YTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTAS 193
           Y    +    G A  ++Y   W     LEL      I+YWT +V   V++++F++L+   
Sbjct: 189 YPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITI 248

Query: 194 NMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMI 252
           N+   R Y E EF+    K+L + GF I  +++  GG+ ++G +G +YW +PG +     
Sbjct: 249 NIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAF----- 303

Query: 253 SSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYIL 312
           +      RF G V++L+ AAF + G+E + IT  E  NPRK VP A  ++ +RILF ++ 
Sbjct: 304 NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLA 363

Query: 313 SLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSN 372
           ++  +G LVPY   +L  +S      SP+V+A+ + G +V+P   N VIL+++LS  NS+
Sbjct: 364 TIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSS 423

Query: 373 IYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLL 432
            Y  +R+L  LS+ G AP +F   +K G P  A+  S++FG +A+   S    +VF WLL
Sbjct: 424 FYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLL 483

Query: 433 TITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQ 492
            I+ ++  F W  I LSHIRF + +K +G S  +L F+++   WG+ YA   + +I++ Q
Sbjct: 484 AISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILILIGQ 543

Query: 493 GFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREI 547
            + + AP    +     F  +Y+++ + I  ++G+++  K  +L +R + +D+ + R+  
Sbjct: 544 FWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIRADKIDLISHRQIF 603

Query: 548 D-ALVWSDDDEPKTLLQK 564
           D  L+  +D+E +  L+ 
Sbjct: 604 DEELIKQEDEEFRERLKN 621

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  330 bits (845), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/569 (35%), Positives = 314/569 (55%), Gaps = 17/569 (2%)

Query: 7   LETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESL-YGNDDPDVKRD 65
           LE++      ++ ++  S   + L   K  + E +     N++++E +        ++  
Sbjct: 35  LESFDNQIDSSNYASHRSAWGNFLDSFKRVEVEEV---DPNLTDLEKIAIKTARSPLQHK 91

Query: 66  LKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFI 125
           LK RH+ MI++GG IGTGLF+G    +R AGP G L+ +   GT+ F +  +LGE+A   
Sbjct: 92  LKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGELAVMF 151

Query: 126 PVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSV-WIV 184
           PV+  FT Y  RF+  + G A  + Y   W V   LE+      + YW   V  +  ++ 
Sbjct: 152 PVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTDGFVA 211

Query: 185 VFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF-RYWKN 243
           +FW+++   NM  VR YGE EF  + +KV ++ GF+I  +V+VCGG   G     RYW N
Sbjct: 212 LFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHN 271

Query: 244 PGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVF 303
           PG + +G  S  K+     G+ S  + AAF++ G+EL+G+   E+KNPRK VP A  +VF
Sbjct: 272 PGAF-VGSTSGQKFH----GFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVF 326

Query: 304 FRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILV 363
           +RIL FYI+ L  +G LVPY DPRL ++S  D + SPFV+AI   G   LPSV N VIL+
Sbjct: 327 WRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVILI 386

Query: 364 TILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQN 423
           ++LS GNS IY  SR L  LS+ G  P +    +++G P   +  SS FG +A++  S  
Sbjct: 387 SVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNK 446

Query: 424 AKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAF 483
             ++F+WLL I+ ++ FF W  I + HIRF   LK +G   ++LPF +     G+Y+  F
Sbjct: 447 QNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLF 506

Query: 484 FITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVD 539
              ++++ Q + +  P        EF + Y++  + +  ++  ++  K  + ++  EDVD
Sbjct: 507 LNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVD 566

Query: 540 IDTDRREIDALVWSDD--DEPKTLLQKLW 566
           IDT RR+ D  +   +  +E   L  + W
Sbjct: 567 IDTGRRDTDVNLLKQEIAEEKAALAMRPW 595

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 175/532 (32%), Positives = 294/532 (55%), Gaps = 14/532 (2%)

Query: 25  ESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGL 84
           E    L H      EG     E+ ++   + G  + ++K  +KPRH+ MISLG  IGTG+
Sbjct: 87  EQPSTLEHDLTKTFEGTLEPSEDGTQPAEVAGKSE-ELKHSIKPRHVIMISLGTGIGTGM 145

Query: 85  FMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRFLSPAL 143
            +G  + +  +GP G ++ Y  MG+  +C+ Q+ GEMA  +  +   F  Y    + PAL
Sbjct: 146 LVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPAL 205

Query: 144 GAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIP-VRFYG 202
           G +  ++Y   W     LEL      I+YWT  V   V++V+F++L+   N++     Y 
Sbjct: 206 GFSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYA 265

Query: 203 EIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARF 261
           E EF+  + K+L + GF I  ++++CGG+  +G +G RYW +PG +            RF
Sbjct: 266 EAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAF-----RGEHAIDRF 320

Query: 262 LGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLV 321
            G VS+L+ AAF +  +E++G+TA E  NPRK +P A  K+ +RI+  Y+ S+  VG LV
Sbjct: 321 KGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLV 380

Query: 322 PYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLY 381
           P+   +L  +S   +  SP+V+A+   G +V+P   N VIL+++LS  NS  Y  SR+L 
Sbjct: 381 PWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLL 440

Query: 382 GLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFF 441
           GL++ G AP +FK  +++G P   +  +++   +++   S    +VF WLL I+ ++  F
Sbjct: 441 GLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLF 500

Query: 442 AWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-- 499
            W  I LSHIRF + +  +G S  ++ FK++   WG++YA   + +I++ Q + + AP  
Sbjct: 501 TWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAIAPIG 560

Query: 500 --EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
                   F  +Y++  + I  + G+++  K  RL +R +D+D+D +R   D
Sbjct: 561 EGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIRAKDIDLDINRDVFD 612

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/553 (33%), Positives = 308/553 (55%), Gaps = 20/553 (3%)

Query: 4   NVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVK 63
           +++ ET+   +   ++ ++  +  D     +  + +     QE ++ + +        +K
Sbjct: 36  DIKKETFNYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQERIAIITA-----HTPLK 90

Query: 64  RDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT 123
             LK RH+ MI++GG IGTGLF+G  + +R AGP   ++ +   G++ + +  ++ EMA 
Sbjct: 91  HHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEMAV 150

Query: 124 FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSV-- 181
             P++  FT Y  RF+  + G AN + Y   W V   LE+      + YW    P     
Sbjct: 151 LYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYW--GTPTKYRD 208

Query: 182 -WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF-R 239
            ++ +FW+++   N+  V+ YGE EF  + +KV+++ GF+I  LV+VCGG   G     +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 240 YWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAI 299
           YW +PG + +G  +     A+F G+ S  + AAF++ G+EL+GI   E++NPRK VP A 
Sbjct: 269 YWHDPGAF-VGATAG----AQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 300 NKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNG 359
            +VF+RIL FYILSL F+GLLVP  D RL  +S+ D   SPFV+AI   G + LPSV N 
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINV 383

Query: 360 VILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLN 419
           VIL+ +LS GNS IY  SR L  L++ G  P +    ++ G P   +  SS FG +A++ 
Sbjct: 384 VILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVA 443

Query: 420 ISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAY 479
            S     VF+WLL I+ ++ FF W  I L HIRF   LK +  S ++LPF +    +G+Y
Sbjct: 444 QSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSY 503

Query: 480 YAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRK 535
           +  F I +++  Q + +  P       + F + Y+S+ + +V ++  ++  K  ++ +  
Sbjct: 504 WGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPL 563

Query: 536 EDVDIDTDRREID 548
             +D+DT R+++D
Sbjct: 564 GQLDLDTGRKQLD 576

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/534 (33%), Positives = 305/534 (57%), Gaps = 13/534 (2%)

Query: 22  ESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIG 81
           +SS  S +L    +  + GI +  +  S V +     + ++ ++L  RH+  +++GG IG
Sbjct: 31  KSSTQSSLLDLTLKKCDNGIEVVNDATSTVSN-ASVTNVNLNKNLSIRHLLTLAVGGAIG 89

Query: 82  TGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSP 141
            GLF+   + +   GP   ++ ++ + T  F V  +LGEMA   PV   F +Y  RF+ P
Sbjct: 90  VGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDP 149

Query: 142 ALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFY 201
           ++G A    Y   W V   LEL      I+YW   +    W+ +F+ ++  +NM+ V+ +
Sbjct: 150 SVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSF 209

Query: 202 GEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWGMGMISSNKYEAR 260
           GE EF ++ +K+L+I GF I  +V+ C GG   G LG +YW NPG + +G  S  K++  
Sbjct: 210 GETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSF-VGHTSGTKFK-- 266

Query: 261 FLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLL 320
             G  S  + AAF+Y G E+  ++A ESK+PR+T+PKA  + F+ I   YI  L  +G L
Sbjct: 267 --GLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITASYITILTLIGCL 324

Query: 321 VPYTDPR-LSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRV 379
           VPY +PR LS +S  D  +SP V+AI+N G K LPS+ N +IL++I+S  NS +Y  SR 
Sbjct: 325 VPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILISIISVANSAVYACSRC 384

Query: 380 LYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAG 439
           +  ++  G  P + K  +K+G P  A+L +  FG L+++  S    +VF WL  ++ ++ 
Sbjct: 385 MVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLST 444

Query: 440 FFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP 499
            F W+ I++SHIRF Q +K +  S ++LP+ ++   WG++Y    + +++++  + S  P
Sbjct: 445 IFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFP 504

Query: 500 ----EFVFSEFIADYISVFLFIVCWLGFQVLF-KTRLILRKEDVDIDTDRREID 548
                     F   Y+S  + I C++G ++++ K ++++  ED+DIDT RR++D
Sbjct: 505 LGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDIDTGRRQVD 558

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/567 (32%), Positives = 306/567 (53%), Gaps = 18/567 (3%)

Query: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQ----ENMSEVESLYGND 58
            N EL T            +S +  +  HH  ET    I  +Q    +   E+  +    
Sbjct: 37  RNYELPTSSTTHSRFRNFIDSFKPPETTHH-IETDMNPILSHQSVFDDAKVEISQVDDEL 95

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           +  +K+ ++PRH+ M+SLG  IGTGL +G  + +  AGP G ++ Y  M +  +C+ Q++
Sbjct: 96  NEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAV 155

Query: 119 GEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           GEMA  ++ +   F  Y    + PAL  +  ++Y   W     LEL      IQYWT  V
Sbjct: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215

Query: 178 PLSVWIVVFWILLTASNMIP-VRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGA 235
              +++++F+IL+ A N+    R Y E EF   + K+L + GF I  +V++CGG+ ++G 
Sbjct: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295
           +G +YW++PG +  G    N    RF G VS+L+ AAF++  TE + ITA E  NPRK +
Sbjct: 276 IGGKYWRDPGAF-RGSDGPN----RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPS 355
           P A  KV +R L  Y+ S+  VGLLVPY    L  +S +    SP+V+A+   G +V+P 
Sbjct: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390

Query: 356 VFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCL 415
             N VIL+++ S  +S  Y  SR+L  L++ G AP +F   ++ G P    L  ++   +
Sbjct: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450

Query: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475
           A+   S    +VF+WLL I+ ++  F W LI LSHIRF + +K +G S +++ +K++   
Sbjct: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510

Query: 476 WGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-R 530
           WG+ YA   + +I++ Q +    P          F  DY+++ +FIV +LG+++  +  R
Sbjct: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570

Query: 531 LILRKEDVDIDTDRREIDALVWSDDDE 557
           L +R +D+D+ + R   D  +   + E
Sbjct: 571 LFIRAKDIDLISHRHIHDPEILRQERE 597

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/539 (35%), Positives = 299/539 (55%), Gaps = 15/539 (2%)

Query: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESL-YGNDDPDVKRDLKPRHMSMIS 75
           ND +   S+  D     +  +   +     N++E E + +      +K  LK RH+ MI+
Sbjct: 43  NDEAGSGSKWQDFKDSFRRVEPVEV---DPNLTEAEKVAFVTAQTPLKHHLKNRHLQMIA 99

Query: 76  LGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYT 135
           +GG IGTGL +G  + +R  GP   L+ +   GT+ + +  +LGE+A   P++  FT Y 
Sbjct: 100 IGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGELAVIFPISGGFTTYA 159

Query: 136 QRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFAVPLSVWIVVFWILLTASN 194
            RF+  + G AN + Y   W V   LE+      + +W T       ++ +FW+++   N
Sbjct: 160 TRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLVIVIIN 219

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF-RYWKNPGPWGMGMIS 253
           M  V+ YGE EF  + +KV+++ GF+I  +++ CGG  EG     +YW +PG +     +
Sbjct: 220 MFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----A 274

Query: 254 SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313
            +   A+F G  S  + +AF++ G+ELVG+ A ES +PRK+VPKA  +VF+RI  FYILS
Sbjct: 275 GDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILS 334

Query: 314 LFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNI 373
           L  VGLLVPY DP L   S  D   SPFV+AI+  G K LP+V N VIL+ +LS GNS I
Sbjct: 335 LLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVNVVILIAVLSVGNSAI 394

Query: 374 YIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLT 433
           Y  SR +  L++    P +F   +++G P   +  +S FG +A++  S+    VF+WLL 
Sbjct: 395 YACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNWLLA 454

Query: 434 ITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQG 493
           ++ ++  F W  I + HIRF + L  +G   ++L FK+    WG+Y+  F + ++ + Q 
Sbjct: 455 LSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQF 514

Query: 494 FDSFAPEFVFSE---FIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
           + +  P         F   Y+S  L +  +LG ++  +  +L +  ED+DIDT RRE+D
Sbjct: 515 YVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLFIPAEDMDIDTGRREVD 573

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/564 (32%), Positives = 313/564 (55%), Gaps = 28/564 (4%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGI---------FINQENMSEVESLYGND 58
           E+  +G ++N RS   +E  D +   K +KN+            I   ++ +  S+ G+ 
Sbjct: 44  ESPSSGSRNNHRS--DNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSVDGDS 101

Query: 59  DPD-VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           +P  +K+ L+ RH+ +I+LGG IGTGL +G +S +   GP G  ++Y+ +  + + +  +
Sbjct: 102 EPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCA 161

Query: 118 LGEMATFIP-----VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQY 172
           LGEM  F+P        S      R++ P+LG A G+ Y++ + +  A E +    +++Y
Sbjct: 162 LGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEY 221

Query: 173 WTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMV-CGGS 231
           WT AVP  VWI +F  ++   N   V+ YGE EFW A++K+L I G +I + ++   GG 
Sbjct: 222 WTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGP 281

Query: 232 SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKN 290
           +   LGFRYW++PG +   +   +     F    + +IK AF +  G ELV +T+ E  +
Sbjct: 282 NHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECAD 339

Query: 291 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTT---SDSDINTSPFVMAIQN 347
            R+ + KA  +  +R++FFY+L    + ++VPY DP L            +SPFV+ IQN
Sbjct: 340 QRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQN 399

Query: 348 SGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVL 407
           +G KVLP + NG IL +  SA N+ ++  +R L  ++++G AP    + NK GVP+ AV 
Sbjct: 400 AGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVG 459

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
            S +  CLAYLN+S +   VF+W   I+ ++GF  W+   ++++RF + +   G+  + L
Sbjct: 460 VSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRL 518

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLGFQVL 526
           PFK    P+  +++   I +I +  G+  F P++   ++FIA YI++ +F+V W G ++ 
Sbjct: 519 PFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLY 578

Query: 527 FKT--RLILRKEDVDIDTDRREID 548
            +T  +  L   ++D+ T   EI+
Sbjct: 579 TRTWRQWWLPVSEIDVTTGLVEIE 602

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  330 bits (846), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/508 (34%), Positives = 286/508 (56%), Gaps = 12/508 (2%)

Query: 56  GNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
            ND+  +K+ ++PRH+ MISLG  IGTGL +G  + ++ AGP G ++ Y  MG+I +C+ 
Sbjct: 124 ANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCII 183

Query: 116 QSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWT 174
           Q+ GEMA  +  +   + +Y    +    G A  ++Y   W     LEL      I+YWT
Sbjct: 184 QATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWT 243

Query: 175 FAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SE 233
            +V   +++ +F+ L+   N+   + Y E EF+    KVL + GF I ++ +  GG+ ++
Sbjct: 244 TSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGND 303

Query: 234 GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 293
           G LG  YW  PG +       +     F G   +L+ AAF Y GTE + +TA E  NPR 
Sbjct: 304 GYLGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRA 358

Query: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVL 353
            +P A  KV +RI+  Y++S+  +G LVP+   RL  +  S  + SP+V+A    G +V+
Sbjct: 359 AIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVV 418

Query: 354 PSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFG 413
           P   N VIL+++LS GNS  Y  SR+L  L++ G AP  F   +++G P  A+L S++FG
Sbjct: 419 PHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFG 478

Query: 414 CLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKF 473
            +A+   S    +VF WLL I+ ++  F W  I LSHIRF   +K +G S  ++ + A+ 
Sbjct: 479 VIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQT 538

Query: 474 MPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT 529
             WG++YA F + +I + Q + + AP    E     F  +Y+++ + IV +LG+++ +K 
Sbjct: 539 GVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKD 598

Query: 530 -RLILRKEDVDIDTDRREIDALVWSDDD 556
             L+++ ED+D+ + R+  D  +  ++D
Sbjct: 599 WTLLIKAEDIDLQSHRQIFDEDLLKEED 626

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/578 (32%), Positives = 319/578 (55%), Gaps = 19/578 (3%)

Query: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGND-DPD 61
           +  +  + P     ND +   S +S      K   ++ I     ++SE    + N+   D
Sbjct: 63  KRADRNSNPLHDLDNDITTSISRTSMDAALNKTKFDDAI---SSSISETNKGHQNEKSED 119

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +K+ +KPRH+ MISLG  IGTGL +G    +  AGP   ++ Y  MGT  +C+ Q+ GE+
Sbjct: 120 LKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGEL 179

Query: 122 AT-FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           A  +  +   F  Y    + PALG +  ++Y   W     LEL      I+YWT  V   
Sbjct: 180 AVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPD 239

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFR 239
           V++V+F++L+ A N    R Y E EF+    KVL + GF I  +++  GG+ ++G LG +
Sbjct: 240 VFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAK 299

Query: 240 YWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAI 299
           YW +PG +     + +K   RF G + + + AAF +  TE + +TA E  NPRK +P A 
Sbjct: 300 YWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAA 354

Query: 300 NKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNG 359
            KV +RI+  ++ S+  +G LVPY   +L  +  S I  SP+V+A+ + G +V+P   N 
Sbjct: 355 KKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPHFINA 414

Query: 360 VILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLN 419
           VIL+++LS GNS  Y  SR+L  L++ G AP  F   +++G PF A+L S++FG +A+  
Sbjct: 415 VILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCA 474

Query: 420 ISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAY 479
            S    +VF WLL I+ ++  F W+ I +SHIRF + ++ +G S  ++ + ++   +G+ 
Sbjct: 475 TSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSA 534

Query: 480 YAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILR 534
           YAA  + + ++ Q + + AP    +     F  +Y+++ + I  + G++V  +  +L +R
Sbjct: 535 YAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWKLFIR 594

Query: 535 KEDVDIDTDRREIDA-LVWSDDDEPKTLLQK--LWQSF 569
            +D+D+DT R+  D  ++  +D+E K  L+   +W+ F
Sbjct: 595 AKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRF 632

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/524 (34%), Positives = 296/524 (56%), Gaps = 19/524 (3%)

Query: 22  ESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIG 81
           E S S D L     T  + I  + E   E      + + ++K+ LK RH+ +I+LGGTIG
Sbjct: 58  EKSYSQDELQTTSPTIIDSI--DDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIG 115

Query: 82  TGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-----VTSSFTMYTQ 136
           T L +G +S +   GP G  ++YL + T  + +  +LGEM  F+P        S      
Sbjct: 116 TSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVH 175

Query: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA--VPLSVWIVVFWILLTASN 194
           +++ P+LG A  + Y++ + +  A E+S    +I+YW +A  VP   WI +F  L+   N
Sbjct: 176 KYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILN 235

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG--SSEGALGFRYWKNPGPWGMGMI 252
            +PV  YGE EFW A++K+L I G +I + ++  GG   S+G LGFRYWKNPG +   + 
Sbjct: 236 FLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHIT 295

Query: 253 SSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKTVPKAINKVFFRILFFYI 311
                   FL   + +IK  F+   G ELV +T+ E  + R+ + KA  +  +R++FFYI
Sbjct: 296 GGGG--GNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYI 353

Query: 312 LSLFFVGLLVPYTDPRLSTT---SDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSA 368
           L    +G++V Y DP L      S +   +SPFV+ IQN+G + +P + N  IL +  SA
Sbjct: 354 LGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSA 413

Query: 369 GNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVF 428
           GN+ ++  SR L  ++++G AP +F + N+ GVP+ AV  S +  CLAYLN+S +   VF
Sbjct: 414 GNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVF 473

Query: 429 DWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVI 488
           +W   I+ ++GF  W+   +++IRF + +    ++   +PF+AK   +  +Y+ F++++I
Sbjct: 474 NWFSNISTISGFIGWICACVAYIRFRKAITYNKLTHR-IPFRAKGQQYTIWYSLFWVSLI 532

Query: 489 ILIQGFDSFAPE-FVFSEFIADYISVFLFIVCWLGFQVLFKTRL 531
            L  G+  F P  +   +FIA YI++ +FIV W+G +V  +T L
Sbjct: 533 TLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRTLL 576

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/539 (33%), Positives = 302/539 (56%), Gaps = 22/539 (4%)

Query: 46  ENMSEVESLYGNDDP---DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLL 102
           E+M +VE    N      ++ RDL  RH+  +++GG IGTGLF+   S + + GP   ++
Sbjct: 52  EDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVI 111

Query: 103 AYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALE 162
           A+  + T  F +  +LGE+A   PV   F +Y  R + P+LG A    Y   W V   LE
Sbjct: 112 AWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLE 171

Query: 163 LSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIY 222
           L      I+YW  +V    W+ VF++ +  ++++ V+ +GE EF ++ +K+L+I GF I 
Sbjct: 172 LVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTIL 231

Query: 223 ALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281
            +V++CGG    G +G +YW +PG +      S     +F G  S  + AAF+Y GTELV
Sbjct: 232 GIVLICGGGPKNGYIGAKYWNDPGSFVGASPGS-----QFKGLCSVFVTAAFSYSGTELV 286

Query: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPR-LSTTSDSDINTSP 340
           G++A ES NPR T+PKA  + F+ I   Y+L L  +G LV + DP+ LS +S  D+  SP
Sbjct: 287 GVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASP 346

Query: 341 FVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQG 400
            V+AI+N G + LPS+ N +IL+ I+S  NS++Y  SR +  +++ G  P +F   + +G
Sbjct: 347 LVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRG 406

Query: 401 VPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDR 460
            P  A++ + +FG L+++  S   +++F WL  ++ ++  F WL I++SHIRF + L  +
Sbjct: 407 RPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQ 466

Query: 461 GISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFV----FSEFIADYISVFLF 516
           G S ++LP+ +     G++Y    I ++++   + S  P       +  F   Y+S+ +F
Sbjct: 467 GYSLDELPYLSMTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIF 526

Query: 517 IVCWLGFQVLFKT-RLILRKEDVDIDTDRREID-------ALVWSDDDEPKTLLQKLWQ 567
           + C++G ++  +    ++R   +D++T RR ID          +++    K+ + KLW 
Sbjct: 527 LFCFVGHKLYKRNWSWMIRSNKIDVNTGRRMIDKEELEKEKQEFNEYMARKSFIAKLWN 585

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  327 bits (837), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/530 (35%), Positives = 300/530 (56%), Gaps = 14/530 (2%)

Query: 46  ENMSEVESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAY 104
           ++MS++E + +      +K  LK RH+ MI++GG IGTGLF+G  + +R AGP G L+ +
Sbjct: 64  DDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGW 123

Query: 105 LFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELS 164
              GT+ +C+  ++GE++   P++  FT Y  RF+  + G AN + Y   W     LE+ 
Sbjct: 124 GLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIV 183

Query: 165 IIGQLIQYW-TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYA 223
                + YW T       ++ +FW+++   N+  V+ YGE EF  + +KVL++ GF+I  
Sbjct: 184 AASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMG 243

Query: 224 LVMVCGGSSEGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVG 282
           +V+ CGG  EG     +Y+ +PG +       +   ARF G  S  + AAF++ G+EL+G
Sbjct: 244 IVLNCGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIG 298

Query: 283 ITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFV 342
           I A ES  PRK+VPKA  +VF+RI  FY+LSL  VGLLVPYTD RL   S  D   SPFV
Sbjct: 299 IAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFV 358

Query: 343 MAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVP 402
           +AI + G + LPSV N VIL+ +LS GNS +Y  SR L  L++    P +F   ++ G P
Sbjct: 359 IAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRP 418

Query: 403 FYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGI 462
            + +  +S FG +A++  S+   +VF WLL ++ ++  F W  I   HIRF   L  +G 
Sbjct: 419 LFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGR 478

Query: 463 SRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVC 519
           S ++LPFKA    +G+ +  F I ++ + Q + +  P   +     F   Y+S  + +  
Sbjct: 479 STDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAF 538

Query: 520 WLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDD--DEPKTLLQKLW 566
           + G ++  +  +L++    +DIDT RRE+D  V   +  +E + +  + W
Sbjct: 539 YFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTRPW 588

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/528 (35%), Positives = 297/528 (56%), Gaps = 16/528 (3%)

Query: 51  VESLYGN-DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGT 109
           V+ L G   +  +K+ +KPRH+ MISLG  IGTGL +G A  +  AGP G  + Y  MG+
Sbjct: 113 VDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGS 172

Query: 110 IAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQ 168
             +C+ Q+ GEMA T+  +   F  Y    +SP LG A  ++YW  W     LEL     
Sbjct: 173 CIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASM 232

Query: 169 LIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC 228
            I+YWT  V   V++V+F+ L+   N+   R Y E EF+    KVL I GF I  +++ C
Sbjct: 233 TIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINC 292

Query: 229 GGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGE 287
           GG+ ++G +G +YW +PG +       +K   RF G  ++L+ AAF + G+E + +TA E
Sbjct: 293 GGAGNDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASE 347

Query: 288 SKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQN 347
             NPRK +P A  K+ +RI+  ++ S+  VG LVP+   +L  +  S    SP+V+AI +
Sbjct: 348 QSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISS 407

Query: 348 SGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVL 407
            G +V+P   N VIL+++LS GNS  Y  SR+L  LS+ G AP  F   +++G P  A++
Sbjct: 408 HGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMV 467

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
             ++F  +A+   S   + VF WLL I+ ++  F W  I LSHIRF + +  +G S  ++
Sbjct: 468 IGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEI 527

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGF 523
            FK++   WG+YYAA  + ++++ Q +   AP    +     F   Y+++ + I  ++G+
Sbjct: 528 GFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGY 587

Query: 524 QVLFKT-RLILRKEDVDIDTDRREIDA-LVWSDDDEPKTLLQK--LWQ 567
               K   L +R +D+D+D  R+  D  ++  +D+E K  L+   LW+
Sbjct: 588 MFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWK 635

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 173/514 (33%), Positives = 292/514 (56%), Gaps = 13/514 (2%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           D  +++ +KPRH+ ++SLG  IGTGL +G  S +  AGP G ++ Y  MG+  +C+ Q+ 
Sbjct: 128 DDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQAC 187

Query: 119 GEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           GEMA  +  +  +F  Y    +  A G +  ++Y   W     LEL      IQYWT  V
Sbjct: 188 GEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTV 247

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236
              V++V+F++L+   N+   + Y E EF+  + KVL + GF I A+V+  GG+ ++G +
Sbjct: 248 NADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 307

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW NPG +       +K   RF   +S+   AAF +  +E + I A E  NPR+ +P
Sbjct: 308 GAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIP 362

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            A   + +RILF ++ S+  VG LVPY    L  +  +    SP+V+A+ + G +V+P  
Sbjct: 363 SAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHF 422

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS  NS  Y   R+LY LS+ G APS F   +++G P  A++ S++F  +A
Sbjct: 423 INAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIA 482

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +   S   + VF WLL I+ ++  F W+ I +SHIRF + +K +G S +++ FK++   W
Sbjct: 483 FCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVW 542

Query: 477 GAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RL 531
           G+ YAA  +T+ ++ + + S AP          F  +Y+++ + IV + G+++  +  +L
Sbjct: 543 GSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKL 602

Query: 532 ILRKEDVDIDTDRREIDA-LVWSDDDEPKTLLQK 564
            +R +D+D+ + R+  D  L+  +++E K  L+ 
Sbjct: 603 FIRAKDIDLVSHRKIYDGELIKQEEEEFKERLRN 636

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/505 (35%), Positives = 289/505 (57%), Gaps = 12/505 (2%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           D  +K+ +K RH+ MISLG  IGTG+ +G    +R  GP G ++ Y  MG+  +C+ Q+ 
Sbjct: 93  DNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAA 152

Query: 119 GEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           GE+A  +  ++  F  Y    + PALG +  ++Y   W     LEL      I+YWT +V
Sbjct: 153 GELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSV 212

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236
              +++ +F++L  A N+   R Y E EF+    KVL I GF I  +++ CGG+ ++G +
Sbjct: 213 NPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYI 272

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG +     S +K    F G VS+L+ AAF +  TE + +TA E  NPRK++P
Sbjct: 273 GGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIP 327

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            A  KV +RI+  ++ S+  VG LVP+    L  +  S  + SP+V+AI + G KV+P  
Sbjct: 328 SAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHF 387

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS GNS  Y  SR+L  L++ G APS  K  +++G P  A++ S++FG ++
Sbjct: 388 INAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLIS 447

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           ++  S   + VF WLL I+ ++  F W  I LSHIRF + +K +G S  +L FK++   W
Sbjct: 448 FVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVW 507

Query: 477 GAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RL 531
           G+YYA   + +I++ Q + + AP    +     F  +Y+++ + I  + G++V  +   L
Sbjct: 508 GSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTL 567

Query: 532 ILRKEDVDIDTDRREIDALVWSDDD 556
            +    +D+ ++RR  D  V   +D
Sbjct: 568 YIPASKIDLISNRRIFDEDVLKQED 592

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  327 bits (837), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/558 (31%), Positives = 309/558 (55%), Gaps = 22/558 (3%)

Query: 15  QHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMI 74
           Q ND ++  S SS     R+  + E      E+   + +  G+    +K+ ++PRH+ MI
Sbjct: 78  QMNDLTSAISPSS-----RQAQELE----KNESSDNIGANTGHKSDSLKKTIQPRHVLMI 128

Query: 75  SLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTM 133
           +LG  IGTGL +G  + +  AGP G L+ Y  MG+I +C+ Q+ GEMA  +  +T  +  
Sbjct: 129 ALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNA 188

Query: 134 YTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTAS 193
           Y    +    G A  ++Y   W     LEL      I+YWT +V   V++++F++L+   
Sbjct: 189 YPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITI 248

Query: 194 NMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMI 252
           N+   R Y E EF+    K+L + GF I  +++  GG+ ++G +G +YW +PG +     
Sbjct: 249 NIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAF----- 303

Query: 253 SSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYIL 312
           +      RF G  ++L+ AAF + G+E + IT  E  NPRK +P A  ++ +RILF ++ 
Sbjct: 304 NGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLA 363

Query: 313 SLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSN 372
           ++  +G LVPY   +L  ++      SP+V+A+ + G +V+P   N VIL+++LS  NS+
Sbjct: 364 TIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSS 423

Query: 373 IYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLL 432
            Y  +R+   LS+ G AP +F   ++ G P  A+  S++F  +A+   S   ++VF WLL
Sbjct: 424 FYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLL 483

Query: 433 TITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQ 492
            I+ ++  F W  I LSH+RF + +K +G S  +L FK++   WG+ YA   + +I++ Q
Sbjct: 484 AISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQ 543

Query: 493 GFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREI 547
            + + AP    +     F  +Y+++ + I  ++G++V  K  +L +R + +D+D+ R+  
Sbjct: 544 FWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQIF 603

Query: 548 D-ALVWSDDDEPKTLLQK 564
           D  L+  +D+E +  L+ 
Sbjct: 604 DEELIKQEDEEYRERLRN 621

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  327 bits (837), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/551 (32%), Positives = 304/551 (55%), Gaps = 16/551 (2%)

Query: 23  SSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGT 82
           +++SS  L +    K+   +I  + + +          ++K+ +KPRH  M+SLG  IGT
Sbjct: 108 TNDSSSQLDNELNRKSS--YITVDGIKQAPQEQEQKQENLKKSIKPRHTVMMSLGTGIGT 165

Query: 83  GLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRFLSP 141
           GL +G +  +  AGP G ++ Y  MG+  +C+ Q+ GE+A  +  +   F  Y    + P
Sbjct: 166 GLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDP 225

Query: 142 ALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFY 201
           ALG +  +L+   W     LEL      I+YWT  V   V++V+F++L+   N+   + Y
Sbjct: 226 ALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGY 285

Query: 202 GEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEAR 260
            E +F+    K+L I GF I A+++ CGG+ ++G +G +YW++PG +       +    R
Sbjct: 286 AEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF-----RGDTPIQR 340

Query: 261 FLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLL 320
           F G V++ + AAF +  +E + +TA E  NPRK +P A  K+ +RILF ++ SL  VG L
Sbjct: 341 FKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFL 400

Query: 321 VPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVL 380
           VPYT  +L   + S    SP+V+A+ + G +V+P   N VIL+++LS  NS  Y  SR+L
Sbjct: 401 VPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRIL 460

Query: 381 YGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGF 440
             L+K G AP  F   +++G P  A+L S++FG +A+   S+  + VF WLL I+ ++  
Sbjct: 461 MSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQL 520

Query: 441 FAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP- 499
           F W+ I LSHIRF + +K +G S  ++ +K++   WG+ YA   + + ++ Q + + AP 
Sbjct: 521 FTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPI 580

Query: 500 ----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID-ALVWS 553
               +     F  +Y+++ + I  ++ F+V      L +    VD+ + R   D  L+  
Sbjct: 581 GGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFDEELLKQ 640

Query: 554 DDDEPKTLLQK 564
           +D+E K  L+ 
Sbjct: 641 EDEEYKERLRN 651

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/554 (32%), Positives = 307/554 (55%), Gaps = 19/554 (3%)

Query: 20  SAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGT 79
           + +SS   D   +RK +     +I  + + +          ++K+ +KPRH  M+SLG  
Sbjct: 108 TKDSSSQLDNELNRKSS-----YITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTG 162

Query: 80  IGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRF 138
           IGTGL +G +  +  AGP G ++ Y  MG+  +C+ Q+ GE+A  +  +   F  Y    
Sbjct: 163 IGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFL 222

Query: 139 LSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPV 198
           + PALG +  +L+   W     LEL      I+YWT +V   V++V+F++L+   N+   
Sbjct: 223 VDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGA 282

Query: 199 RFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKY 257
           + Y E +F+    K+L I GF I A+++ CGG+ ++G +G +YW++PG +       +  
Sbjct: 283 KGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF-----RGDTP 337

Query: 258 EARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFV 317
             RF G V++ + AAF +  +E + +TA E  NPRK +P A  K+ +RILF ++ SL  V
Sbjct: 338 IQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLV 397

Query: 318 GLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGS 377
           G LVPYT  +L   + S    SP+V+A+ + G +V+P   N VIL+++LS  N   Y  S
Sbjct: 398 GFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSS 457

Query: 378 RVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAV 437
           R+L  L+K G AP  F   +++G P  A+L S++FG +A+   S+  + VF WLL I+ +
Sbjct: 458 RILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGL 517

Query: 438 AGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSF 497
           +  F W+ I LSHIRF + +K +G S  ++ +K++   WG+ YA   + + ++ Q + + 
Sbjct: 518 SQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAI 577

Query: 498 AP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID-AL 550
           AP     +     F  +Y+++ ++I  ++ ++V  K   L +  + VD+ + R   D  L
Sbjct: 578 APIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEEL 637

Query: 551 VWSDDDEPKTLLQK 564
           +  +D+E K  L+ 
Sbjct: 638 LKQEDEEYKERLRN 651

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/505 (35%), Positives = 288/505 (57%), Gaps = 35/505 (6%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           ++KR LK RH+ MI++GG+IGTGLF+G    +   GP+  ++ +   GT        LGE
Sbjct: 84  NLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGE 143

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           +    PV  +F  Y+ RFL P++      +Y   W     LE+      IQYW  ++   
Sbjct: 144 ITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSIDPV 203

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFR 239
           VW+ +F+ ++ + N+   R +GE EF  +++KV++I GF+I  +V++CGG  +   +G R
Sbjct: 204 VWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGAR 263

Query: 240 YWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAI 299
           YW +PG    G          F G +S L+ A+++  GTE+V + +GE+ NPR+ +P AI
Sbjct: 264 YWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-NPRE-LPSAI 311

Query: 300 NKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNG 359
            + F+RILFF+++SL  +G LVPYT+P L     S +N SPFV+AI+    K LPS+ N 
Sbjct: 312 KQTFWRILFFFLISLTLIGFLVPYTNPNL--LGGSSVNNSPFVIAIKLHHIKALPSIVNA 369

Query: 360 VILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLN 419
           VIL++I+S GNS I+  SR L  ++  GL P  F   ++ G P   +LT+S+FG LA+L 
Sbjct: 370 VILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLV 429

Query: 420 ISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAY 479
            S +  +VFDWL+ I  +A    WL I++SHIRF   +K +G S ++L F +    WG+ 
Sbjct: 430 KSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSA 489

Query: 480 YAAFFITVIILIQGFDSFAP-----------EFVFSEFIADYISVFLFIVCWLGFQVLFK 528
           Y+A   ++I++ Q + +  P           +  F  ++   I  FLF VC    +V ++
Sbjct: 490 YSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLF-VC---HKVFYR 545

Query: 529 TRL-----ILRKEDVDIDTDRREID 548
            +      I+  + +D++TDR+ ID
Sbjct: 546 YKTGKWWAIMDLDKIDLETDRKNID 570

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  325 bits (832), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/521 (33%), Positives = 292/521 (56%), Gaps = 16/521 (3%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           ++  +K+ +KPRH+ MISLG  IGTGL +G A  +  AGP G ++ Y  MG+  +C+ Q+
Sbjct: 138 EEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQA 197

Query: 118 LGEMAT-FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
            GEMA  +  +   F  Y    + P  G A  ++Y   W     LEL      I+YWT  
Sbjct: 198 AGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTT 257

Query: 177 VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGA 235
           V    ++V+F++++    +   R Y E EF+    K+L I GF I  +++  GG+ ++G 
Sbjct: 258 VNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGY 317

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295
           LG +YW +PG +      +N  + RF G +++ + AAF +  TE + +TA E  NPRK +
Sbjct: 318 LGAKYWHDPGAFR----GTNGIQ-RFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAI 372

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPS 355
           P A  KV +R++  ++ ++  +G LVP+   +L     S    SP+V+AI   G +V+P 
Sbjct: 373 PSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPH 432

Query: 356 VFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCL 415
             N VIL+++ S  NS  Y  SR+L GL++ G AP  F   ++QG PF A+  +++FG +
Sbjct: 433 FINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVI 492

Query: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475
           A+   S    +VF WLL I+ ++  F W+ I +SHIRF + +  +G S  ++ FKA+   
Sbjct: 493 AFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGV 552

Query: 476 WGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKT- 529
           +G+YYA   + + ++ Q + + AP     +     F  +Y+++ + I  + G+++  +  
Sbjct: 553 YGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDW 612

Query: 530 RLILRKEDVDIDTDRREID-ALVWSDDDEPKTLLQK--LWQ 567
           RL +R +D+D+D+ R+  D  L+  +D+E K  L+   +W+
Sbjct: 613 RLFIRAKDIDLDSYRQVFDEELLKQEDEEYKEKLKNGPMWK 653

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  322 bits (826), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/561 (34%), Positives = 304/561 (54%), Gaps = 30/561 (5%)

Query: 3   ENVELETYPAGKQHNDRS-AESSESSDVLHHR--------KETKNEGIFINQENMSEVES 53
           +  +LE+   G+ H   S    S++S V   R        K    + +  N  +  ++  
Sbjct: 13  QETQLES---GEFHEQNSYVSQSDASPVEGTRWERFRDSFKRADTQDLDPNLTDAEKMAI 69

Query: 54  LYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFC 113
           L  N    +KR LK RH+ MI++GG IGTGLF+G    +  AGP G L+ +   GT+ +C
Sbjct: 70  LTAN--APLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYC 127

Query: 114 VTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW 173
           +  ++GE+A   P+   FT Y  RF+  + G A   +Y   W V   LE+      + YW
Sbjct: 128 MVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYW 187

Query: 174 -TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSS 232
            T       ++ +F++++ A N   V+ YGE EF  + +KV+++ G++I  +++VCGG  
Sbjct: 188 GTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGP 247

Query: 233 EGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNP 291
           +G     R W NPG +  G          F G  S  + AAF++ G+ELVG+ A E+ NP
Sbjct: 248 QGGYIGGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANP 297

Query: 292 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTK 351
           RK++P A  +VF+RI  FYIL+L  VGLLVPYT  RL   S  D   SPFV++IQN+G K
Sbjct: 298 RKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIK 357

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
            LPSV N VIL+ +LS GNS ++  SR +  L+  G  P +F   ++ G P   ++ + +
Sbjct: 358 GLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCV 417

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
           FG L+++  S    +VFDWLL ++ ++  F W  I L HIR  + L  +  +  +L F A
Sbjct: 418 FGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTA 477

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFK 528
               WG+ Y    I +I++ Q + +  P   +   S F   Y+S  + I  ++G ++  K
Sbjct: 478 PTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKK 537

Query: 529 T-RLILRKEDVDIDTDRREID 548
             +L +R +++DIDT RRE D
Sbjct: 538 NWKLFIRAKNIDIDTGRRETD 558

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/555 (33%), Positives = 309/555 (55%), Gaps = 32/555 (5%)

Query: 20  SAESSESSDVLHHRK--------ETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHM 71
           S E  E   V  +R+        E+         ++ SEVE+     +  +K+ L  RH+
Sbjct: 11  SKEEEEKKTVFDNRQILINELDLESLTREKITRSDSSSEVEA---EGNGKLKQGLSSRHV 67

Query: 72  SMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP----- 126
             I+LGGTIGTGLF+G +  ++  GP G +++Y+ + T+ + +  +LGEM  ++P     
Sbjct: 68  QFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGED 127

Query: 127 VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVF 186
              S      R++  +L  A G+ Y++ + +  A E +    ++ YWT +VP +VWI +F
Sbjct: 128 SAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTTSVPTAVWITIF 187

Query: 187 WILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPG 245
             ++T  N   V+++GE EFW A++K+L I G ++ + ++  GG  S   LGF YWK+PG
Sbjct: 188 LGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPG 247

Query: 246 PWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKTVPKAINKVFF 304
            +   +   +     FL   + +IK AF +  G ELV +T+ E  + R+ + KA  +  +
Sbjct: 248 TFAHHITGGS--WGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIW 305

Query: 305 RILFFYILSLFFVGLLVPYTDPRLSTTSDSDIN---TSPFVMAIQNSGTKVLPSVFNGVI 361
           R++FFYIL    + ++V Y DP L    +       +SPFV+ IQN+G KVLP + N  I
Sbjct: 306 RLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACI 365

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           L +  SAGNS ++  SR L  ++ +G AP +F K N+ GVP+Y+V  S++  CLA+LN+S
Sbjct: 366 LSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVS 425

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
            +  +VFDW   I+ ++GF  W+   ++++RF + +    +  + LPFK    P+  +Y+
Sbjct: 426 SSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLPFKTFGQPYLIWYS 484

Query: 482 AFFITVIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLG--FQVLFKTRLILRK--- 535
              I+VI L  G+ +F P F   S+F+A YI++ LF++ W+G  F   +K  + L K   
Sbjct: 485 LLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAVPLLKLYY 544

Query: 536 --EDVDIDTDRREID 548
             +++D+ T   E +
Sbjct: 545 PVDEIDVITGLAEAE 559

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  322 bits (826), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/535 (33%), Positives = 293/535 (54%), Gaps = 15/535 (2%)

Query: 33  RKETKNEGIFINQENMSEVESLYGND--DPDVKRDLKPRHMSMISLGGTIGTGLFMGIAS 90
           + +  N    I +  ++ ++S   ND  +  +++ ++PRH+ MISLG  IGTGL +G  +
Sbjct: 49  KIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGA 108

Query: 91  PIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGY 149
            +  AGP G L+ Y+ M +  +C+ Q+ GEMA  ++ +   F  Y    +  A   A  +
Sbjct: 109 TLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAW 168

Query: 150 LYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIP-VRFYGEIEFWI 208
           +Y   W     LEL      I+YW   V   V++ +F++L+ A N+    R Y E EF+ 
Sbjct: 169 VYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFF 228

Query: 209 AALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSS 267
              K+L I GF I  ++++CGG+ + G +G  YW NPG +       +    RF G VS+
Sbjct: 229 NLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAF-----RGHTPGTRFKGIVST 283

Query: 268 LIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPR 327
           L+ AAF++  TE + ITA E  NPRK +P A  KV +R LF Y+ S+  VG LVPY  P 
Sbjct: 284 LVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPE 343

Query: 328 LSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSG 387
           L  +  S    SP+V+A+ + G ++ P   N VIL+++LS  NS+ Y  SR+L  L+K G
Sbjct: 344 LLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQG 403

Query: 388 LAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLIS 447
            AP +F   +++G P + ++ +S+   +A+   S    +VF WLL I+ ++  F W  I 
Sbjct: 404 YAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTIC 463

Query: 448 LSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVF 503
           LSHIRF + +K +G S N+L +K++   WG+ YAA  + +I++ Q + +  P        
Sbjct: 464 LSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANI 523

Query: 504 SEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDDE 557
           + F  +Y+++ + ++ + G++   K   L +R +D+D+ + R   D  V   +  
Sbjct: 524 TNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKN 578

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/566 (30%), Positives = 310/566 (54%), Gaps = 14/566 (2%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHH-RKETKNEGIFINQENMSEVESLYGNDDPDVKRDL 66
           +++    Q     +E+ + +D+       ++N       ++  ++    GN    +K+ +
Sbjct: 61  DSFKRADQGGQDESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTI 120

Query: 67  KPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFI 125
           +PRH+ MI+LG  IGTGL +G  + +  AGP G L+ Y  MG+I +C+ Q+ GE+A  + 
Sbjct: 121 QPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYS 180

Query: 126 PVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVV 185
            +T  +  Y    +    G A  ++Y   W     LEL      I+YWT +V   V++++
Sbjct: 181 NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVII 240

Query: 186 FWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNP 244
           F++L+   N+   R Y E EF+    K+L + GF I ++++  GG+ ++G +G +YW +P
Sbjct: 241 FYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDP 300

Query: 245 GPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFF 304
           G +     +      RF G V++L+ AAF + G+E + IT  E  NPRK +P A  ++ +
Sbjct: 301 GAF-----NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIY 355

Query: 305 RILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVT 364
           RILF ++ ++  +G LVPY   +L  +       SP+V+AI + G +V+P   N VIL++
Sbjct: 356 RILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLS 415

Query: 365 ILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNA 424
           +LS  NS+ Y  +R+   LS+ G AP  F   ++ G P  A+  S++F  +A+   S   
Sbjct: 416 VLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKE 475

Query: 425 KKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFF 484
           ++VF WLL I+ ++  F W  I  SHIRF + +K +G S  +L FK++   WG+ YA   
Sbjct: 476 EQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIM 535

Query: 485 ITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVD 539
           + +I++ Q + + AP    +     F  +Y+++ + I  ++G+++  K  +L +R + +D
Sbjct: 536 MLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKID 595

Query: 540 IDTDRREID-ALVWSDDDEPKTLLQK 564
           +++ R+  D  L+  +D+E +  L+ 
Sbjct: 596 LESHRQIFDEELIKQEDEEYRERLRN 621

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/524 (36%), Positives = 299/524 (57%), Gaps = 13/524 (2%)

Query: 47  NMSEVESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           N++E E + +      +K  LK RH+ MI++GG IGTGL +G    +R  GP   L+ + 
Sbjct: 69  NLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWG 128

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
            MGT+ + +  +LGE+A   P++  FT Y  RF+  + G A  + Y   W VT  LE+  
Sbjct: 129 SMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVS 188

Query: 166 IGQLIQYW-TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
               + YW T       ++ +FW+++   NM  V+ YGE EF  + +KV++I GF+I  +
Sbjct: 189 ASITVNYWGTDPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGI 248

Query: 225 VMVCGGSSE-GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           ++ CGG  E G +G +Y+ +PG +     + +   A+F G  S  + AAF++ G+ELVG+
Sbjct: 249 ILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGL 303

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVM 343
            A ES +PRK+VPKA  +VF+RI  FYILSL  +GLLVPY D RL   S  D   SPFV+
Sbjct: 304 AASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVI 363

Query: 344 AIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPF 403
           AI   G K LPSV N VIL+ +LS GNS I+  SR    L++ G  P +F   +++G P 
Sbjct: 364 AIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPL 423

Query: 404 YAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGIS 463
             ++ +S  G +A++  S   + VF+WLL ++ ++  F W  I + HIRF + L  +G S
Sbjct: 424 VGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRS 483

Query: 464 RNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCW 520
            ++L FK+    WG+Y+  F I ++ + Q + +  P         F   Y+S  L +  +
Sbjct: 484 VDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMY 543

Query: 521 LGFQVLFKT-RLILRKEDVDIDTDRREID-ALVWSDDDEPKTLL 562
           +G ++  +  +L++   ++DID+ RRE+D  L+  +  E K +L
Sbjct: 544 IGHKIYKRNWKLLIPAGEMDIDSGRREVDLELLKQEIAEEKAIL 587

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/539 (35%), Positives = 296/539 (54%), Gaps = 17/539 (3%)

Query: 18  DRSAESSESSDVLHHRKETKNEGIFINQENMSEVE--SLYGNDDPDVKRDLKPRHMSMIS 75
           D +   S+  D     K  K   +     N+SE E  ++     P +K  LK RH+ MI+
Sbjct: 44  DETGSGSKWQDFKDSFKRVKPIEV---DPNLSEAEKVAIITAQTP-LKHHLKNRHLQMIA 99

Query: 76  LGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYT 135
           +GG IGTGL +G  + +R  GP   L+ +   GT+ + +  +LGE+A   P++  FT Y 
Sbjct: 100 IGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYA 159

Query: 136 QRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFAVPLSVWIVVFWILLTASN 194
            RF+  + G AN + Y   W V   LE+      + +W T       ++ +FW+ +   N
Sbjct: 160 TRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIIN 219

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF-RYWKNPGPWGMGMIS 253
           M  V+ YGE EF  + +KV+++ GF+I  +++ CGG   G     +YW +PG +     +
Sbjct: 220 MFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAF-----A 274

Query: 254 SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313
            +   A+F G  S  + AAF++ G+ELVG+ A ES  PRK+VPKA  +VF+RI  FYILS
Sbjct: 275 GDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILS 334

Query: 314 LFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNI 373
           L  +GLLVPY D  L   S  D   SPFV+AI+  G K LPSV N VIL+ +LS GNS I
Sbjct: 335 LLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAI 394

Query: 374 YIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLT 433
           Y  SR +  L++    P +F   +++G P   +  +S FG +A++  S+   +VF+WLL 
Sbjct: 395 YACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLA 454

Query: 434 ITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQG 493
           ++ ++  F W  I + HIRF + L  +G   ++L FK+    WG+Y+  F + ++ + Q 
Sbjct: 455 LSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQF 514

Query: 494 FDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
           + +  P         F   Y+S  L +V ++G ++  +  +L +  E +DIDT RRE+D
Sbjct: 515 YVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVD 573

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/504 (35%), Positives = 286/504 (56%), Gaps = 27/504 (5%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           D  ++KR LK RH+ MI++GG+IGTGLF+G    I   GP+  ++ +   G+        
Sbjct: 81  DTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHG 140

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGE+    PV  +F  Y+ RFL P+L      +Y   W     LE+      +QYW  ++
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSI 200

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
              VW+ +F+  + + N+   R +GE EF  +++KVL+I GF+I  +V++CGG  +   +
Sbjct: 201 DPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFV 260

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG    G          F G +S L+ A+++  GTE+V + +GE+ +P K +P
Sbjct: 261 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DP-KELP 308

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            AI + F+RILFF+++SL  +G LVPYT+  L     S +N SPFV+AI+    KVLPS+
Sbjct: 309 SAIKQTFWRILFFFLVSLTLIGFLVPYTNENL--LGGSSVNNSPFVIAIKLHQIKVLPSI 366

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL++ILS GNS I+  SR L  ++  GL P  F   ++ G P   ++T+S+FG LA
Sbjct: 367 VNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLA 426

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +L  S +  +VFDWL+ I  +A    WL I++SHIRF   +K +G S ++L F +    W
Sbjct: 427 FLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIW 486

Query: 477 GAYYAAFFITVIILIQGFDSFAP-------EFVFSEFIADYISVFLFIVCWLGFQVLFKT 529
           G+ Y+A   ++I++ Q + +  P            +F   Y+   + IV ++G ++ ++ 
Sbjct: 487 GSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRY 546

Query: 530 RL-----ILRKEDVDIDTDRREID 548
           +      +L    +D++TDR+ ID
Sbjct: 547 KTGKWWSMLPLNKIDLETDRKNID 570

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  322 bits (826), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/520 (34%), Positives = 290/520 (55%), Gaps = 13/520 (2%)

Query: 46  ENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           E     E    +D  ++K+ +KPRH+ MISLG  IGTG+ +G  + +  +GP G ++ Y 
Sbjct: 93  EGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYA 152

Query: 106 FMGTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELS 164
            MG+  +C+ Q+ GE+A  +  +T  F  Y    + PA G A  ++Y   W     LEL 
Sbjct: 153 IMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELV 212

Query: 165 IIGQLIQYWTFAVPLSVWIVVFWILLTASNMIP-VRFYGEIEFWIAALKVLSIFGFLIYA 223
                I+YWT  V   V++V+F+ L+   N++     Y E EF+  + K+L + GF I  
Sbjct: 213 TASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILG 272

Query: 224 LVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVG 282
           +V++CGG+ ++G +G R W NPG +       +K   RF G VS+L+ AAF +  +E +G
Sbjct: 273 IVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLG 327

Query: 283 ITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFV 342
           +TA E  NPRK +P A  K+ +RI+  Y+ S+  VG LVPY   +L  +S +    SP+V
Sbjct: 328 VTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYV 387

Query: 343 MAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVP 402
           +AI   G +V+P   N VIL+++LS GNS  Y  SR L  LS+ G APS     ++ G P
Sbjct: 388 LAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRP 447

Query: 403 FYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGI 462
             A   S++ G +A+   S    +VF WLL I+ ++  F W  I LSH+RF + ++ +G 
Sbjct: 448 LKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGR 507

Query: 463 SRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIV 518
           S  ++ FK++   +G+ Y+   + +I++ Q + +  P    +     F  +Y+++ +FIV
Sbjct: 508 SMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIV 567

Query: 519 CWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDDE 557
            + GF++  K  RL +R ED+D+ + R   D  +   +DE
Sbjct: 568 LYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDE 607

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  322 bits (825), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/551 (32%), Positives = 306/551 (55%), Gaps = 16/551 (2%)

Query: 23  SSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGT 82
           + +SS  L +    K+  I ++    S  E     ++  +K+ +KPRH  M+SLG  IGT
Sbjct: 108 TKDSSSRLDNELNPKSSYITVDGIKQSSQEQEPKQEN--LKKSIKPRHTVMMSLGTGIGT 165

Query: 83  GLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRFLSP 141
           GL +G +  +  AGP G ++ Y  MG+  +C+ Q+ GE+A  +  +   F  Y    + P
Sbjct: 166 GLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVDP 225

Query: 142 ALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFY 201
           A+G +  +L+   W     LEL      I+YWT  V   V++++F++L+   N+   + Y
Sbjct: 226 AVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKGY 285

Query: 202 GEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEAR 260
            E +F+    K+L I GF I A+++ CGG+ ++G +G RYW++PG +       +    R
Sbjct: 286 AEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAF-----RGDTSIQR 340

Query: 261 FLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLL 320
           F G V++ + AAF +  +E + +TA E  NPRK +P A  K+ +RILF ++ SL  VG L
Sbjct: 341 FKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGFL 400

Query: 321 VPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVL 380
           VPYT  +L   + S    SP+V+A+ + G +V+P   N VIL+++LS  NS  Y  SR+L
Sbjct: 401 VPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRIL 460

Query: 381 YGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGF 440
             L+K G AP  F   +++G P  A++ S++FG +A+   S+  + VF WLL I+ ++  
Sbjct: 461 MSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQL 520

Query: 441 FAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP- 499
           F W+ I LSHIRF + +K +G S  ++ +K++   WG+ YA   + + ++ Q + + +P 
Sbjct: 521 FTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAISPI 580

Query: 500 ----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID-ALVWS 553
               +     F  +Y+++ + I  ++ ++V  +   L +  + +D+ + R   D  L+  
Sbjct: 581 GGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKIDLVSHRNIFDEELLKQ 640

Query: 554 DDDEPKTLLQK 564
           +D+E K  L+ 
Sbjct: 641 EDEEYKDRLRN 651

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  320 bits (819), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 173/505 (34%), Positives = 286/505 (56%), Gaps = 14/505 (2%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           ++K+ +K RHM MISLG  IGTGL +G  + +   GP GS + +L MG   +CV Q+ GE
Sbjct: 89  NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGE 148

Query: 121 MA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW--TFAV 177
           +A  +  +   F  Y    + PALG A  ++Y   W   F LEL      I++W  + +V
Sbjct: 149 LAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSV 208

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG-SSEGAL 236
              +++ +F++L+   N    R Y E EF+  + KVL + GF I  +++  G   + G +
Sbjct: 209 NPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYI 268

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW++PG  G        +   F G V++L+ AAF+   +E V +TA E  NPRK++P
Sbjct: 269 GGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSIP 323

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            A  K+ ++I   ++ S+  +G LVP     L  ++DSD++ SP+V+A++  G  V+PS 
Sbjct: 324 AAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVVPSF 383

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS GNS  Y  SR+L+ L++   AP +FK  ++ G P  A++ S +FG + 
Sbjct: 384 INAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTIC 443

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           ++  S   ++VF WLL I+ ++  F W  I LSHIRF + L  +G S ++L FKA+    
Sbjct: 444 FVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGII 503

Query: 477 GAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RL 531
           G+Y +A  + + ++ Q + S  P    E     F   Y+++ +F++ + G+++  K  RL
Sbjct: 504 GSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKDWRL 563

Query: 532 ILRKEDVDIDTDRREIDALVWSDDD 556
            +R + +D+ + RR  DA V   +D
Sbjct: 564 FIRADQIDLVSHRRIFDADVLKQED 588

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/510 (36%), Positives = 292/510 (57%), Gaps = 14/510 (2%)

Query: 47  NMSEVESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           N+++ E +        +K  LK RH+ MI++GG IGTGLF+G    +R AGP G L+ + 
Sbjct: 71  NLTDAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWT 130

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
             GT+ + +  ++GE+A   PV+  FT Y  RF+  + G A  + Y   W +T  LE+  
Sbjct: 131 VTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVS 190

Query: 166 IGQLIQYWTF-AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
               + YW   A     ++ +FW+     N+  V+ YGE EF  A +KV++I GF+I A+
Sbjct: 191 ASITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAV 250

Query: 225 VMVCGGSSEGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           +++CGG   G     +YW +PG + +G  +  K++    G+ +  I A+F++ G+E+VG+
Sbjct: 251 ILICGGGPVGGYIGAKYWHHPGAF-VGDTAGQKFK----GFCTVFITASFSFGGSEVVGV 305

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVM 343
              ES+NPRK+VP A  +VF+RI  FY+L L  +G+LVPY D RL   S  D   SPFV+
Sbjct: 306 AGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVI 365

Query: 344 AIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPF 403
           A+ N G + LPSV N VIL+++LS GNS+IY+ SR L  L++ G  P +    ++ G P 
Sbjct: 366 AVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPL 425

Query: 404 YAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGIS 463
            A+  +S FG +A++  S +  +VF+WLL ++ ++  F+W  I + HIRF + L  +G S
Sbjct: 426 VAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRS 485

Query: 464 RNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGF 523
            ++LPF +     G+Y+  F   ++++ Q +    P    S    D+   +L     L F
Sbjct: 486 TDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGA-SPNAKDFFMAYLSFPIVLAF 544

Query: 524 QVLFKT-----RLILRKEDVDIDTDRREID 548
            +  K      +L ++ ED+DIDT RRE+D
Sbjct: 545 YIFHKIWKKNWKLYIKAEDMDIDTGRREVD 574

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  320 bits (820), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/564 (34%), Positives = 310/564 (54%), Gaps = 22/564 (3%)

Query: 11  PAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRH 70
           PA K+ N R     +S     H     ++   IN+   +E E+   + + ++K+ +KPRH
Sbjct: 64  PAKKKSNLR--RFVDSFKRAEHMIPADDK---INEMTTAEPEAEMASVEDNLKQTIKPRH 118

Query: 71  MSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT-FIPVTS 129
           + MISLG  IGTGL +G  S +  AGP G +  Y  MGT  +C+ QS GEMA  +  +  
Sbjct: 119 VIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNG 178

Query: 130 SFTMYTQRFLSPA--LGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFW 187
            F  Y    + P   +    G L+    C++F +         +YWT  V   V++V+F+
Sbjct: 179 GFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCF--DDYKYWTTRVDPDVFVVIFY 236

Query: 188 ILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGP 246
           +L+   N+   R Y E EF+    KVL + GF I  +++  GG+ ++G LG  YW+NPG 
Sbjct: 237 VLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGA 296

Query: 247 WGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRI 306
           +       +K    F G V++L+ AAF + GTE + +TA E  NPRK +P A  KV +RI
Sbjct: 297 F-----RGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRI 351

Query: 307 LFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTIL 366
           +  Y+ S+  +G LVP+T P L  +  +    SP+V+A+ + G +V+P   N VIL+++L
Sbjct: 352 VLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHFINAVILLSVL 411

Query: 367 SAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKK 426
           S GNS  Y  SR+L  LSK G AP  F   +++G P  A++ S++FG +A+   S    +
Sbjct: 412 SVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETE 471

Query: 427 VFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFIT 486
           VF WLL I+ ++  F W+ I LSHIRF   +K +G S  ++ FKA+   WG+YY+ F + 
Sbjct: 472 VFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMI 531

Query: 487 VIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDID 541
           + ++ Q + + AP    E     F  +Y+++ + I  + G+++  K   L ++ ED+D+ 
Sbjct: 532 LTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDIDLI 591

Query: 542 TDRREID-ALVWSDDDEPKTLLQK 564
           + R+  D  L+  +D E K  L+ 
Sbjct: 592 SHRQIFDEELLKQEDYELKEKLKN 615

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/516 (34%), Positives = 284/516 (55%), Gaps = 13/516 (2%)

Query: 49  SEVESLYGNDDPD-VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFM 107
           ++ ESL  N+  + +K+ ++PRH+ MISLG  IGTGL +G    +   GP G  + +  M
Sbjct: 75  NDQESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVM 134

Query: 108 GTIAFCVTQSLGEMATFIPVTSS-FTMYTQRFLSPALGAANGYLYWFSWCVTFALELSII 166
           GT  +CV Q+ GEMA   P  S  F  Y    + P  G A  +LY   W   F LEL   
Sbjct: 135 GTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTA 194

Query: 167 GQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVM 226
              I+YWT A+   +++ VF++L+   N    R Y E EF+    KVL I GF I  +++
Sbjct: 195 SITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILV 254

Query: 227 VCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITA 285
             G + ++G +G +YW+ PG +G      +     F G VS+L+ AAF+   +E V +TA
Sbjct: 255 NTGAAGNDGYIGAKYWREPGSFG-----GHTAIDHFKGVVSTLVNAAFSLGCSEFVALTA 309

Query: 286 GESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAI 345
            E  NPRK+VP A  K+ +++   ++ S+  +G LVP     L  ++DS ++ SP+V+A+
Sbjct: 310 AEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAV 369

Query: 346 QNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYA 405
            + G +V+P   N VIL+++LS GNS  Y  SR+L  L++ G AP +FK  ++QG P  A
Sbjct: 370 ASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMA 429

Query: 406 VLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRN 465
           ++ S   GCL ++  S   + VF WLL I+ ++  F W  I +SHIRF + L  +G   +
Sbjct: 430 MMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWD 489

Query: 466 DLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWL 521
            L FKA+   WG+YY+A  + +  + Q +    P    +     F   Y++  +F+  + 
Sbjct: 490 GLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYF 549

Query: 522 GFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDD 556
           G+++  K  +L +  E +D+D  R+  DA V   +D
Sbjct: 550 GYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQED 585

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  319 bits (817), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/572 (31%), Positives = 319/572 (55%), Gaps = 32/572 (5%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHR---KETKNEGIFINQENMSEVE-----SLYGNDD 59
           E+  +G ++N +  ++ +  D+   +    ++ +    I++E + +V+     S  G+++
Sbjct: 42  ESASSGSRNNHQRYDNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDLEKSPSADGDNE 101

Query: 60  P-DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           P  +K+ L+ RH+ +I+LGG IGTGL +G +S +   GP G  ++Y+ +  + + +  +L
Sbjct: 102 PRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCAL 161

Query: 119 GEMATFIP-----VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW 173
           GEM  F+P        S      R++  +LG A G+ Y++ + +  A E +    +++YW
Sbjct: 162 GEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYW 221

Query: 174 TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-S 232
           T AVP  VWI VF +++   N   V+ YGE EFW A++K+L I G +I + ++  GG   
Sbjct: 222 TTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPK 281

Query: 233 EGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNP 291
              LGFRYW++PG +   +   +     F    + +IK AF +  G ELV +T+ E  + 
Sbjct: 282 HDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQ 339

Query: 292 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTT---SDSDINTSPFVMAIQNS 348
           R+ + KA  +  +R++FFY+L    + ++VPY DP L            +SPFV+ IQN+
Sbjct: 340 RRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNA 399

Query: 349 GTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLT 408
           G KVLP + NG IL +  SA N+ ++  +R L  ++++G AP    K N+ GVP+ AV  
Sbjct: 400 GIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAA 459

Query: 409 SSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLP 468
           S +  CLAYLN+S +   VF+W   I+ ++GF  W+   ++++RF + +   G+  + LP
Sbjct: 460 SFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLP 518

Query: 469 FKAKFMPWGAYYAAFFITVIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLGFQVLF 527
           FK    P+  +++   +++I +  G+  F P++   ++FIA Y+++ +F+V WLG ++  
Sbjct: 519 FKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYT 578

Query: 528 KT---------RLILRKEDVDIDTDRREIDAL 550
           +T          + + +  V+I+   REI+ L
Sbjct: 579 RTWHQWWLPVSEIDVTRGLVEIEEKSREIEEL 610

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/564 (31%), Positives = 309/564 (54%), Gaps = 28/564 (4%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGI---------FINQENMSEVESLYGND 58
           E+  +G + N      +E  D +   K +KN             I   ++ +  S+ G++
Sbjct: 48  ESLSSGLRRNH--PYDNEKDDAIRMEKISKNHSASSNGTIREDLIMDVDVEKSPSVEGDN 105

Query: 59  DPD-VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           +P  +K+ L+ RH+ +I+LGG IGTGL +G +S +   GP G  ++Y+ +  + + +  +
Sbjct: 106 EPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCA 165

Query: 118 LGEMATFIP-----VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQY 172
           LGEM  F+P        S      R++  +LG A G+ Y++ + +  A E +    +++Y
Sbjct: 166 LGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEY 225

Query: 173 WTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS- 231
           WT AVP  VWI +F  ++   N+  V+ YGE EFW A++K+L I G +I + ++  GG  
Sbjct: 226 WTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGP 285

Query: 232 SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKN 290
           +   LGFRYW++PG +   +   +     F    + +IK AF +  G ELV +T+ E  +
Sbjct: 286 NHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECAD 343

Query: 291 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTT---SDSDINTSPFVMAIQN 347
            R+ + KA  +  +R++FFY+L    + ++VPY DP L            +SPFV+ IQN
Sbjct: 344 QRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQN 403

Query: 348 SGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVL 407
           +G KVLP + NG IL +  SA N+ ++  +R L  ++++G AP    + N+ GVP+ AV 
Sbjct: 404 AGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVG 463

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
            S +  CLAYLN+S +   VF+W   I+ ++GF  W+   ++++RF + +   G+  + L
Sbjct: 464 VSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRL 522

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLGFQVL 526
           PFK    P+  + +   + +I L  G+  F P++   ++FIA YI++ +F+V W G ++ 
Sbjct: 523 PFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLY 582

Query: 527 FKT--RLILRKEDVDIDTDRREID 548
            +T  +  L   ++D+ T   EI+
Sbjct: 583 TRTWSQWWLPVSEIDVTTGLIEIE 606

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/554 (32%), Positives = 301/554 (54%), Gaps = 18/554 (3%)

Query: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDV 62
           +N EL +  +  + N     SS + D+L    +     +    E  S VE +   ++ ++
Sbjct: 35  DNFELSSVNSPVRVN---VSSSGNDDILKGDTKEYPRDVKATPEAASYVEDI---NNTNL 88

Query: 63  KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA 122
            +DL  RH+  +++GG IGTGLF+   + +   GP   ++ ++ + T  F V  SLGE+A
Sbjct: 89  NKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGELA 148

Query: 123 TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVW 182
              PV   F +Y  RF+ P+   A    Y   W V   LEL      I+YW   +    W
Sbjct: 149 AAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDKINSDAW 208

Query: 183 IVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYW 241
           + +F+  +  +NM+ V+ +GE EF ++ +K+L+I GF I  +V+ C GG   G +G +YW
Sbjct: 209 VAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIGGKYW 268

Query: 242 KNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 301
            NPG +       +   ++F G  S  + AAF+Y G E+  ++A ES+NP++T+PKA  +
Sbjct: 269 HNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAKR 323

Query: 302 VFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFNGV 360
            F+ I   Y+  L  +G LVPY DPRL   S S D   SP V+AI+N G K LPS+ N +
Sbjct: 324 TFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNAI 383

Query: 361 ILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNI 420
           IL+ I+S  NS +Y  SR +  ++  G  P    K +K+G P  A+L +  FG L+++  
Sbjct: 384 ILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIAA 443

Query: 421 SQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYY 480
           S   ++VF WL  ++ ++  F W+ I+LS IRF   +K +G S +++PF ++   WGA+Y
Sbjct: 444 SDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAWY 503

Query: 481 AAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRK 535
               + ++++   + S  P          F   Y+S+ + I C++G ++  +  RL++  
Sbjct: 504 GVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWRLLVPL 563

Query: 536 EDVDIDTDRREIDA 549
            ++D+D+ RR +DA
Sbjct: 564 MEMDLDSGRRVLDA 577

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/546 (32%), Positives = 296/546 (54%), Gaps = 27/546 (4%)

Query: 14  KQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSM 73
           ++  D     +E + +L H      E +F     + E+ ++    +  +K+ ++PRH+ M
Sbjct: 59  RRAEDVRILPNEMNPILSH------ESVF--DTAVVEISAVDNQINEKLKKTIQPRHVIM 110

Query: 74  ISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFT 132
           I+LG  +GTGL +G  + +  AGP G ++ Y  M T  +CV Q++GEMA  ++ +   F+
Sbjct: 111 ITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFS 170

Query: 133 MYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTA 192
            Y    + P L  A  ++Y   W     LEL      IQYWT  V   +++++F++L+  
Sbjct: 171 AYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYLLMIG 230

Query: 193 SNMIP-VRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMG 250
            N+    R Y E EF+    K+L + GF I  ++++CGG+ + G +G RYW +PG +   
Sbjct: 231 INIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGFIGARYWHSPGAF--- 287

Query: 251 MISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFY 310
               +    RF G VS+L+ AAF + GTE + ITA E  NPRK +P A  KV +R L  Y
Sbjct: 288 --RGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIY 345

Query: 311 ILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGN 370
           + S+  VG LVPY    L  +S      SP+V+A+ + G +V+P   N VIL+++ S  +
Sbjct: 346 VGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGIRVVPHFINAVILISVFSVAD 405

Query: 371 SNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDW 430
           S  Y  SR+L  L++ G AP +F   +K+G P    +  +I   +++   S     VF+W
Sbjct: 406 SAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNW 465

Query: 431 LLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIIL 490
           LL+I+ ++  F W +ISLSHIRF + +K +G S +++ FK++   WG+ YA   + ++++
Sbjct: 466 LLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLI 525

Query: 491 IQGFDSFAPEFVFSEFIADYISVF-------LFIVCWLGFQVLFKT-RLILRKEDVDIDT 542
            Q +    P     E  AD +S F       +FIV + G+++  +  RL +R +++D+  
Sbjct: 526 GQFWVGIVP---VGEDSADAVSFFQAYLAMPVFIVLYFGYKIWNRDWRLFIRAKNIDLIA 582

Query: 543 DRREID 548
            R   D
Sbjct: 583 HRHIYD 588

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/544 (31%), Positives = 301/544 (55%), Gaps = 23/544 (4%)

Query: 14  KQHNDRSAESSESSDVLHHRKETKNE--GIFINQENMSEVESLYGNDDPDVKRDLKPRHM 71
           ++ +  S  +S  S V H + +T  +   +  ++++++ V         ++ ++L  RH+
Sbjct: 34  EKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDDINNV---------NLNKNLSIRHL 84

Query: 72  SMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSF 131
             +++GG+IG GLF+   + +   GP   ++ ++ + T  F V  +LGEMA   PV   F
Sbjct: 85  LTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGF 144

Query: 132 TMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLT 191
            +Y  RF+ P++G A    Y   W V   LEL      I+YW   +    W+ +F+ ++ 
Sbjct: 145 NVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIA 204

Query: 192 ASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWGMG 250
            +NM+ V+ +GE EF ++ +K+L+I GF I  +V+ C GG   G +G +YW +PG + +G
Sbjct: 205 LANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF-VG 263

Query: 251 MISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFY 310
             S  K++    G  S  + AAF+Y G E+  ++A ESK+PR T+PKA  + F+ I   Y
Sbjct: 264 HNSGTKFK----GLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASY 319

Query: 311 ILSLFFVGLLVPYTDPR-LSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAG 369
           +  L  +G LVPY DPR LS TS  D  +SP V+AI+N G K LPS+ N +IL++I+S  
Sbjct: 320 VTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVA 379

Query: 370 NSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFD 429
           NS +Y  SR +  ++  G  P +  + + +G P  A++ +  FG L+++  S     VF 
Sbjct: 380 NSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFT 439

Query: 430 WLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVII 489
           WL  ++ ++  F W+ I+LSHIRF Q +  +  S ++LPF ++   WG++Y    + +++
Sbjct: 440 WLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVL 499

Query: 490 LIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKTR-LILRKEDVDIDTDR 544
           +   + S  P          F   Y+S  + + C+ G ++  + R  ++   D+D+DT R
Sbjct: 500 VASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGR 559

Query: 545 REID 548
           R++D
Sbjct: 560 RQVD 563

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/559 (32%), Positives = 308/559 (55%), Gaps = 25/559 (4%)

Query: 19  RSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYG----NDDPDVKRDLKPRHMSMI 74
           R AE  E +      ++ +NE   ++  + S+ + L+G    +DD  +++ ++PRH+ M+
Sbjct: 79  RRAEDDEET-----AEDLENE--LVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVLMM 131

Query: 75  SLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTM 133
           SLG  IGTGL +G  S +  AGP   ++ Y  MG+  +C+ Q+ GEMA  +  +  +F  
Sbjct: 132 SLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNA 191

Query: 134 YTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTAS 193
           Y    +   +     ++Y   W     LEL      I YWT  V   V++V+F++L+T  
Sbjct: 192 YPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLITLI 251

Query: 194 NMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMI 252
           N    + Y E EF+  + KVL + GF I A+V+  GG+ ++G +G +YW NPG +     
Sbjct: 252 NTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF----- 306

Query: 253 SSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYIL 312
             +K   RF   +S+   AAF +  +E + I A E  NPR+ +P A   + +RILF ++ 
Sbjct: 307 RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLT 366

Query: 313 SLFFVGLLVPYTDPRL-STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNS 371
           S+  VG LVPY    L  +   +    SP+V+A+ + G +V+P   N VIL+++LS  NS
Sbjct: 367 SITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANS 426

Query: 372 NIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWL 431
             Y   R+LY L++ G AP  F+  +++G P  A+L ++IFG +A+ + S   + VF WL
Sbjct: 427 AYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWL 486

Query: 432 LTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILI 491
           L+I  ++  F W  I LSHIRF + +K +G S +++ FK++   WG+ YAA  + + ++ 
Sbjct: 487 LSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIA 546

Query: 492 QGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRRE 546
           + + S AP          F  +Y+++ + IV + G+++  K  +L +R +D+D+ + R  
Sbjct: 547 EFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTI 606

Query: 547 IDA-LVWSDDDEPKTLLQK 564
            D  LV  +++E K  L+ 
Sbjct: 607 FDGELVRQEEEEYKEKLRN 625

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/531 (33%), Positives = 297/531 (55%), Gaps = 18/531 (3%)

Query: 26  SSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLF 85
           SS V     +  + G F + +++ + +     ++ ++ ++L  RH+  +++GG IGTGLF
Sbjct: 54  SSGVNQTTNDITSSGRFHSDDDVQQEDI----NNTNLSKELSVRHLLTLAVGGAIGTGLF 109

Query: 86  MGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGA 145
           +   + +   GP   ++ ++ + T  F V  SLGE++   PV   F +Y+ RF+ P+   
Sbjct: 110 VNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAF 169

Query: 146 ANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIE 205
           A    Y   W V   LEL      I+YW   +    W+ +F+  +  +NM+ V+ +GE E
Sbjct: 170 AVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETE 229

Query: 206 FWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGW 264
           F ++ +K+L+I GF I  +V+ C GG   G +G +YW +PG + +G  S  K++    G 
Sbjct: 230 FVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAF-VGHDSGTKFK----GL 284

Query: 265 VSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYT 324
            S  + AAF+Y G E+  ++A ESKNPR+T+PKA  + F+ I   Y+  L  +G LVP  
Sbjct: 285 CSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSN 344

Query: 325 DPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGL 383
           DPRL   S S D  +SP V+AI+N   K LPS+ N +IL+ ++S  NS +Y  SR +  +
Sbjct: 345 DPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAM 404

Query: 384 SKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAW 443
           +  G  P   ++ +K+G P  A++ +  FG L+++  S    +VF WL  ++ ++  F W
Sbjct: 405 AHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCW 464

Query: 444 LLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGF-DSFAP--- 499
           + I+LSHIRF Q +K +  S ++LPF ++   WG+ Y  F +  ++LI  F  S  P   
Sbjct: 465 MAINLSHIRFRQAMKFQERSLDELPFISQTGVWGSIY-GFVVLFLVLIASFWTSMFPIGS 523

Query: 500 -EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
                  F   Y+S  + IVC+ G ++  +  RL+++ ED+D+DT R+++D
Sbjct: 524 SGANAESFFEGYLSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVD 574

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/567 (32%), Positives = 304/567 (53%), Gaps = 25/567 (4%)

Query: 1   MVENVELETYPAGKQHNDRS---AESSESSDVLHHRKETKNEGIFINQENMSEVESLYGN 57
           MV+  +  T P  +   D +    E    +D         + GI     +++  +   G+
Sbjct: 14  MVDGFKPATSPVSENEKDSTIFVTEQKSKTDSTFLLSSKGSPGINQTTNDVTSSDHFRGS 73

Query: 58  D--------DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGT 109
           +        + ++ +DL  RH+  +++GG IGTGL++   + +   GP   ++ ++ + T
Sbjct: 74  EGIEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIIST 133

Query: 110 IAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQL 169
             F V  SLGE++   PV   F +Y+ RF+ P+   A    Y   W V   LEL      
Sbjct: 134 CLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASIT 193

Query: 170 IQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC- 228
           I+YW   +    W+ +F+  +  +NM+ V+ +GE EF ++ +K+LSI GF I  +V+ C 
Sbjct: 194 IKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCG 253

Query: 229 GGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGES 288
           GG   G +G +YW +PG + +G  S  +++    G  S  + AAF+Y G E+  ++A ES
Sbjct: 254 GGPHGGYIGGKYWHDPGAF-VGHSSGTQFK----GLCSVFVTAAFSYSGIEMTAVSAAES 308

Query: 289 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPFVMAIQN 347
           KNPR+T+PKA  + F+ I   Y+  L  +G LVP  DPRL   S S D  +SP V+AI+N
Sbjct: 309 KNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIEN 368

Query: 348 SGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVL 407
            G K LPS+ N +IL+ ++S  NS +Y  SR +  ++  G  P    + +K+G P  A+L
Sbjct: 369 GGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAIL 428

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
            +  FG L+++  S    +VF WL  ++ ++  F W+ I+LSHIRF Q +K +  S ++L
Sbjct: 429 LTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDEL 488

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGF-DSFAP----EFVFSEFIADYISVFLFIVCWLG 522
           PF ++    G++Y  F +  ++LI  F  S  P          F   Y+S  + IVC+ G
Sbjct: 489 PFISQTGVKGSWY-GFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFG 547

Query: 523 FQVLFKT-RLILRKEDVDIDTDRREID 548
            ++  +   L+++ ED+D+DT R+++D
Sbjct: 548 HKIYTRNWTLMVKLEDIDLDTGRKQVD 574

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  315 bits (806), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 184/560 (32%), Positives = 306/560 (54%), Gaps = 19/560 (3%)

Query: 22  ESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIG 81
           E + SSD  + +   K E   I     +  E     ++ ++ ++L  RH+  +++GG+IG
Sbjct: 3   EETTSSDFKNEKWTLKEESQDIPSITETRQEEEETLNNTNLSKNLSVRHLVTLAVGGSIG 62

Query: 82  TGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSP 141
           TGLF+   + +   GP   ++ ++ + T  F V  SLGE+A   P+   F +Y  RF+ P
Sbjct: 63  TGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINSLGELAAAFPIVGGFNVYITRFVDP 122

Query: 142 ALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFY 201
           ++G A    Y   W V   LEL      I+YW   +    W+ +F++ +  +NM+ V+ +
Sbjct: 123 SVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDKINSDAWVAIFYVTIVLANMLEVKSF 182

Query: 202 GEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWGMGMISSNKYEAR 260
           GE EF ++ +K+L+I GF I  +V+   GG S G LGF+YW NPG +  G  +S     +
Sbjct: 183 GETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYLGFKYWNNPGAFVGGTNAS-----K 237

Query: 261 FLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLL 320
           F G  S  + AAF++ G E++ ++A ESKNPRK +PKA  + F+ +   Y++ L  VG L
Sbjct: 238 FKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAKRTFWLVTSSYVVILTLVGCL 297

Query: 321 VPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRV 379
           VPY D RL   + S D   SP V+AI+N G K LPS+ N +IL+ I+S  NS +Y  SR 
Sbjct: 298 VPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRC 357

Query: 380 LYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAG 439
           +  ++  G  P +  K +K+G P  A++ + IFG L+++  S    +VF WL  ++ ++ 
Sbjct: 358 MVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIAASDKQNEVFTWLSALSGLST 417

Query: 440 FFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP 499
            F W+ I+ S IRF + ++ +  S ++LP+ ++   WGA+Y    + ++I+   + S  P
Sbjct: 418 IFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAWYGVLVLFLVIVASFWTSMFP 477

Query: 500 ----EFVFSEFIADYISVFLFIVCWLGFQVLFKT--RLILRKEDVDIDTDRREID--ALV 551
                     F   ++S+ + +VC+ G ++ F    RL +  E++DID+ R+ ID   L 
Sbjct: 478 LGSAHADAESFFESFLSLPILLVCYFGHKLYFARNWRLQIGAEEMDIDSGRKIIDEEGLK 537

Query: 552 WSDDDEPKTL----LQKLWQ 567
              ++E K +    L K W 
Sbjct: 538 QEREEEEKAMNSSFLIKFWH 557

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  316 bits (809), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 184/557 (33%), Positives = 299/557 (53%), Gaps = 25/557 (4%)

Query: 11  PAGKQHNDRSA---ESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDD-------- 59
           P  +   D SA   E    +D         + G+     +++  E    NDD        
Sbjct: 24  PGFENEKDCSAFGTEQKSQTDSTFPLSTKGSPGMKQTTNDITSSERSRDNDDVEQVDINN 83

Query: 60  PDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLG 119
            ++ +DL  RH+  +++GG IGTGL++   + +   GP   ++ ++ +GT  F V  SLG
Sbjct: 84  TNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLG 143

Query: 120 EMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPL 179
           E++   PV   F +Y  RF+ P+   A    Y   W V   LEL      I+YW   +  
Sbjct: 144 ELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINS 203

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGF 238
             W+ +F+  +  +NM+ V+ +GE EF ++ +K+LSI GF I  +V+ C GG   G +G 
Sbjct: 204 DAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGG 263

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           +YW+NPG + +G  S  K++    G  S  + AAF+Y G E+  ++A ESKNPR+T+PKA
Sbjct: 264 KYWRNPGAF-VGHNSGTKFK----GLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKA 318

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVF 357
             + F+ I   Y+  L  +G LVP  DPRL   S S D  +SP V+AI+N   K LPS+ 
Sbjct: 319 AKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLM 378

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N +IL+ ++S  NS +Y  SR +  ++  G  P    + +K+G P  A+L +  FG L++
Sbjct: 379 NAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSF 438

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
           +  S    +VF WL  ++ ++  F W+ I+LSHIRF + +K +  S ++LPF ++    G
Sbjct: 439 VAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQTGVLG 498

Query: 478 AYYAAFFITVIILIQGF-DSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RL 531
           ++Y  F +  ++LI  F  S  P          F   Y+S  + IVC+ G ++  +   L
Sbjct: 499 SWY-GFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTRNWTL 557

Query: 532 ILRKEDVDIDTDRREID 548
           +++ ED+D+DT R+++D
Sbjct: 558 MVKIEDIDLDTGRKQVD 574

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  315 bits (807), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 191/560 (34%), Positives = 305/560 (54%), Gaps = 37/560 (6%)

Query: 7   LETYPAGKQHN--DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD-VK 63
           +ET   G++    D S ++S  S V++HR   +N    I +   S    L G+   D +K
Sbjct: 18  VETCVTGQEIKIGDGSEKTSTPSTVVNHRGTKRN---IIQRMVDSFKPPLDGSFHSDNLK 74

Query: 64  RDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT 123
           + LK RH+ MI++GG+IGTGLF+G    + V GP+  ++ +   GT        LGE+  
Sbjct: 75  KSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHGLGEITV 134

Query: 124 FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWI 183
             PV  +F  Y  RFL P++      +Y   WC    LE+      ++YW  +VP   W+
Sbjct: 135 RFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSSVPPVAWV 194

Query: 184 VVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYWK 242
            +F+  +   N++ VR +GE EF  + +KVL+I GF+I  +V++CGG  +   +G +YW 
Sbjct: 195 AIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFVGAKYWS 254

Query: 243 NPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKV 302
           +PGP   G          F G  +  + A+++  GTE+  + +GE+ +P K +P AI +V
Sbjct: 255 DPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGET-DP-KELPSAIKQV 302

Query: 303 FFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVIL 362
           F+RI+FF+++SL  VG LVPYT+  L     S ++ SPFV+AI+  G K LPSV N VIL
Sbjct: 303 FWRIVFFFLVSLTLVGFLVPYTNENL--MGGSSVDNSPFVIAIRLHGIKALPSVVNAVIL 360

Query: 363 VTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQ 422
           V++LS GNS I+  SR L  ++  GL P +F   ++ G P   +LT+  FG LA+L  S 
Sbjct: 361 VSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAFLVKSS 420

Query: 423 NAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAA 482
           ++  VF WL+ I  +A    WL I++SHIRF   +K +G+S ++L F +    +G+ Y+A
Sbjct: 421 SSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYGSVYSA 480

Query: 483 FFITVIILIQGFDSF-------APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRL---- 531
               +I++ Q + S        +P      F  +Y+   + ++ + G ++ ++       
Sbjct: 481 TINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYYRISTGKWW 540

Query: 532 ---ILRKEDVDIDTDRREID 548
               LR  D+D+ TD R  D
Sbjct: 541 GFKALR--DIDLLTDMRVTD 558

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  318 bits (815), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 177/554 (31%), Positives = 307/554 (55%), Gaps = 31/554 (5%)

Query: 24  SESSDVLHHRKETKNE-----GIFINQENMSEVESLYGNDDPD-VKRDLKPRHMSMISLG 77
           +E  D +   K +KN+     G    + ++ +  S  G+  P  +K+ L+ RH+ +I+LG
Sbjct: 118 AEKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQGLQSRHVQLIALG 177

Query: 78  GTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP------VTSSF 131
           G IGTGL +G +S +   GP G  ++Y+ +  + + +  +LGEM  F+P        SS 
Sbjct: 178 GAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSSA 237

Query: 132 TMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLT 191
            + T R++  +LG A G+ Y++ + +  A E +    +++YWT AVP  VWI +F  ++ 
Sbjct: 238 NLVT-RYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVV 296

Query: 192 ASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMV-CGGSSEGALGFRYWKNPGPWGMG 250
             N   V+ YGE EFW A++K+L I G +I + ++   GG     LGFRYW++PG +   
Sbjct: 297 LLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFAHH 356

Query: 251 MISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKTVPKAINKVFFRILFF 309
           +   +     F    + +IK AF +  G ELV +T+ E  + R+ + KA  +  +R++FF
Sbjct: 357 LAGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFF 414

Query: 310 YILSLFFVGLLVPYTDPRLSTT---SDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTIL 366
           Y+L    + ++VPY DP L            +SP+V+ IQN+G KVLP + NG IL +  
Sbjct: 415 YVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAW 474

Query: 367 SAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKK 426
           SA N+ ++  +R L  ++++G AP    K N+ GVP+ AV  S +  CLAYLN+S +   
Sbjct: 475 SAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTAD 534

Query: 427 VFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFIT 486
           VF+W   I+ ++GF  W+   ++++RF + +   G+  + LPFK    P+  +++   ++
Sbjct: 535 VFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQPYTVWFSLTVVS 593

Query: 487 VIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLGFQVLFKT---------RLILRKE 536
           +I +  G+  F P++   ++FIA YI++ +F+V WLG ++  +T          + +   
Sbjct: 594 IITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWNHWWHSVSEIDVTTG 653

Query: 537 DVDIDTDRREIDAL 550
            V+I+   R+I+ L
Sbjct: 654 LVEIEEKSRDIEEL 667

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  315 bits (807), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 172/508 (33%), Positives = 287/508 (56%), Gaps = 35/508 (6%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           D  ++KR LKPRH+ MI++GG+IGTGLF+G    I   GP+G +L +   G+        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHG 133

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGE+    PV  +F  Y  RFL P++      +Y   W     LE+      +QYW  ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
              +W+ +F+ ++ + N+   R +GE EF  + +K +++ GF+I  +V++CGG  +   +
Sbjct: 194 DPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEFI 253

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG    G          F G +S L+ A+++  G E+  + +GE+ +P K +P
Sbjct: 254 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            AI +VF+RI+FF+++SL  VG LVPYT+  L     S ++ SPFV+AI+    KVLPS+
Sbjct: 302 SAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNL--LGGSSVDNSPFVIAIKLHHIKVLPSI 359

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS GNS I+  SR L  ++  GL P  F   ++ G P   ++ +S+FG LA
Sbjct: 360 VNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLA 419

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +L  S +  +VF+WL+ I  +A    WL I+LSH+RF   +K +G S ++L F +    W
Sbjct: 420 FLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGIW 479

Query: 477 GAYYAAFFITVIILIQGFDSFAP-----------EFVFSEFIADYISVFLFIVCWLGFQV 525
           G+ Y+A    +I++ Q + S  P           +  F  ++   I VF+F++     ++
Sbjct: 480 GSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVI----HKI 535

Query: 526 LFKTRL-----ILRKEDVDIDTDRREID 548
            ++ ++     +   +D+D++TDR++ID
Sbjct: 536 YYRCQMGKWWGVKELKDIDLETDRKDID 563

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  314 bits (805), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 181/489 (37%), Positives = 283/489 (57%), Gaps = 22/489 (4%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           + R L PRH++MIS+ G IGTGL++  A  + V GP    + Y  MG + +     LGEM
Sbjct: 57  LNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEM 116

Query: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA---VP 178
           +TF+P++ SF  Y ++F   +   A    YWF+  V+ A +L+ +  ++ YW  +    P
Sbjct: 117 STFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFP 176

Query: 179 LSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LG 237
                ++FW+ L   N+I VR YGE E+W+A LKV++I  F I A+V+  G + +   +G
Sbjct: 177 YWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIG 236

Query: 238 FRYWK-NPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           F+YW     P+  G          F G+V+  + +AF+Y GTE + +TAGE++NP +  P
Sbjct: 237 FKYWSYKEAPFVNG----------FKGFVTIFVSSAFSYGGTESITLTAGEARNPIRNTP 286

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
           + +  VF+RIL FY+ ++FF+ + +PY  P LST S   + TSPF +  Q +GTK   S 
Sbjct: 287 RIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS---VMTSPFTIIFQMAGTKAAGSF 343

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLA-PSLFKKTNKQGVPFYAVLTSSIFGCL 415
            N VIL +I+SAGN  ++ GSRVLY +   G   P L  KTN+   P+ AV+ +   G L
Sbjct: 344 MNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGL 403

Query: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475
            +      A  ++ WL  I  V+   AWL I+++ IRF + L  +G ++ +L FK    P
Sbjct: 404 CFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQFKNWTYP 462

Query: 476 WGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK 535
           +G Y+   F+T+IIL+QG+ +F P +  S+F + Y+ +F+F  CWL + +  + R + + 
Sbjct: 463 YGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFKRDRFV-KP 520

Query: 536 EDVDIDTDR 544
           ED+D  TDR
Sbjct: 521 EDMDFITDR 529

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  315 bits (807), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 181/539 (33%), Positives = 296/539 (54%), Gaps = 30/539 (5%)

Query: 18  DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLG 77
           +++     SSD     ++T+ E I  N  N+S              +DL  RH+  +++G
Sbjct: 58  NQTTNDITSSDRFRRNEDTEQEDI--NNTNLS--------------KDLSVRHLLTLAVG 101

Query: 78  GTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQR 137
           G IGTGL++   + +   GP   ++ ++ + T  F V  SLGE++   PV   F +Y+ R
Sbjct: 102 GAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMR 161

Query: 138 FLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIP 197
           F+ P+   A    Y   W V   LEL      I+YW   +    W+ +F+  +  +NM+ 
Sbjct: 162 FIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLD 221

Query: 198 VRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWGMGMISSNK 256
           V+ +GE EF ++ +K+LSI GF I  +V+ C GG   G +G +YW +PG + +G  S  +
Sbjct: 222 VKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF-VGHSSGTQ 280

Query: 257 YEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFF 316
           ++    G  S  + AAF+Y G E+  ++A ESKNPR+T+PKA  + F+ I   Y+  L  
Sbjct: 281 FK----GLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTL 336

Query: 317 VGLLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYI 375
           +G LVP  DPRL   S S D  +SP V+AI+N G K LPS+ N +IL+ ++S  NS +Y 
Sbjct: 337 IGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYA 396

Query: 376 GSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTIT 435
            SR +  ++  G  P    + +K+G P  A+L +  FG L+++  S    +VF WL  ++
Sbjct: 397 CSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALS 456

Query: 436 AVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGF- 494
            ++  F W+ I+LSHIRF Q +K +  S ++LPF ++    G++Y  F +  ++LI  F 
Sbjct: 457 GLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWY-GFIVLFLVLIASFW 515

Query: 495 DSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
            S  P          F   Y+S  + IVC++G ++  +   L+++ ED+D+DT R+++D
Sbjct: 516 TSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  314 bits (804), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 178/528 (33%), Positives = 299/528 (56%), Gaps = 23/528 (4%)

Query: 34  KETKNEGIFINQENMSEVESLYGND-----DPDVKRDLKPRHMSMISLGGTIGTGLFMGI 88
           + +K+ G  I+  +  + +SL+GN+       ++ +DL  RH+  +++GG+IGTGLF+  
Sbjct: 45  QSSKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSIGTGLFVNS 104

Query: 89  ASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANG 148
            + +   GP   ++ ++ + +  F V  +LGE+A   P+   F +Y  RF+ P+   A  
Sbjct: 105 GTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAFAVN 164

Query: 149 YLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWI 208
             Y   W V+  LEL      I+YW   +    W+ +F++ +   NM+ V+F+ E EF +
Sbjct: 165 LNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSEAEFVM 224

Query: 209 AALKVLSIFGFLIYALVM-VCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSS 267
           + +K+L+I GF I  +V+ V GG + G +G +YW +PG +       +   +RF G  S 
Sbjct: 225 SIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAF-----HGDSAGSRFKGLCSV 279

Query: 268 LIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPR 327
            + AAF+Y G E+  ++A ESKNPRKT+PKA  + F+ I F YI  L  +G+LVPY D R
Sbjct: 280 FVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYNDKR 339

Query: 328 -LSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKS 386
            LS +S  D + SP V+AI+N+G K LPS+ N +IL+ +LS  NS +Y+ SRV+  ++ +
Sbjct: 340 LLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSMALT 399

Query: 387 GLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLI 446
              P +F K +K+G P Y++  +   G L+++  S   ++VF WL  I  ++  F W+ I
Sbjct: 400 NTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCWIGI 459

Query: 447 SLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEF 506
           +L+HIRF   LK +  S ++L + ++   WG++Y    I V++LI  F  +   F   E 
Sbjct: 460 NLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGV-IILVLVLIASF--WVSLFPVGES 516

Query: 507 IAD-------YISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRRE 546
            AD       Y+S  + I  ++G +V  K  + ++  E++DID  ++ 
Sbjct: 517 SADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDIDLGKKN 564

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  315 bits (806), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/521 (33%), Positives = 290/521 (55%), Gaps = 35/521 (6%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           D  ++KR LKPRH+ MI++GG+IGTGLF+G    I   GP+G ++ +   G+        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHG 133

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGE+    PV  +F  Y  RFL P++      +Y   W     LE+      +QYW  ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
              +W+ +F+ ++ + N+  VR +GE EF  + +K +++ GF+I  +V++CGG  +   +
Sbjct: 194 DPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFI 253

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG    G          F G +S L+ A+++  G E+  + +GE+ +P K +P
Sbjct: 254 GAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            AI +VF+RILFF+++SL  VG LVPYT+  L     S ++ SPFV+AI+    K LPS+
Sbjct: 302 SAIKQVFWRILFFFLISLTLVGFLVPYTNQNL--LGGSSVDNSPFVIAIKLHHIKALPSI 359

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS GNS I+  SR L  ++  GL P  F   ++ G P   ++ +S+FG LA
Sbjct: 360 VNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLA 419

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +L  S +  +VF+WL+ I  +A    WL I+LSHIRF   +K +G S ++L F +    W
Sbjct: 420 FLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIW 479

Query: 477 GAYYAAFFITVIILIQGFDSFAP-----------EFVFSEFIADYISVFLFIVCWLGFQV 525
           G+ Y+A    +I++ Q + S  P           +  F  ++   I +F+FIV     ++
Sbjct: 480 GSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIV----HKI 535

Query: 526 LFKTRL-----ILRKEDVDIDTDRREIDALVWSDDDEPKTL 561
            +K +      +   +D+D++TDR++ID  +   +   K +
Sbjct: 536 YYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKM 576

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  315 bits (806), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 186/531 (35%), Positives = 290/531 (54%), Gaps = 18/531 (3%)

Query: 47  NMSEVESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           N++E E +        ++  LK R  +MI++GG IG+GLF+G ++ +R  GP G ++ + 
Sbjct: 87  NLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWG 146

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
              T+ + +  +LGE+A   PV   FT Y  RF+  + G AN + Y   W V   LE+  
Sbjct: 147 LTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVS 206

Query: 166 IGQLIQYWTFAVPLSV---WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIY 222
               + YW    P      ++ +FW+++   NM  V+ +GE EF  + +KV ++ GF+I 
Sbjct: 207 ASITVNYW--GTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIIL 264

Query: 223 ALVMVCGGSSEGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281
            +V+VCGG  +G     +YW +PG +       +   A+F G  S  + AAF++ G+EL+
Sbjct: 265 GIVLVCGGGPKGGFVGAKYWHDPGAF-----VGHGSGAQFKGVCSVFVTAAFSFAGSELI 319

Query: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPF 341
           GITA E+ NPRK++P A  +V +RI+ FY+ +L  +GLLVPY D RL   S  D   SPF
Sbjct: 320 GITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPF 379

Query: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401
           V+AI   G K LPSV N VIL+ +LS GNS I+  SR +  LS  G  P +F   ++ G 
Sbjct: 380 VIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGR 439

Query: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461
           P   +  +S FG LA++  S+   +VF+WLL ++ ++  F W  I L HIRF   LK +G
Sbjct: 440 PLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQG 499

Query: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSE---FIADYISVFLFIV 518
              N+L F +     G+Y+  F I ++ + Q + +  P     +   F   Y+S  + + 
Sbjct: 500 RDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVA 559

Query: 519 CWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDD--DEPKTLLQKLW 566
            + G ++  +  +L +  ED+DIDT RRE D  +   +  +E   L  K W
Sbjct: 560 TYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAILASKPW 610

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  313 bits (803), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 185/572 (32%), Positives = 316/572 (55%), Gaps = 37/572 (6%)

Query: 21  AESSESSDVLH-----HRKETKN---EGIFINQENM-SEVESLYGNDDP---DVKRDLKP 68
           ++ SESSD+       + K  KN   +G+   +  + SEV+   G  +    ++K  L+ 
Sbjct: 3   SDMSESSDMATTNISVYDKNDKNNIKDGVSFEKPIIYSEVDIESGAKESSSRNLKHGLQS 62

Query: 69  RHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVT 128
           RH+ +I+LGGTIGTGLF+G +S +   GP   +++Y+ + TI + +    GEM  ++P  
Sbjct: 63  RHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGN 122

Query: 129 SS------FTMY-TQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSV 181
                   +  Y   +++  +LG A  + Y++ + V  A E +    +++YWT  +P +V
Sbjct: 123 DDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAV 182

Query: 182 WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA----LG 237
            I +F  ++   N +PV+FYGE EFW A +K+  I G +I A V+ CGG+        +G
Sbjct: 183 LIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVG 242

Query: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKTVP 296
           F YWKNP  +   +  +N     FL   ++LIK AF +  G ELV +T+ E  + R+ + 
Sbjct: 243 FHYWKNPSSFRDYV--TNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIA 300

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTT---SDSDINTSPFVMAIQNSGTKVL 353
           KA  +  +R++FFYI     + ++VPY DP L      +     +SPFV+ IQN+G  +L
Sbjct: 301 KASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITIL 360

Query: 354 PSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFG 413
           P + N  IL + +SAGN+ ++  +R L  + K+G AP +F + N+ GVP+ A+  S +  
Sbjct: 361 PHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIA 420

Query: 414 CLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKF 473
           CLA+LN S ++ KVF W   I+ ++GF  W    ++++RF + +   G+  + LPFK K 
Sbjct: 421 CLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKG 479

Query: 474 MPWGAYYAAFFITVIILIQGFDSFAPEF-VFSEFIADYISVFLFIVCWLGFQVLFKTRLI 532
             +  +Y+  F+ ++IL  G+    P+F  + +FIA YI++ +F+V + G  +++  R  
Sbjct: 480 QVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFG-HIIYSGRWR 538

Query: 533 LRK-----EDVDIDTDRREIDALVWSDDDEPK 559
            RK     +++D+ T   EI+      D+E +
Sbjct: 539 QRKWWKPVDEIDVVTGLEEIELKTKIADEERQ 570

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  313 bits (802), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 177/523 (33%), Positives = 290/523 (55%), Gaps = 12/523 (2%)

Query: 33  RKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPI 92
            +++K+  I  N +  S+      + +  + +DL  RH+  +++GG IG GLF+   + +
Sbjct: 49  NEKSKDSPIEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAAL 108

Query: 93  RVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYW 152
              GP   ++ ++ + T  F V  SLGE+A   PV   F +Y  RF+ P+   A    Y 
Sbjct: 109 ASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYL 168

Query: 153 FSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALK 212
             W V   LEL      I+YW   +    W+ +F+ ++T +NM+ V+ +GE EF ++ +K
Sbjct: 169 AQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVK 228

Query: 213 VLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKA 271
           +L+I GF I  +V+ C GG   G LG +YW NPG + +G  S  K++    G  S  + A
Sbjct: 229 ILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAF-VGHTSGTKFK----GLCSVFVTA 283

Query: 272 AFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL-ST 330
           AF+Y G E+  ++A ESK+PRKT+PKA  + F+ I   Y+  L  VG LVPY DPRL S 
Sbjct: 284 AFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSG 343

Query: 331 TSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAP 390
           TS  D   SP V+AI+N G K L S+ N +IL++I+S  NS +Y  SR +  ++  G  P
Sbjct: 344 TSSVDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLP 403

Query: 391 SLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSH 450
               K +K+G P  A L +  FG L+++  S    +VF WL  ++ ++  F W+ I++SH
Sbjct: 404 KKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISH 463

Query: 451 IRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEF 506
           IRF Q +  +  S +++P+ ++   WG+ Y    + ++++   + S  P          F
Sbjct: 464 IRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSF 523

Query: 507 IADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
              Y+S+ + IVC++G ++ FK    ++  E++D+DT R+ +D
Sbjct: 524 FEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALD 566

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  312 bits (800), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 185/576 (32%), Positives = 307/576 (53%), Gaps = 20/576 (3%)

Query: 3   ENVELETYPAG--KQHNDRSAESSESSDVLHHRKETKNEGIFINQ-ENMSEVESLYGNDD 59
           E+VE  + P    K H D S           HR +   +G   N  E  +EV       +
Sbjct: 31  ESVERISLPGDDYKFHEDDSKSRFRRFARTFHRADGLGDGASGNDVEFGAEVAR---QTE 87

Query: 60  PDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLG 119
             +K+ +  RH+ M+SLG  IGTG+ +G    +   GP G ++ Y  MG+  +C+ Q+ G
Sbjct: 88  TKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAG 147

Query: 120 EMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVP 178
           E+A ++  ++ +F  Y    +  A G +  ++Y   W     LEL      I+YWT +V 
Sbjct: 148 ELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSVN 207

Query: 179 LSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALG 237
             +++ +F++L+   NM   R Y E EF+    KVL I GF I  +++ CGG+ ++G +G
Sbjct: 208 PDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIG 267

Query: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297
            RYW NPG +        K    F G +S+++ AAF +  TE + +TA E  NPR+ +P 
Sbjct: 268 GRYWNNPGAF-----YGTKPIHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIPS 322

Query: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357
           A  KV +RIL  ++  +  +G LVP+  P L  +  S  + SP+V+A+ + G +V+P   
Sbjct: 323 AAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHFI 382

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N VIL+++LS GNS  Y  SR+L  L+    AP+  K  ++ G P  A+L S +FG +++
Sbjct: 383 NAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISF 442

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
           +  S   + VF WLL I+ ++  F W+ I +SHIRF + L  +G    +L +K++    G
Sbjct: 443 VAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVAG 502

Query: 478 AYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLI 532
           +YYA F +  I++ Q + + AP    +   + F  +Y+++ LF+V + GF++  +  RL 
Sbjct: 503 SYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLY 562

Query: 533 LRKEDVDIDTDRREIDA--LVWSDDDEPKTLLQKLW 566
           +  E +D+D+ R+  D   L   D +  + +  K W
Sbjct: 563 IPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGW 598

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  311 bits (797), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 180/588 (30%), Positives = 310/588 (52%), Gaps = 32/588 (5%)

Query: 3   ENVELETYPAGKQHNDRSAESSES-----SDVLHHR----------KETKNEGIFINQEN 47
           +++ + ++ AG      S+E + S     SD L HR            T+ + I  N  +
Sbjct: 18  DSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSD 77

Query: 48  MSE-VESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLF 106
           + + VES+    D  +K+ +K RH+ M+SLG  IGTGL +  A  +   GP   ++ Y+ 
Sbjct: 78  LEDGVESI--TSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYIL 135

Query: 107 MGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
           +  + + + Q+ GEMA   P + ++F  Y+  F+S + G A  +LY F W     LEL  
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELIT 195

Query: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225
               IQ+W   +   ++I++F++ L   +   V+ YGE EF     K+L I GF+I ++V
Sbjct: 196 ASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIV 255

Query: 226 MVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGIT 284
           + CGG+ ++G +G  YW NPG +     + +    RF      L+ A F++ G EL  ++
Sbjct: 256 INCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALS 310

Query: 285 AGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMA 344
             E  NPRK+ P A  +  +RI+  Y+L++  +G  VPY D +L     S  + SP+V+A
Sbjct: 311 VQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370

Query: 345 IQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFY 404
               G K++P + N VIL++++S  NS++Y G R++  L++ G AP      +++G P  
Sbjct: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLR 430

Query: 405 AVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISR 464
           A++   +FG +A++  S   + VF WL  I  ++  F W  I LSH+RF Q +K +G S 
Sbjct: 431 ALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490

Query: 465 NDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVC 519
           ++L +KA    WG+ Y  FF  ++ + Q + + AP     +     F  +Y++  +++  
Sbjct: 491 DELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAF 550

Query: 520 WLGFQVLFKTRLILRKED-VDIDTDRREID-ALVWSDDDEPKTLLQKL 565
           + G+ V  +   +L   D +D+D  RR  D  L+  +D+E K  L+ +
Sbjct: 551 YFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNM 598

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  311 bits (796), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 201/530 (37%), Positives = 301/530 (56%), Gaps = 16/530 (3%)

Query: 47  NMSEVESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           N++++E +        ++  LK RH+ MI++GG IGTGLF+G    +R AGP G L+ + 
Sbjct: 72  NLTDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWG 131

Query: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
             GT+ F +  +LGE+A   PV+  F  Y  RF+  + G AN + Y F W V   LE+  
Sbjct: 132 ITGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVA 191

Query: 166 IGQLIQYWTFAVPLSV-WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
               + YW   V  +  ++ +FW+++   NM  VR YGE EF  + +KV+++ GF+I  +
Sbjct: 192 ASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGI 251

Query: 225 VMVCGGSSEGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           ++VCGG   G     RYW +PG +     + +    RF G+ S  + AAF++ G+ELVGI
Sbjct: 252 ILVCGGGPVGGYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAGSELVGI 306

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVM 343
            + ESKNPRK+VP+A  +VF+RIL FYIL L  VGLLVPYTDPRL  +S  D + SPFV+
Sbjct: 307 ASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVI 366

Query: 344 AIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPF 403
           AI   G   LPSV N VIL+++LS GNS+IY  SR L  LS+ G  P      +++G P 
Sbjct: 367 AIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPL 426

Query: 404 YAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGIS 463
             +   S FG +A++  S   +++F+WLL I+ ++ F  W  I   HIRF   LK  G S
Sbjct: 427 VGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRS 486

Query: 464 RNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGF 523
            ++LPFK+     G+Y+      ++++ Q +++  P    S    D+ S +L     L F
Sbjct: 487 DDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFP-IGSSPNAYDFFSAYLAAPIVLAF 545

Query: 524 QVLFKT-----RLILRKEDVDIDTDRREIDALVWSDD--DEPKTLLQKLW 566
            +  K      +L++  +D+DIDT RRE D  +   +  +E   L  + W
Sbjct: 546 YIAHKLWKRNWKLLIPLKDIDIDTGRRETDINLLKQEIAEEKAALAMRPW 595

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  310 bits (793), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 172/508 (33%), Positives = 284/508 (55%), Gaps = 35/508 (6%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           D  ++KR LKPRH+ MI++GG+IGTGLF+G    I   GP+G +L +   G+        
Sbjct: 75  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 134

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGE+    PV  +F  Y  RFL P++      +Y   W     LE+      +QYW  ++
Sbjct: 135 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 194

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
              +W+ +F+ ++   N+   R +GE EF  + +K +++ GF+I ++V++CGG  +   +
Sbjct: 195 DPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFI 254

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG    G          F G ++ L+ A+++  G E+  + +GE+ +P K +P
Sbjct: 255 GAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGET-DP-KGLP 302

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            AI +VF+RILFF++ SL  VG LVPYT+  L     S ++ SPFV+A++    KVLP++
Sbjct: 303 GAIKQVFWRILFFFLASLTLVGFLVPYTNQNL--LGGSSVDNSPFVIAMKLHHIKVLPTI 360

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS GNS I+  SR L  ++  GL P  F   ++ G P   ++ +S+FG LA
Sbjct: 361 VNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLA 420

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +L  S +   VF+WL+ I  +A    WL I+LSHIRF   +K +G S ++L F +    W
Sbjct: 421 FLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIW 480

Query: 477 GAYYAAFFITVIILIQGFDSFAP-----------EFVFSEFIADYISVFLFIVCWLGFQV 525
           G+ Y+A    +I++ Q + S  P           +  F  ++   I +F+F+V     ++
Sbjct: 481 GSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVV----HKI 536

Query: 526 LFKTRL-----ILRKEDVDIDTDRREID 548
            +K +      +   +D+D++TDR++ID
Sbjct: 537 YYKCQTGKWWGVKSLKDIDLETDRKDID 564

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  310 bits (794), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 175/520 (33%), Positives = 285/520 (54%), Gaps = 27/520 (5%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           D  ++K+ LK RH+ MI++GG+IGTGLF+G    +   GP+  ++ +   G+        
Sbjct: 82  DTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIGTIHG 141

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGE+    PV  +F  Y+ RFL P++      +Y   W     LE+      +QYW  ++
Sbjct: 142 LGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYWNESI 201

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
              VW+ +F++ + + N+  VR +GE EF  + +KV++I GF++  ++++ GG  +   +
Sbjct: 202 DPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGPDHVYV 261

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G RYW NPG    G          F G +S ++ A+++  GTE+  + +GE+ +P K +P
Sbjct: 262 GSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCLASGET-DP-KELP 309

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            AI +VF+RILFF+++SL  VG LVPYT+  L     S ++ SPFV+AI+    KVLPS+
Sbjct: 310 SAIKQVFWRILFFFLVSLTLVGFLVPYTNENL--LGGSSVDNSPFVIAIKIHHIKVLPSI 367

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL++ILS GNS I+  SR L  ++   L P  F   ++ G P   ++T+S+FG LA
Sbjct: 368 VNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGLLA 427

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +L  S +  +VFDWL+ I  +A    WL I++SHIRF   +K +G S N+L F +    W
Sbjct: 428 FLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVGIW 487

Query: 477 GAYYAAFFITVIILIQGFDSFAP-------EFVFSEFIADYISVFLFIVCWLGFQVLF-- 527
           G+ Y+A    +I++ Q + S  P       E    +F   Y+   + +  W+G ++ +  
Sbjct: 488 GSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKIYYWR 547

Query: 528 ---KTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQK 564
              K        ++D+D  R+ ID  V   +   + +  K
Sbjct: 548 QTGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHERKMYLK 587

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/506 (33%), Positives = 285/506 (56%), Gaps = 22/506 (4%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +K+ L  RH+ +I+LGG IGTGLF+G    +   GP G + +YL + T+ + +   LGEM
Sbjct: 102 LKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNVLGEM 161

Query: 122 ATFIP-----VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
             ++P        S     +R+L  +L  A G+ Y++ + +  A E +    +++YWT  
Sbjct: 162 VCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEYWTKV 221

Query: 177 VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGA 235
           VP   WIV+F +++   NM PVR YGE EFW A  K+L I G +I + ++  GG  +   
Sbjct: 222 VPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGPNHDR 281

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKT 294
           LGFRYW  PG +   +  +N     FL     +I  AF++  G ELV + + E  +PR+ 
Sbjct: 282 LGFRYWITPGSFANTI--TNGSFGNFLDVYKGIILGAFSFILGPELVVLPSSECSDPRRN 339

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSD---INTSPFVMAIQNSGTK 351
           + KA  +  +R++FFYIL    + ++V Y DP LST    D     +SPFV+ IQN+G  
Sbjct: 340 IKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQNAGID 399

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
           VLP + N  IL++  S+GN+ ++  SR L  ++ +  AP    K N+ GVP+ AV+ S I
Sbjct: 400 VLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVIVSII 459

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
             C+AYLN S++   VF W   ++ ++GF  W+++S++++RF + ++  G+ ++ LP+  
Sbjct: 460 LSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM-KDRLPYTT 518

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSFAPE-FVFSEFIADYISVFLFIVCWLGFQVL-FKT 529
              P+   Y+     +I +  GFD   P  +  S+FIA Y+++ +F++ W+G +   ++ 
Sbjct: 519 WGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHKFYKYRF 578

Query: 530 RLILRK-------EDVDIDTDRREID 548
           ++  R+       ED+D+ T   EI+
Sbjct: 579 KIFTRQCRWWYQVEDIDVITGLEEIE 604

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  308 bits (788), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 179/550 (32%), Positives = 298/550 (54%), Gaps = 37/550 (6%)

Query: 18  DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLG 77
           D+        D+  +  +++  G   N+           + D ++K+ LK  H+ +I++G
Sbjct: 17  DKQTGQVYELDLTSYSNDSEKNGSLPNKPQ---------SGDHNLKKGLKSAHIQLIAIG 67

Query: 78  GTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-------VTSS 130
           G IGTGLF+G +S +   GP G  ++Y  M TI + V  +L EM  F+P          S
Sbjct: 68  GCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGS 127

Query: 131 FTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILL 190
            +    R++  +LG A G+ Y + + +  A E +    ++ YWT AVP + WI +F  ++
Sbjct: 128 ISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGII 187

Query: 191 TASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGM 249
              N   V FYG  E    +LK+  I G +I ++V+  GG  +   LGFR+WK+PG W  
Sbjct: 188 VVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAY 247

Query: 250 GMISSNKYEARFLGWVSSLIKAAFTY-QGTELVGITAGESKNPRKTVPKAINKVFFRILF 308
            +  ++    R    ++ +I+A F +  G ELV +T+ E+++ R+ + KA  +  +R++F
Sbjct: 248 HL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIF 305

Query: 309 FYILSLFFVGLLVPYTDPRLS---TTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTI 365
           FY +S    G++V   DP L    +       +SPFV+ IQN+G KVLP + N  IL + 
Sbjct: 306 FYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSA 365

Query: 366 LSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAK 425
            S+GNS +Y  +R L  LS+ G AP +F + N+ GVP+  V  ++ F CLAYLN+S +  
Sbjct: 366 WSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTA 425

Query: 426 KVFDWLLTITAVAGFFAWLLISLSHIRFMQV-----LKDRGISRNDLPFKAKFMPWGAYY 480
            VF+W   I+ ++GF  W+   ++++RF +      L DR      LPFK  F P+  ++
Sbjct: 426 DVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNLYDR------LPFKTPFQPYFTWF 479

Query: 481 AAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKT--RLILRKEDV 538
               I +I LI G++SF   + + +FIA YI++ LF++ WLG +   +T  + ++   ++
Sbjct: 480 YIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEI 538

Query: 539 DIDTDRREID 548
           D+ T  REI+
Sbjct: 539 DVTTGLREIE 548

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  308 bits (788), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 183/561 (32%), Positives = 305/561 (54%), Gaps = 38/561 (6%)

Query: 6   ELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD-VKR 64
           EL    A ++   + +   E S +L   +  K     + +   S    + G+ DPD +KR
Sbjct: 13  ELSNTSAVQRVLKKRSSVLEESRLLEESRTNKRG--LVRRCIDSFKPPVDGSFDPDNLKR 70

Query: 65  DLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATF 124
            LK RH+ MI++GG+IGTGLF+G    +   GP+  L+ +   GT        LGE+   
Sbjct: 71  TLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVR 130

Query: 125 IPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIV 184
            PV  +F  Y+ RFL P++      +Y   W     LE+      +++WT +V   VW+ 
Sbjct: 131 FPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPVVWVA 190

Query: 185 VFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKN 243
           VF+ L+ + N+  VR++G+ +F  + +K++ I GF+I  LV++ GG  +   +G RYW +
Sbjct: 191 VFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHD 250

Query: 244 PGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVF 303
           PG    G          F G  + ++ A+++  G+E+  + +GE+ +P K +P AI ++F
Sbjct: 251 PGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KEIPHAIKQIF 298

Query: 304 FRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILV 363
           +RI+FF+++SL  VG LVPYT+ +L     S++N SPFV+AI+    +VLP + NGVILV
Sbjct: 299 WRIIFFFLVSLTLVGFLVPYTNDQL--LGGSNVNNSPFVIAIKMHNIRVLPHIINGVILV 356

Query: 364 TILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQN 423
           +ILS GNS I+  SR L  ++  GL P +F   ++ G P   +LT+S+FG LA+L  S +
Sbjct: 357 SILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSS 416

Query: 424 AKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAF 483
              VF WL+ +  +A    WL I++SHIRF   +K +G S ++L F +    WG+ Y+  
Sbjct: 417 TGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGV 476

Query: 484 FITVIILIQGFDSFAP-----------EFVFSEFIADYISVFLFIVCWLGFQVLFKTRL- 531
              V+++ Q + S  P           E  F  ++   I +F+F+      ++ +++   
Sbjct: 477 MNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFV----AHKIYYRSTTG 532

Query: 532 ----ILRKEDVDIDTDRREID 548
               IL   ++D+++ R+ ID
Sbjct: 533 QWWKILPLAEIDLESGRKNID 553

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  308 bits (788), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 181/587 (30%), Positives = 317/587 (54%), Gaps = 29/587 (4%)

Query: 1   MVENVELETYPAGKQHNDRSAESSESSDVLHHRKET-KNEGIFINQENMSEVE----SLY 55
           MV+  +++  P     +  + ++S S     H  ++  NE      + + +VE     L 
Sbjct: 1   MVKTPQMQELPLSPYASKVAIDNSHSRPNYGHSADSWNNEKSAYQVDQIIDVEDASMELI 60

Query: 56  GNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
              +  V R LK RH+ +I+LGG IGTGLF+G    + V GP   L++Y+ M    +C+ 
Sbjct: 61  EGQEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIM 120

Query: 116 QSLGEMATFIPVTSSFTMY--TQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW 173
             L EM   +P++   +M+  T  +L+  L    G   +++  +    E++    LIQYW
Sbjct: 121 NFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYW 180

Query: 174 TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-- 231
           T A   +++I +F ++  +  M+PV F+GE EFW++ +K+  I G +I  +V+  GG+  
Sbjct: 181 TDANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPN 239

Query: 232 SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGT-ELVGITAGESKN 290
            +  LGF YWK+PG +   ++  N    +FL   +++IK+ F+Y    E+V   A E+K+
Sbjct: 240 QDKVLGFHYWKHPGAFNPHLVPGNT--GKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKD 297

Query: 291 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL---STTSDSDINTSPFVMAIQN 347
           PR+ +P+   +  +R+  FY+     +G++V Y + RL       +S+   SPFV+ IQ 
Sbjct: 298 PRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQE 357

Query: 348 SGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVL 407
            G +VLP + N  IL +  S G S +Y  SRVL+ ++ +G  P +F  TN+ G P+Y+  
Sbjct: 358 VGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTA 417

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
            +S+F  LAYLN S ++  VF WL  I  ++GF  W+L+ + ++RF +V++   ++ + +
Sbjct: 418 AASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKM 476

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVL 526
           PF+ +FM   AY +  F  ++ L  G+  F A  +  S+F A Y ++ L  V ++G  + 
Sbjct: 477 PFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIY 536

Query: 527 FKTRLILRKEDVDIDTDRREIDALVWSDDDE-------PKTLLQKLW 566
           +KT   ++  D+D +     I  +  +D++E       PK  L+K+W
Sbjct: 537 YKT---IKLRDLD-EVAAEIIPKIAMADEEEKGEVPIVPKNWLEKVW 579

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  309 bits (791), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 167/513 (32%), Positives = 286/513 (55%), Gaps = 15/513 (2%)

Query: 46  ENMSEVESLY---GNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLL 102
           + M++VE        +   + ++L  RH+  +++GG IGTGLF+   + +   GP   L+
Sbjct: 90  KEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILI 149

Query: 103 AYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALE 162
           A+  + T  F +  SLGE+A+  PV   F +Y  RF+ P+ G A    Y   W V   LE
Sbjct: 150 AWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLE 209

Query: 163 LSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIY 222
           L+     I+YW   +    W+ +F++ +  +NM+ V+ +GE EF ++ +K+L+IFGF I 
Sbjct: 210 LAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAIL 269

Query: 223 ALVMVCGGSSEGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281
             V++CGG   G     +YW +PG +       +   A+F G  S  + AAF+Y GTELV
Sbjct: 270 GTVLICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQFKGLCSVFVTAAFSYSGTELV 324

Query: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPR-LSTTSDSDINTSP 340
           G++A ES NPR T+P+A  + F+ I   Y+L L   G LVP  DPR L+  S  D+  SP
Sbjct: 325 GVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASP 384

Query: 341 FVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQG 400
            V+AI+N G + +PS+ N +IL+ I+S  NS++Y  SR +  +++ G  P +F   +++G
Sbjct: 385 LVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKG 444

Query: 401 VPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDR 460
            P  A+L + +FG L+++  S   + +F WL  ++ ++  F W  I++SHIRF + +  +
Sbjct: 445 RPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQ 504

Query: 461 GISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEF----VFSEFIADYISVFLF 516
             S ++LP+ +     G++Y A  +  ++++  + S  P          F   Y+S  +F
Sbjct: 505 QRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIF 564

Query: 517 IVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
           ++C++  ++  +  RL +    +D+D+ RR +D
Sbjct: 565 LICYISHKLYKRDWRLFIPAGQIDVDSGRRALD 597

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  308 bits (788), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 176/508 (34%), Positives = 283/508 (55%), Gaps = 35/508 (6%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           D  ++KR LKPRH+ MI++GG+IGTGLF+G    I   GP+G +L +   G+        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 133

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGE+    PV  +F  Y  RFL P++      +Y   W     LE+      +QYW  ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
              VW+ +F++++ + N+  VR +GE EF  + +K +++ GF+I  +V++ GG  +   +
Sbjct: 194 DPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYV 253

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG    G          F G +S L+ A+++  G E+  + +GE+ +P K +P
Sbjct: 254 GAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            AI +VF+RILFF+++SL  VG LVPYT+  L     S ++ SPFV+AI+    KVLPS+
Sbjct: 302 SAIKQVFWRILFFFLVSLTLVGFLVPYTNQNL--LGGSSVDNSPFVIAIKLHHIKVLPSI 359

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS GNS I+  SR L  ++  GL P  F   ++ G P   ++ +S+FG LA
Sbjct: 360 VNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLA 419

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +L  S +   VF+WL+ I  +A    WL I++SHIRF   +K +G   ++L F +    W
Sbjct: 420 FLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVGIW 479

Query: 477 GAYYAAFFITVIILIQGFDSFAP-----------EFVFSEFIADYISVFLFIVCWLGFQV 525
           G+ Y+A    +I+L Q + S  P           +  F  ++   I +F+FI      ++
Sbjct: 480 GSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFI----AHKI 535

Query: 526 LFKTRL-----ILRKEDVDIDTDRREID 548
            +K +      I   +D+D++TDR+ ID
Sbjct: 536 YYKCQTGQWWGIKALKDIDLETDRKNID 563

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  307 bits (787), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 190/579 (32%), Positives = 302/579 (52%), Gaps = 30/579 (5%)

Query: 11  PAGKQHNDRSAESSESSDVLHHRKETKNEGI---FINQENMSEVESL-YGND-------- 58
           P        S  +SE  D   H +  ++EG    F +    ++  S+  G D        
Sbjct: 13  PVWSSTKSESVTASELYDSRPHAQHEEHEGAWCRFRDSFKRAQKRSVPQGGDLETASVQT 72

Query: 59  ---DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
              D  ++R ++PRH++M+S+   IGTGL +     +R  GP G ++ Y  +  +A+ + 
Sbjct: 73  DLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMM 132

Query: 116 QSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWT 174
           Q+ GEMA   P +  +F  Y+  F+S   G A+ +LY   W   F LEL      I+YWT
Sbjct: 133 QAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWT 192

Query: 175 FAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SE 233
            +V   V+I +F++ +   +    R YGE EF     KVL I GF+I A+V+ CGG+ + 
Sbjct: 193 DSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNS 252

Query: 234 GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 293
           G +G RYW +PG + +G  +S     +F G+   L+   F+Y GTEL  +T  E  +PR+
Sbjct: 253 GYIGARYWHDPGAFAVGDPAS-----KFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRR 307

Query: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYT-DPRLSTTSDSDINTSPFVMAIQNSGTKV 352
            +  A  +  +RIL  Y+L++  +G LVP+T D  + +   S  + SP+V+A+   G KV
Sbjct: 308 AIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKV 367

Query: 353 LPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIF 412
           +P + N VIL+ ++S GNS +Y G RVL  L++ G AP      ++ G P  A++  S+ 
Sbjct: 368 VPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVI 427

Query: 413 GCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAK 472
           G LA++  S + + VF WL  I  ++  F W  I LSHIRF Q +K  G S + L +K+ 
Sbjct: 428 GLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSI 487

Query: 473 FMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLF 527
              WG+ Y   F  ++ + Q + + AP     +     F   Y++  L+ V +LG+ V  
Sbjct: 488 TGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYS 547

Query: 528 KTRLILRK-EDVDIDTDRREID-ALVWSDDDEPKTLLQK 564
              +ILR  +D+DI+  R   D   +  +  E KT+LQ 
Sbjct: 548 GEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKTMLQN 586

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  306 bits (783), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 176/521 (33%), Positives = 290/521 (55%), Gaps = 28/521 (5%)

Query: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117
           D  ++KR LK RH+ MI++GG+IGTGLF+G    +   GP+  ++ +   G+        
Sbjct: 59  DTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHG 118

Query: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           LGE+    PV  +F  Y+ RFL P++      +Y   W     LE+      IQYW  ++
Sbjct: 119 LGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSI 178

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-L 236
              VW+ +F+ ++ + N+   R +GE EF  + +K ++I GF+I  +V++CGG  +   +
Sbjct: 179 DPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFI 238

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG    G          F G +S L+ A+++  GTE+  + +GE+ +P K +P
Sbjct: 239 GAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGET-DP-KELP 286

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            AI +VF+RILFF++ SL  VG LVPYT+  L     S ++ SPFV+AI+    K LPS+
Sbjct: 287 SAIKQVFWRILFFFLASLTLVGFLVPYTNENL--LGGSSVDNSPFVIAIKLHHIKALPSI 344

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL++ILS GNS I+  SR L  ++  GL P  F   ++ G P   ++T+S+FG LA
Sbjct: 345 VNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLA 404

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +L  S +  +VFDWL+ I  +A    WL I+LSHIRF   +K +  + ++L F +    W
Sbjct: 405 FLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIW 464

Query: 477 GAYYAAFFITVIILIQGFDSFAP-----------EFVFSEFIADYISVFLFIVCWLGFQV 525
           G+ Y+A    +I++ Q + S  P           +  F  ++   I + +F +  + ++V
Sbjct: 465 GSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRV 524

Query: 526 LFKTRLILRK-EDVDIDTDRREIDA-LVWSDDDEPKTLLQK 564
            F     ++  +D+D++T R+ +D  ++ ++  E K  L+K
Sbjct: 525 SFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  306 bits (784), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 176/568 (30%), Positives = 306/568 (53%), Gaps = 21/568 (3%)

Query: 15  QHNDRSAESSESSD-VLHHR---KETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRH 70
           QH+  S E +   D  + HR      + E   + Q++  E ++     D  +K+ +K RH
Sbjct: 24  QHSKSSYEPASRQDSTMIHRFVNSFKRAEQPPLKQDSDLEEDTDTIVTDTQLKKTMKSRH 83

Query: 71  MSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-VTS 129
           + M+SLG  IGTGL +  A  +  AGP   ++AY  +  + + + Q+ GEMA   P +  
Sbjct: 84  VVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPG 143

Query: 130 SFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWIL 189
           +F  Y   F+S   G A  +L++  W     LEL      +QYW  ++   V++V+F++ 
Sbjct: 144 NFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVF 203

Query: 190 LTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWG 248
           L   +   V+ YGE EF     K+L + GF+I+++V+  GG+ + G +G +YW +PG + 
Sbjct: 204 LLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAF- 262

Query: 249 MGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILF 308
               +S+    RF G    L+ A F+Y G EL  ++  E +NPR++ P A  +  +RI+ 
Sbjct: 263 ----TSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVV 318

Query: 309 FYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSA 368
            Y+L++  VG  VP     L  +  S  + SP+V+A    G KV+P + N VIL++++S 
Sbjct: 319 IYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISV 378

Query: 369 GNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVF 428
           GNS +Y   R++  L++ G AP      +++G P +A++  S+FG + ++  S   ++VF
Sbjct: 379 GNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVF 438

Query: 429 DWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVI 488
           +WL  I  +A  F W  I +SHIRF Q +K +  S +++ +K+ F  +G+Y+  FF  ++
Sbjct: 439 NWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLV 498

Query: 489 ILIQGFDSFAPEFVFSEFIAD-----YISVFLFIVCWLGFQVLFKTRLILRK-EDVDIDT 542
            + Q + + AP  +++E  AD     Y++  +F   + G+ +  +   +    E VD+D 
Sbjct: 499 FVAQFWVALAPP-MYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDY 557

Query: 543 DRREID-ALVWSDDDEPKTLLQK--LWQ 567
            RR  D  LV  +D+E K +L+   +W+
Sbjct: 558 HRRIYDPELVKQEDEEKKEMLKNSPMWK 585

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  305 bits (782), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 172/531 (32%), Positives = 287/531 (54%), Gaps = 31/531 (5%)

Query: 42  FINQENMSEVESLYGNDDP-----DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAG 96
           F++     + + + G D+       +K+ +K RH+ MISLG  IGTGL +G  + +  AG
Sbjct: 39  FVDSFKKKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAG 98

Query: 97  PVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSW 155
           P G ++ Y     + +C+ Q+ GE+   +  +T ++T Y+   + PALG +  ++Y   W
Sbjct: 99  PGGLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQW 158

Query: 156 CVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLS 215
              F L+L      I+YWT   P  +++ + + L+   N+   + Y E EF     KVL 
Sbjct: 159 MTVFPLQLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLM 217

Query: 216 IFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFT 274
           + GF+I  +++ CGG+ ++G +G RYW  PG +  G          F G       AAF 
Sbjct: 218 MVGFVILGIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFA 267

Query: 275 YQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS 334
           Y G E++ +TA E +NPRK++P A  KV +RIL  Y+L+   V  LVPY  P L++T  +
Sbjct: 268 YGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSA 327

Query: 335 DINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFK 394
               SPFV+AI + G  V+P + N VILV ++S GNS++Y   R+L  LS+ G AP +F 
Sbjct: 328 S-RASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFN 386

Query: 395 KTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFM 454
             ++QG P    L +   G LA++  S   + VF WLL I+ ++  F W+ I LSH+RF 
Sbjct: 387 YVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFR 446

Query: 455 QVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIAD 509
             +K +G S  ++ +K++   WG+++A      +++ Q + + AP     +    +F   
Sbjct: 447 DAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQS 506

Query: 510 YISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDDEPK 559
           Y++  + I  + G+++ +K  RL +   +VD+++ R+        D+DE K
Sbjct: 507 YLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIF------DEDELK 551

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  306 bits (783), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 169/505 (33%), Positives = 280/505 (55%), Gaps = 12/505 (2%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           +  +K+ +  RH+ MISLG  IGTG+ +G    +   GP G  + Y  MG+  +C+ Q+ 
Sbjct: 76  ETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQAA 135

Query: 119 GEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           GEMA ++  ++ +F  Y    + PALG +  ++Y   W     LEL      I+YWT AV
Sbjct: 136 GEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTAV 195

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236
              V++V+F++L    N+   R Y E EF+    KVL I GF I  +++ CGG+ ++G L
Sbjct: 196 NPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYL 255

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG      +   K    F G +++++ AAF +  TE + +TA E  NPR+ +P
Sbjct: 256 GGKYWHDPGA-----LYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRRAIP 310

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            A  K+ +R+L  ++  +  +G LVPY    L  +  S  + SP+V+AI + G KV+P  
Sbjct: 311 SAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVPHF 370

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS GNS  Y  SR+L  LS+   APS     +++G P  A+L S IFG +A
Sbjct: 371 INAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLIA 430

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           ++  S   + VF WLL I+ ++  F W+ I +SHIRF + L  +G S  +L +K++    
Sbjct: 431 FVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGVV 490

Query: 477 GAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RL 531
           G+YYA   +  ++  Q + + AP    +   + F  +Y+++ + I  + G++V  +  +L
Sbjct: 491 GSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDWKL 550

Query: 532 ILRKEDVDIDTDRREIDALVWSDDD 556
            +  E +D+ + R+  D  +   +D
Sbjct: 551 YIPLEQIDLVSHRKVFDEDLLKQED 575

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  308 bits (789), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 173/568 (30%), Positives = 315/568 (55%), Gaps = 22/568 (3%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLK 67
           E +P    +N  ++ES   + +L++   T      +   + +++     +D+  +K+ +K
Sbjct: 109 EQHPTNVNNNGANSESDLENMILYNEDGTPKP---LPHHHDAQINDNSKSDE--LKKTIK 163

Query: 68  PRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIP 126
           PRH+ MISLG  IGTGL +G+ S +  AGP G ++ +  MG+  +C+ Q++GE+A  +  
Sbjct: 164 PRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVAYSD 223

Query: 127 VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVF 186
           +   F  Y    +  A   A  +LY   W     LEL      I+YWT  V   +++++F
Sbjct: 224 LVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPDIFVIIF 283

Query: 187 WILLTASNMIP-VRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNP 244
           +IL+   N++     Y E EF   + K++ + GF I  + ++CGG+ ++G +G +YW +P
Sbjct: 284 YILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKYWHDP 343

Query: 245 GPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFF 304
           G      +  +    RF G +++L+ AAF +  +E +G+TA E  NPRK +P A  K+ +
Sbjct: 344 GA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIY 398

Query: 305 RILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVT 364
           RIL  ++ S+  VG LVPY   +L  ++ S +  SP+V+AI   G +V+P   N VIL++
Sbjct: 399 RILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINAVILIS 458

Query: 365 ILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNA 424
           +LS  NS  Y  SR+L  L++ G AP ++   +++G P   + T++IFG +A+   S   
Sbjct: 459 VLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKE 518

Query: 425 KKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFF 484
            +VF WLL I+ ++  F W+ I +SHIRF + +  +G S  +L F+++   +G+ YAA  
Sbjct: 519 DEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIM 578

Query: 485 ITVIILIQGFDSFAP-------EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKE 536
           + +I++ Q + +  P       +     F  +Y+++ + +  + G+++  K  +L +R +
Sbjct: 579 MFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRAK 638

Query: 537 DVDIDTDRREID-ALVWSDDDEPKTLLQ 563
           ++D+ + R   D  L+  ++DE +  L+
Sbjct: 639 NIDLISHRNIFDEELIKQEEDEYRERLR 666

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  304 bits (778), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 172/503 (34%), Positives = 284/503 (56%), Gaps = 19/503 (3%)

Query: 52  ESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIA 111
           + +  ND   +K+ LK RH+ M++L G  GTGLF+     ++  GPVG L+AY+ +G + 
Sbjct: 36  QGVLHNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVV 95

Query: 112 FCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFAL----ELSIIG 167
            C   ++ E+A+F+P T +   ++++F+  A+G      + F W  T++     ELS   
Sbjct: 96  GCNQIAIAEVASFMPATGATIRHSEQFIDEAVG------FTFGWISTYSSLMPGELSATA 149

Query: 168 QLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMV 227
            ++ YWT   P +++I +F +L   +N+  +RFYGEIE++   LK+  I   +I  LV+ 
Sbjct: 150 VVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVID 208

Query: 228 CGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGE 287
            GG+ +  LGF YW+NPGP+   ++  +    +F+G+ ++L    ++Y G + + I AGE
Sbjct: 209 LGGTKQERLGFHYWRNPGPFAEYLVGGDT--GKFVGFWAALSSVVYSYSGIQNIAILAGE 266

Query: 288 SKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQN 347
           +KN R  +      VF RI+  Y++++F + L+VPY D +L  T   +  +SPFV+A++ 
Sbjct: 267 TKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYND-KLIATGSGNARSSPFVIAMER 325

Query: 348 SGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVL 407
           +G KVLP + N +IL +  SAGN  I  GSR L+ L+    AP +F KT+K+G+P+  VL
Sbjct: 326 AGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVL 385

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
             S F  LAY++ S+++  VF W   + +      W+LIS +HI   + L+ +G SR DL
Sbjct: 386 FISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDL 445

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-EFVFSEFIADYISVFLFIVCWLGFQVL 526
           P+     P+ A+++     + +L  GF +F    F    F + Y  + L I  +  F  L
Sbjct: 446 PYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFT-FWKL 504

Query: 527 FKTRLILRKEDVDIDT---DRRE 546
           FK    LR  +VD+ +   D RE
Sbjct: 505 FKKTRYLRPHEVDLQSIFEDIRE 527

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  306 bits (783), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 186/581 (32%), Positives = 305/581 (52%), Gaps = 28/581 (4%)

Query: 4   NVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVK 63
           N   ET   G   N  S+  SE      +R + K E    + +  +   S       D+K
Sbjct: 24  NRMTETPVGGTTSNPESSFLSE-----KNRYDFKEETTSFSDDRFNSQHSYNPGSPDDIK 78

Query: 64  ---------RDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCV 114
                    +DL  RH+  +++GG IGTGLF+   + +   GP   ++ +  + T  F V
Sbjct: 79  EDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTV 138

Query: 115 TQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWT 174
             SLGE+A   PV   F +Y  RF+ P+   +    Y   W V   LEL      I+YW 
Sbjct: 139 INSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWD 198

Query: 175 FAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSE 233
             +    W+ +F+ L+  +N++ V+ +GE EF ++ +K+L+I GF I  +V+ C GG   
Sbjct: 199 DTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKG 258

Query: 234 GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 293
           G +G +YW +PG +       +    +F G  S  + AAF+Y G E++ ++A ES+NPRK
Sbjct: 259 GYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRK 313

Query: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKV 352
           T+P A  + F+ I F YI  L  VG LV Y D RL   S S D+  SP V+AI+N G K 
Sbjct: 314 TIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKG 373

Query: 353 LPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIF 412
           LPS+ N +IL+ ILS  NS +Y  SR +  ++  G  P      +K+G P  A+ T+  F
Sbjct: 374 LPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFF 433

Query: 413 GCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAK 472
           G L+++  S   ++VF WL  ++ ++  F W+ I+++HIRF Q +  +  S +++P+ ++
Sbjct: 434 GLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQ 493

Query: 473 FMPWGAYYAAFFITVIILIQGFDSFAP---EFVFSE-FIADYISVFLFIVCWLGFQVLFK 528
              +G+YY    + ++++   + S  P   +   +E F   Y+S  + I C++G ++ FK
Sbjct: 494 TGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFK 553

Query: 529 T-RLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQS 568
             R++   E++D+ T R+E+D  +    +E K   + L QS
Sbjct: 554 NWRIMTPLEEIDLLTGRKEVDIDILK--EELKIEREALRQS 592

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  305 bits (782), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 168/528 (31%), Positives = 292/528 (55%), Gaps = 15/528 (2%)

Query: 44  NQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLA 103
           N  NM   E +   D  ++ +DL  RH+  +++GG IGTGLF+   + +   GP   ++ 
Sbjct: 74  NDSNMLSKEDI---DGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIG 130

Query: 104 YLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALEL 163
           ++ + T  F V  SLGE+A   PV   F++Y  RF+ P++  +    Y   W V   LEL
Sbjct: 131 WVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLEL 190

Query: 164 SIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYA 223
                 I+YW   +    W+ +F+ ++   NM+ V+ +GE EF ++ +K+L+I GF I  
Sbjct: 191 VAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILG 250

Query: 224 LVMVC-GGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVG 282
           +V+ C GG   G +G +YW +PG +       +   ++F G  S  + AAF+Y G E++ 
Sbjct: 251 IVLSCGGGPVGGYIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIA 305

Query: 283 ITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPF 341
           ++A ES +PRKT+P A  + F+ I   Y+  L  +G LVPY DPRL   S S D+ +SP 
Sbjct: 306 VSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPL 365

Query: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401
           V+AI+N G K LPS+ N +IL+ +LS  NS +Y  SR +  ++  G  P    + +K+G 
Sbjct: 366 VIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGR 425

Query: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461
           P  A L +  FG ++++  S    +VF WL  ++ ++  F W+ I++SHIRF + +  +G
Sbjct: 426 PINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQG 485

Query: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFI 517
            S  ++P+ ++   +G++Y    + ++++   + S  P    +   + F   Y+S+ + +
Sbjct: 486 RSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILL 545

Query: 518 VCWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQK 564
            C++G +  FK  RL     ++D+D+ +R+ID  +  ++ + + L  K
Sbjct: 546 ACYVGHKFYFKNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALK 593

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  302 bits (773), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 168/481 (34%), Positives = 272/481 (56%), Gaps = 21/481 (4%)

Query: 6   ELETYPAGKQ--HNDRSAESSESSDVLHHRKETKNE-GIFINQENMSEVESLYGNDDPDV 62
            LE Y +G++   +D S +++  +D +  R   +N     ++     E  S + ++   +
Sbjct: 17  HLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPEDGSFHSDN---L 73

Query: 63  KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA 122
           K+ LK RH+ MI++GG+IGTGLF+G    + + GP+  ++ +   GT        LGE+ 
Sbjct: 74  KKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEIT 133

Query: 123 TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVW 182
              PV  +F  Y  RFL P++      +Y   WC    LE+      ++YW  +V   VW
Sbjct: 134 VRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVW 193

Query: 183 IVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYW 241
           + +F+ ++   N++ VR +GE EF  + +KV++I GF+I  +V++CGG  +   +G +YW
Sbjct: 194 VAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYW 253

Query: 242 KNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 301
            +PGP   G          F G    L+ A+++  GTE+  + +GE+ +P K +P AI +
Sbjct: 254 HDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-DP-KELPSAIKQ 301

Query: 302 VFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVI 361
           VF+RI+FF+++SL  VG LVPYT+  L     S ++ SPFV+AI+  G   LPS+ N VI
Sbjct: 302 VFWRIVFFFLVSLTLVGFLVPYTNQNL--MGGSSVDNSPFVIAIRLHGINALPSIVNAVI 359

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           LV++LS GNS I+  SR L  ++  GL P +F   ++ G P   +LT+ +FG LA+L  S
Sbjct: 360 LVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKS 419

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
            +A  VF WL+ I  +A    WL I++SHIRF   +K +G+   +L F +    +G+ Y+
Sbjct: 420 GSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYS 479

Query: 482 A 482
           A
Sbjct: 480 A 480

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  308 bits (788), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 169/537 (31%), Positives = 289/537 (53%), Gaps = 13/537 (2%)

Query: 28  DVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMG 87
           D L ++++ +  G  I  E +   +    + + ++++ +KPRH+ M+SLG  IGTGL +G
Sbjct: 126 DDLENKQQVELIGTTIQDEELLPGQK-KEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVG 184

Query: 88  IASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAA 146
            A P+  AGP   ++ Y  MGT  +C+ Q+ GEMA  +  +T SF  +    + P    A
Sbjct: 185 NAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFA 244

Query: 147 NGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEF 206
             ++Y   W     LEL      IQYWT  V   V++V+F++L+   N    + Y E EF
Sbjct: 245 VAWVYCIQWLCVCPLELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEF 304

Query: 207 WIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWV 265
                KVL I GF I A+ +  G + ++G +G +YW +PG +        K E RF G +
Sbjct: 305 IFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGAFR----GQTKIE-RFKGVM 359

Query: 266 SSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTD 325
            + + AAF +  TE + +TA E  NPRK +P A  K+ +R+L  ++ ++  +G LVPY  
Sbjct: 360 DTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDS 419

Query: 326 PRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSK 385
            +L  +  S    SP+V+AI   G +V     N VIL++++S GNS  Y  SR+L  L++
Sbjct: 420 DQLLGSGGSATKASPYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQ 479

Query: 386 SGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLL 445
            G AP +F   +++G P  A+  S++   +A+   S    +VF WL+ I  ++  F W  
Sbjct: 480 QGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFA 539

Query: 446 ISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFS- 504
           I LSH+RF + +K +G S  ++ + ++    G+ YAA  + + ++ Q + +  P    + 
Sbjct: 540 ICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTP 599

Query: 505 ---EFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDDE 557
               F ++Y+++ + IV + G+++  +  RL +R +D+D+ + R   D  +   +DE
Sbjct: 600 DANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIRAKDIDLISHRTIYDEELLRQEDE 656

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  305 bits (780), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 177/555 (31%), Positives = 293/555 (52%), Gaps = 32/555 (5%)

Query: 13  GKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLY------------GNDDP 60
           G +  D SA  S  ++V+       NEG    Q  +  V S                D+ 
Sbjct: 23  GFEVKDISATVSPETNVITASSSASNEGPATPQPQLGVVASFLDSFKRKEHDDSTAGDEN 82

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           D+ + ++ RH+ MISLG  IGTGL +G  S +  +GP+G ++ Y+    + F + Q+ GE
Sbjct: 83  DLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAAGE 142

Query: 121 MA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPL 179
           +   +  V  +FT Y    + PA G A  +LY   W +   L+L      IQ+W   V L
Sbjct: 143 LGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGVNL 202

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG---SSEGAL 236
            V+++  ++++   N+   R Y E EF+    K++ + GF+I  +++  GG     +G +
Sbjct: 203 DVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDGYI 262

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW+NPG +  G          F G  S    AAF+Y G E + ++A E KNP K++P
Sbjct: 263 GGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLKSIP 312

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            A  KV +RILF Y+LSL  V  LVPYT P L  +S S  ++SPFV+AI + G  V+P +
Sbjct: 313 SATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVVPHL 372

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+++LS  NS +Y+  R+L  L++ G AP      +K+G P    L   +FG + 
Sbjct: 373 INAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFGMIG 432

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           ++  S   + VF WLL+I+ +   F W+ I +SHIRF   ++ +G    ++ +KA+   W
Sbjct: 433 FVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQTGYW 492

Query: 477 GAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-R 530
           G+Y A      +++ Q + + AP     +   + F  +Y++  + +  +LGF+V +K  +
Sbjct: 493 GSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYKQWQ 552

Query: 531 LILRKEDVDIDTDRR 545
           L++  + +++D +R 
Sbjct: 553 LLIPADKIELDNNRN 567

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  302 bits (773), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 168/481 (34%), Positives = 272/481 (56%), Gaps = 21/481 (4%)

Query: 6   ELETYPAGKQ--HNDRSAESSESSDVLHHRKETKNE-GIFINQENMSEVESLYGNDDPDV 62
            LE Y +G++   +D S +++  +D +  R   +N     ++     E  S + ++   +
Sbjct: 17  HLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPEDGSFHSDN---L 73

Query: 63  KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA 122
           K+ LK RH+ MI++GG+IGTGLF+G    + + GP+  ++ +   GT        LGE+ 
Sbjct: 74  KKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEIT 133

Query: 123 TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVW 182
              PV  +F  Y  RFL P++      +Y   WC    LE+      ++YW  +V   VW
Sbjct: 134 VRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVW 193

Query: 183 IVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYW 241
           + +F+ ++   N++ VR +GE EF  + +KV++I GF+I  +V++CGG  +   +G +YW
Sbjct: 194 VAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYW 253

Query: 242 KNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 301
            +PGP   G          F G    L+ A+++  GTE+  + +GE+ +P K +P AI +
Sbjct: 254 HDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-DP-KELPSAIKQ 301

Query: 302 VFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVI 361
           VF+RI+FF+++SL  VG LVPYT+  L     S ++ SPFV+AI+  G   LPS+ N VI
Sbjct: 302 VFWRIVFFFLVSLTLVGFLVPYTNQNL--MGGSSVDNSPFVIAIRLHGINALPSIVNAVI 359

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           LV++LS GNS I+  SR L  ++  GL P +F   ++ G P   +LT+ +FG LA+L  S
Sbjct: 360 LVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKS 419

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
            +A  VF WL+ I  +A    WL I++SHIRF   +K +G+   +L F +    +G+ Y+
Sbjct: 420 GSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYS 479

Query: 482 A 482
           A
Sbjct: 480 A 480

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  305 bits (782), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 189/588 (32%), Positives = 316/588 (53%), Gaps = 29/588 (4%)

Query: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHR--------KETKN--EGIFINQENMS--E 50
           E+  +E++ + +   + S  S  S D L HR        +E  N  +GI    E +S  +
Sbjct: 13  EDGVVESFDSVEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHSTHERVSGED 72

Query: 51  VESLYGNDDPD---VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFM 107
            E L  +D      +K+++KPRH+ MISL   IGTG+ +G    +   GP   L+ Y  +
Sbjct: 73  FERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIV 132

Query: 108 GTIAFCVTQSLGEMAT-FIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSII 166
            T+ +CV QS  E+A  +  ++  F  Y    +  A   +  ++Y   W     LEL   
Sbjct: 133 STMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTA 192

Query: 167 GQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVM 226
              I+YW  ++    ++V+F+++L   N I    Y E EF+    KVL + GF I  +++
Sbjct: 193 SMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIV 252

Query: 227 VCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITA 285
            CGG+ ++G LG  YW +PG +       N    RF G V+ L+ AAF Y G E   +TA
Sbjct: 253 NCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTA 307

Query: 286 GESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAI 345
            E +NP+K++  A  K+ +RI+  Y+++   +G LVPY  P L  +  +  + SPFV+AI
Sbjct: 308 AEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAI 367

Query: 346 QNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYA 405
            + G KV+P + N VIL+++LS  NS +Y  SR+L  LS+ G AP LF   +++G P   
Sbjct: 368 ASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRC 427

Query: 406 VLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRN 465
           +L S +FG L ++  S   + VF WLL I+ ++  F W  ISLSH+RF + +  +G S +
Sbjct: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487

Query: 466 DLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWL 521
           +L +++    WGAYYA   I +I++ Q + + +P    +   + F  +Y+++ + I  +L
Sbjct: 488 ELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYL 547

Query: 522 GFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDD--DEPKTLLQKLW 566
           G+++ ++  R+I+   +VD+ + R+  DA +   +  +E + L    W
Sbjct: 548 GYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASW 595

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  303 bits (776), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 175/494 (35%), Positives = 276/494 (55%), Gaps = 21/494 (4%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD-VKRDL 66
            ++ A K+H    A   E   V  ++K  K        ++    E+  G+ DPD +KR L
Sbjct: 27  RSFVATKKHG---AYHYEDDQVQPNKKAYKRNLFHRCIDSFKPPEN--GSFDPDSLKRSL 81

Query: 67  KPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP 126
           K RH+ MI++GG+IGTGLF+G    + + GP+  ++ +L  GT        LGE+    P
Sbjct: 82  KSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGEITVRFP 141

Query: 127 VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVF 186
           V  +F  Y  RFL P+L      +Y   W     LE+      IQ+W  ++   VW+ +F
Sbjct: 142 VVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPVVWVAIF 201

Query: 187 WILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPG 245
           ++ + A N+  VR +GE EF  +++KV++I GF+I  +V++ GG  +   +G RYW +PG
Sbjct: 202 YVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVGARYWHDPG 261

Query: 246 PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFR 305
               G          F G  S  + A+++  G+E+  + +GE+ +P K +P AI +VF+R
Sbjct: 262 ALAHG----------FKGVASVFVTASYSLGGSEMACLASGET-DP-KELPSAIKQVFWR 309

Query: 306 ILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTI 365
           I+FF+++SL  VG LVPYT+  L     S +N SPFV+A      KVLPS+ N VILV+I
Sbjct: 310 IIFFFLVSLTLVGFLVPYTNQNL--LGGSSVNNSPFVIACNLYHIKVLPSIINAVILVSI 367

Query: 366 LSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAK 425
           +S GNS I+  SR L  ++  GL P +F   ++ G P   ++T+S+FG LA+L  S +  
Sbjct: 368 MSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSSSMS 427

Query: 426 KVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFI 485
           +VF+WL+ I  +A    WL I++SHIRF   +K +  + ++L F +    WG+ Y+A   
Sbjct: 428 EVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVYSAVVN 487

Query: 486 TVIILIQGFDSFAP 499
            +I++ Q + S  P
Sbjct: 488 VLILIAQFYISLWP 501

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  305 bits (781), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 175/537 (32%), Positives = 297/537 (55%), Gaps = 14/537 (2%)

Query: 22  ESSESSDVLHHRKETKNEGIFINQENM-SEVESLYGND-DPDVKRDLKPRHMSMISLGGT 79
           +SS++        +TK  G   N E   SE  S+   D + ++ +DL  RH+  +++GG+
Sbjct: 50  KSSDNMTTYVTDSKTKEGGSEKNIETTPSEQFSIAKEDINENLNKDLSIRHLITLAVGGS 109

Query: 80  IGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFL 139
           IG GLF+   + +   GP   ++ ++ + T  F V  +LGE+A   PV   F +Y  RF+
Sbjct: 110 IGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFV 169

Query: 140 SPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVR 199
            P++  A    Y   W V   LEL      I+YW   +    W+ +F+ ++  +NM+ V+
Sbjct: 170 DPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVK 229

Query: 200 FYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPGPWGMGMISSNKYE 258
            +GE EF ++ +K+L+I GF I  +V+ C GG   G LG  YW +PG +       +K  
Sbjct: 230 SFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSF-----VGDKPG 284

Query: 259 ARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVG 318
            +F G  S  + AAF+Y G EL  ++A ESK+PRKT+PKA  + F+ +   Y+  L  +G
Sbjct: 285 TQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIG 344

Query: 319 LLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGS 377
            LVP+ DPRL   S S D   SP V++I+N+G K L S+ N +IL++I+S  NS +Y  S
Sbjct: 345 CLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACS 404

Query: 378 RVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAV 437
           R +  ++  G  P +  + +K+G P  A+L++  FG L+++  S    +VF WL  ++ +
Sbjct: 405 RCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGL 464

Query: 438 AGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSF 497
           +  F W+ I+ SHIRF   +K +  + ++LP+ ++    G++Y    + ++++   + S 
Sbjct: 465 STIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSL 524

Query: 498 AP----EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK-EDVDIDTDRREIDA 549
            P        + F   Y+S+ + I C++G ++  +   +L K ED+D++T R+ IDA
Sbjct: 525 FPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDA 581

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  305 bits (780), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 179/552 (32%), Positives = 304/552 (55%), Gaps = 20/552 (3%)

Query: 34  KETKNEGI-FINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPI 92
           K+   E I +    ++ E +     ++  +K+ LK RH+ +I+LGGTIGTGL +G +  +
Sbjct: 41  KDKHKETIDYSETSSLDEEKQQQPEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTL 100

Query: 93  RVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-----VTSSFTMYTQRFLSPALGAAN 147
              GP G   +YL + T  + +  + GEM  ++P        S     ++++  +LG A+
Sbjct: 101 ATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFAS 160

Query: 148 GYLYWFSWCVTFALELSIIGQLIQYWTFA--VPLSVWIVVFWILLTASNMIPVRFYGEIE 205
            + Y++ + +  A E +    +++YW +A  VP   WI +F   + A NM+PV FYGE E
Sbjct: 161 SWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESE 220

Query: 206 FWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGW 264
           FW A++K+L I G +I + ++  GG  S   LGFRYW+ PG +   +  ++     FL  
Sbjct: 221 FWFASIKILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDV 278

Query: 265 VSSLIKAAFTYQ-GTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPY 323
            + +IK  F +  G ELV +T+ E  + R+ + KA  +  +R++ FY+L    + ++V Y
Sbjct: 279 YTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAY 338

Query: 324 TDPRLSTT---SDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVL 380
            DP L      S     +SPFV+ IQN+G KVLP + N  I+ +  SAGN+ ++  SR L
Sbjct: 339 NDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSL 398

Query: 381 YGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGF 440
             ++  G AP  F K N+ GVP+ AV  S +F CLAYLN+S +   VF+W   I+ ++GF
Sbjct: 399 LTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGF 458

Query: 441 FAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPE 500
             W+   +++IRF + +    +  + LP+K     +  +Y+ F +++I L  G+  F P 
Sbjct: 459 IGWICACVAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPR 517

Query: 501 F-VFSEFIADYISVFLFIVCWLGFQVLFKT--RLILRKEDVDIDTDRREIDALVWSDDDE 557
           F  + +FIA YI++ +FIV W+G +++ ++  +  +  + +D+ T   EI+ L  ++ DE
Sbjct: 518 FWDYKDFIAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEELT-NELDE 576

Query: 558 PKTLLQKLWQSF 569
            +      W  F
Sbjct: 577 KRVPPNNAWDKF 588

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  306 bits (784), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 168/495 (33%), Positives = 279/495 (56%), Gaps = 12/495 (2%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           D+ +DL  RH+  +++GG IGTGLF+   S +   GP   ++ ++ + T  F V  SLGE
Sbjct: 140 DMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGE 199

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           +A   PV   F++Y  +F+ P+   A    Y   W V   LEL      I+YW  ++   
Sbjct: 200 LAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSD 259

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFR 239
            W+ +F++ +  +NM+ V+ +GE EF ++ +K+L+I GF I  +V+ CGG  S   +G +
Sbjct: 260 AWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGK 319

Query: 240 YWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAI 299
           YW +PG + +G  S +K++    G  S  + AAF++ G E+  ++A ES+NPR+T+PKA 
Sbjct: 320 YWHDPGAF-VGTTSGSKFK----GLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAA 374

Query: 300 NKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFN 358
            + F+ I   Y+  L  VG LVPY DPRL   S S D  +SP V+AI+N     LPS+ N
Sbjct: 375 KRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMN 434

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            +IL+ ILS  NS++Y  SR +  +SK    P +F K +++G P  A+     FG L+++
Sbjct: 435 AIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFV 494

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
             S    +VF WL  ++ ++  F W+ I+L HIRF Q +  + IS ++LPF ++   WG+
Sbjct: 495 AASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGS 554

Query: 479 YYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLIL 533
            Y    + ++++   + S  P    +   + F   Y+S  + + C++  +V FK  R  +
Sbjct: 555 IYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYI 614

Query: 534 RKEDVDIDTDRREID 548
               +D+ + R+++D
Sbjct: 615 PASKMDLHSGRKQVD 629

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  304 bits (779), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 180/580 (31%), Positives = 301/580 (51%), Gaps = 32/580 (5%)

Query: 3   ENVELETYPAGK------QHNDRSAESSESSDVLHH------RKE---TKNEGIFINQEN 47
           E++ + ++  G       +    S + S+S  ++H       R E   TK   I  N  +
Sbjct: 18  ESISIRSFSGGNDFQISSREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQINENTSD 77

Query: 48  MSE-VESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLF 106
           + + +ES+    D  +K+ +K RH+ M+SLG  IGTGL +  A  +   GP   ++ Y+ 
Sbjct: 78  LEDGIESI--TSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVL 135

Query: 107 MGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
           +  + + + Q+ GEMA   P + ++F  Y+  F+S   G A  +LY F W     LEL  
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELIT 195

Query: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225
               IQYW   +   V+I++F+I L   ++  V+ YGE EF     K+L I GF+I ++V
Sbjct: 196 ASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVV 255

Query: 226 MVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGIT 284
           + CGG+  +G +G  YW NPG +     + +   ARF      L+   F++ G EL  ++
Sbjct: 256 INCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALS 310

Query: 285 AGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMA 344
             E  NPRK+ P A  +  +RI+  Y+L++  +G  VPY D +L     S  + SP+V+A
Sbjct: 311 VQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370

Query: 345 IQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFY 404
               G K++P + N VIL++++S  NS++Y G R++  LS+ G AP      +++G P  
Sbjct: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLR 430

Query: 405 AVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISR 464
           A++   IFG +A++  S   + VF WL  I  ++  F W  I LSH+RF Q +K +G S 
Sbjct: 431 ALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490

Query: 465 NDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVC 519
           ++L +KA    WG+ Y  FF  ++ + Q + + AP           F   Y++  +++  
Sbjct: 491 DELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTF 550

Query: 520 WLGFQVLFKTRLILRKED-VDIDTDRREID-ALVWSDDDE 557
           + G+ +  +   +L   D +D+D  RR  D  L+  +D E
Sbjct: 551 FFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQE 590

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  304 bits (778), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 168/514 (32%), Positives = 286/514 (55%), Gaps = 27/514 (5%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           ++K+ LK RH+ MI++GG+IGTGLF+G    +   GP+  ++ +   G+        LGE
Sbjct: 77  NLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGTIHGLGE 136

Query: 121 MATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           +    PV  +F  YT RFL P++      +Y   W     LE+      +QYW  ++   
Sbjct: 137 ITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWNDSIDPV 196

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFR 239
           V++ +F+ ++ + N+   R +GE EF  + +K+++I GF+I  +V++ GG  +   +G +
Sbjct: 197 VFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDHEYIGAK 256

Query: 240 YWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAI 299
           YW NPG    G          F G +S L+ A+++  GTE+  + +GE+ +P K +P AI
Sbjct: 257 YWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLASGET-DP-KELPSAI 304

Query: 300 NKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNG 359
            +VF+RILFF+++SL  VG LVPYT+P L     S ++ SPFV+AI+    KVLPS+ N 
Sbjct: 305 KQVFWRILFFFLVSLTLVGFLVPYTNPNL--LGGSSVDNSPFVIAIKIHNIKVLPSIVNA 362

Query: 360 VILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLN 419
           VILV+ILS GNS I+  SR L  ++   L P  F   ++ G P   ++ +S+FG LA+L 
Sbjct: 363 VILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFGLLAFLV 422

Query: 420 ISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAY 479
            S +  +VFDWL+ I  +A    WL I++ H+RF   +K +  + ++L F +    WG+ 
Sbjct: 423 KSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAVGIWGSV 482

Query: 480 YAAFFITVIILIQGFDSFAPEFVFSE-------FIADYISVFLFIVCWLGFQVLFKTRL- 531
           Y+     +I++ Q + +  P   +++       F  +Y+   + IV ++G ++ ++    
Sbjct: 483 YSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKIYYRVTTG 542

Query: 532 ----ILRKEDVDIDTDRREIDALVWSDDDEPKTL 561
                +  +D+D+DTDR+ +D  +   +   K +
Sbjct: 543 HWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKM 576

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  304 bits (779), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 185/589 (31%), Positives = 306/589 (51%), Gaps = 31/589 (5%)

Query: 2   VENVELETYPAGK--QHNDRSAESSESSDVLHHRKETKNEGIF--------INQENMSEV 51
           +EN+  E  PA +    N    ES  S+D+    +   N  +          N +     
Sbjct: 6   LENLSNEKLPATECGSSNSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSDTFDAS 65

Query: 52  ESLYG------NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           + L G        +   K+ +K RH+ M+SLG  IGTGL +     +   GP G L+ Y 
Sbjct: 66  QDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYS 125

Query: 106 FMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELS 164
            +  +A+ + Q+ GEMA   P +  +F +Y+  F+S + G A  +LY   W     LEL 
Sbjct: 126 LVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELI 185

Query: 165 IIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
                I+YW  ++    +I +F+ ++   +      YGE EF  +  KV  I GF+I ++
Sbjct: 186 TASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSI 245

Query: 225 VMVCGGSSEGALGF-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           V+ CGG+  G      YW+NPG +  G          F G    L+ A F+Y G EL  +
Sbjct: 246 VINCGGAGTGGYIGGEYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYGGMELFAL 300

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPY-TDPRLSTTSDSDINTSPFV 342
           T  E  NPRK VP A  K  +RIL  Y+L++  +G LVPY +D  + ++  S  + SP+V
Sbjct: 301 TVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYV 360

Query: 343 MAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVP 402
           +A+ + G KV+P + N VIL++++S GNS +Y   R+L  L++ G AP +F   ++ G P
Sbjct: 361 IAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRP 420

Query: 403 FYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGI 462
             A++  SIFG L+++  S   ++VF WL  I  ++  F W  I LSH+RF   +K +G 
Sbjct: 421 LVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGY 480

Query: 463 SRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFI 517
           S ++L +K+K   WG+ YA FF  ++ + Q + + AP     +     F   Y++  ++I
Sbjct: 481 SLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWI 540

Query: 518 VCWLGFQVLFKT-RLILRKEDVDIDTDRREIDA-LVWSDDDEPKTLLQK 564
            C++G+++  K  +L++  +++D+++ R   D  ++  +DDE K  L+ 
Sbjct: 541 SCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHKEKLKN 589

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  302 bits (774), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 182/559 (32%), Positives = 302/559 (54%), Gaps = 23/559 (4%)

Query: 18  DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLG 77
           D S  S E      + ++   E   ++ E   +   L+ ND   +K+ LK RH+ M++L 
Sbjct: 6   DESTNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLH-NDRTKLKQGLKERHIKMLTLV 64

Query: 78  GTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQR 137
           G  GTGLF+     ++  GPVG L+AYLF+G +  C   ++ E+A+F+P T +   + ++
Sbjct: 65  GVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQ 124

Query: 138 FLSPALGAANGYLYWFSWCVTFAL----ELSIIGQLIQYWTFAVPLSVWIVVFWILLTAS 193
           F+  ++G      + F W  T++     ELS    +++YWT   P +V+I VF IL   +
Sbjct: 125 FIDESVG------FTFGWISTYSSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVT 177

Query: 194 NMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSS-EGALGFRYWKNPGPWGMGMI 252
           N+  +RFYGE+E+    LK++ IF  +I  LV+  GG+  +  LGF YW+ PGP+   ++
Sbjct: 178 NIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANYLV 237

Query: 253 SSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYIL 312
               +  +F+G+ +++    ++Y G + + I AGE+KN R  +      VF RI+  Y++
Sbjct: 238 GG--HIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLV 295

Query: 313 SLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSN 372
           ++F + L+VPY D +L  T      +SPFV+A+  +G KVLP + N +IL +  SAGN  
Sbjct: 296 TVFILTLIVPYND-KLIATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLA 354

Query: 373 IYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLL 432
           I  GSR L+ L+    AP +F +T+K+G+P+  V+  S F  LAY++ S+++  VF W  
Sbjct: 355 IIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQ 414

Query: 433 TITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQ 492
            + +      W+LIS +HI   + LK +G SR+DLP+     P+ A+++     + +L  
Sbjct: 415 ELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTG 474

Query: 493 GFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALV 551
           GF +F    F    F   Y  + L I  +  F  LFK    LR  +VD+++   +I    
Sbjct: 475 GFYNFIHGHFDIESFFTRYFIIPLAIGLFT-FWKLFKKTKYLRPHEVDLESIFDDIK--- 530

Query: 552 WSDDDEPKTLLQKLWQSFS 570
             ++ E     +  W  FS
Sbjct: 531 --ENPEHIVKTKNAWARFS 547

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  303 bits (777), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 167/515 (32%), Positives = 292/515 (56%), Gaps = 15/515 (2%)

Query: 44  NQENMSEVESLYGN---DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGS 100
            ++  S++ES  G    ++ D+K+ +K RH+ +ISLG  IGTGL +G A  +R AGP G 
Sbjct: 96  EKQTTSDLESGLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGL 155

Query: 101 LLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTF 159
           ++ Y  MG+  +C+ Q+ GE+A  +  + S+F +Y    +  A G A  ++Y   W    
Sbjct: 156 VIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVC 215

Query: 160 ALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGF 219
            LEL      I+YWT +V   +++ +F++L+   N    R Y E EF+  + KVL + GF
Sbjct: 216 PLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGF 275

Query: 220 LIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGT 278
            I  +++ CGG+ + G +G +YW +PG +     + N+    F G +++   AAF +  +
Sbjct: 276 FILGIIITCGGAGTSGYIGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGAS 330

Query: 279 ELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT 338
           E + +TA E  NPRK +PKA   + +RILF ++ S+  +G LVPY  P L  +       
Sbjct: 331 EFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKA 390

Query: 339 SPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNK 398
           SP+V+A+ + G +V+P   N VIL+++LS GNS  Y  SR+L  L++ G AP +F   +K
Sbjct: 391 SPYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDK 450

Query: 399 QGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLK 458
           +G P  A++ S++F  +A+   S   ++VF WLL I+ ++  F W+ I +SH+RF + LK
Sbjct: 451 RGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALK 510

Query: 459 DRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVF 514
            +G S  ++ FK++   +G+ YAA  + + ++ Q + + AP          F  +Y+++ 
Sbjct: 511 VQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMP 570

Query: 515 LFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
           + +V + G+++  +  +  +    +D+ + R+  D
Sbjct: 571 ILLVLYFGYKIRKRDWKFWIPAHRIDLVSHRKVFD 605

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  303 bits (777), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 169/504 (33%), Positives = 281/504 (55%), Gaps = 13/504 (2%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           ++KRD+  RHM  +++G  +GTGL +G AS +  AGP G L+ Y  MGT  +CV Q+ GE
Sbjct: 116 ELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGE 175

Query: 121 MA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPL 179
           +  T+  +   F  Y    ++P+   + G++Y   W     LEL      I+YWT  V  
Sbjct: 176 LGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTKVDP 235

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSS-EGALGF 238
            V++V+F++L+   N    + Y E +F+   +K+  I GF I  +V+ CGG+  +G LG 
Sbjct: 236 DVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGG 295

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           +YW NPG +        K    F G  S  + +AF + G+E V ++A E  NPRK++P A
Sbjct: 296 KYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSA 350

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
              + +RI++ Y+ S+  +G LVP+  P+L  +SD    TSP+V+AI   G KV+P + N
Sbjct: 351 AKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGK-KTSPYVVAIAMHGVKVVPHLIN 409

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            VIL+ +LS  NS  +  SR+L  LS+ G AP  F   +++G P  A+L S++FG + + 
Sbjct: 410 AVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFC 469

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
             S+    VF WLL I+ ++  F +  I +SHIR    +K +G S  +L F+++   +G+
Sbjct: 470 ATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGS 529

Query: 479 YYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLIL 533
           +YA   + + ++ + + + AP    +     F  +Y++  + IV + G+ +  K  R+ +
Sbjct: 530 FYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFI 589

Query: 534 RKEDVDIDTDRREIDALVWSDDDE 557
           R +D+D+D  R+  D  +   +DE
Sbjct: 590 RSKDIDLDFKRQVFDEDLIKQEDE 613

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  304 bits (778), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 170/501 (33%), Positives = 286/501 (57%), Gaps = 15/501 (2%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
           N   ++K+ +KPRH+ MISLG  IGTGL +G+ S +  AGP G LL +  MGT  +C+ Q
Sbjct: 144 NKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQ 203

Query: 117 SLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175
           ++GEMA  +  +   F  Y    + PA G +  ++Y   W     LEL      I+YWT 
Sbjct: 204 AVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTT 263

Query: 176 AVPLSVWIVVFWILLTASNMIP-VRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SE 233
            V   V++++F++L+ A N++     Y E EF   + K+L + GF I  ++++CGG+ ++
Sbjct: 264 KVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGND 323

Query: 234 GALGFRYWKNPGPW-GMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPR 292
           G +G +YW  PG + G   I       RF G +++L+ AAF +  +E +G+TA E  NPR
Sbjct: 324 GYIGGKYWHEPGAFRGEHAID------RFKGVMATLVNAAFAFGMSEFIGVTASEQSNPR 377

Query: 293 KTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKV 352
           K +P A  K+ +RI+  ++ S+  VG LVPY   +L  +S   +  SP+V+A+   G KV
Sbjct: 378 KAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKV 437

Query: 353 LPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIF 412
           +P   N VIL+++LS  NS  Y  SR+L  L++ G AP +F   +++G P   +  +S+F
Sbjct: 438 VPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLF 497

Query: 413 GCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAK 472
           G +A+   S    +VF WLL I+ ++  F W+ I +SH+RF + +  +G S  +L F+++
Sbjct: 498 GVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQ 557

Query: 473 FMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFK 528
              WG+ YAA  +  I++ Q + + AP    +     F  +Y+++ + +  + G+++  K
Sbjct: 558 VGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTK 617

Query: 529 T-RLILRKEDVDIDTDRREID 548
              + +R +D+D+ + R   D
Sbjct: 618 NWTIFIRAKDIDLVSHRNIFD 638

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  300 bits (769), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 180/515 (34%), Positives = 286/515 (55%), Gaps = 16/515 (3%)

Query: 20  SAESSESSDVLHHRKET--KNEGIFINQENMSEVE--SLYGNDDPDVKRDLKPRHMSMIS 75
           SAE + S       K++  + E I ++  N++E E  ++     P +K  LK RH+ MI+
Sbjct: 42  SAEEAGSGSKWQDFKDSFKRVEPIAVD-PNLTEAEKVAIVTAQTP-LKHHLKNRHLQMIA 99

Query: 76  LGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYT 135
           +GG IGTGL +G  + +R  GP   L+ +   GT+ + +  +LGE+A   P++  FT Y 
Sbjct: 100 IGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYA 159

Query: 136 QRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFAVPLSVWIVVFWILLTASN 194
            RF+  + G AN + Y   W V   LE+      + +W T       ++ +FW+++   N
Sbjct: 160 TRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWVVIVIIN 219

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGF-RYWKNPGPWGMGMIS 253
           M  V+ YGE EF  + +KV+++ GF+I  +++ CGG  EG     +YW +PG +     +
Sbjct: 220 MFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----A 274

Query: 254 SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313
            +   A+F G  S  + +AF++ G+ELVG+ A ES  PRK+VPKA  +VF+RI  FYILS
Sbjct: 275 GDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILS 334

Query: 314 LFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNI 373
           L  +GLLVPY D  L   S  D   SPFV+AI+  G K LPSV N VIL+ +LS GNS I
Sbjct: 335 LLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAI 394

Query: 374 YIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLT 433
           Y  SR +  L++    P +F   +++G P   +  +S FG +A++  S+    VF+WLL 
Sbjct: 395 YACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLA 454

Query: 434 ITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQG 493
           ++ ++  F W  I + HIRF + L  +G   ++L FK+    WG+Y+  F + ++ + Q 
Sbjct: 455 LSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQF 514

Query: 494 FDSFAP---EFVFSEFIADYISVFLFIVCWLGFQV 525
           + +  P         F   Y+S  L +  ++G ++
Sbjct: 515 YVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKI 549

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 186/571 (32%), Positives = 308/571 (53%), Gaps = 36/571 (6%)

Query: 14  KQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDP-DVKRDLKPRHMS 72
           K HN+ + ES + S +L+   E +   + + +   S    + G+ DP ++KR LK RH+ 
Sbjct: 31  KSHNEYTYESGKCS-LLNGSTEERKRNV-VQRVIDSFKPPVDGSFDPSNMKRALKSRHLI 88

Query: 73  MISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFT 132
           MI++G +IGTGLF+G    +   GP+  ++ +   GT        LGE+   +PV  +F 
Sbjct: 89  MIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGELTVRLPVVGAFA 148

Query: 133 MYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLI--QYWTFAVPLSVWIVVFWILL 190
            Y+ RFL P++      +Y   W   F L L II   I  ++WT +V   +W+ +F+ ++
Sbjct: 149 DYSTRFLDPSVSFVISSIYVMQW--FFVLPLEIIASCITMRFWTQSVDPIIWVALFYTMI 206

Query: 191 TASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGM 249
            + N++ VR +GE EF  +++KV++I GF+I  +V++ GG  +   +G RYW +PGP   
Sbjct: 207 VSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPGPLAN 266

Query: 250 GMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFF 309
           G          F G  + ++ A+++  G+E+  + +GE+ +P K +P AI ++F+RILFF
Sbjct: 267 G----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KELPHAIKQIFWRILFF 314

Query: 310 YILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAG 369
           +++SL  VG LVPYT+  L   S ++   SPFV+A+     KV+P + NGVILV+ILS G
Sbjct: 315 FLVSLTLVGFLVPYTNENLLGGSSAE--NSPFVLALYLHHVKVVPHIVNGVILVSILSVG 372

Query: 370 NSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFD 429
           NS I+  SR L  ++  GL P +F   ++ G P   +L +SIFG LA+L    +   VF 
Sbjct: 373 NSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFS 432

Query: 430 WLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVII 489
           WL+ I  +A    WL I++SH+RF   +K +  S ++L F +    WG+ YA     + +
Sbjct: 433 WLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTL 492

Query: 490 LIQGFDSFAP-------EFVFSEFIADYISVFLFIVCWLGFQVLFKTRL-----ILRKED 537
           + Q + +  P       +     F  +Y+   + I  +   +  F+        I +  +
Sbjct: 493 VAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTGKWWGIKKLSE 552

Query: 538 VDIDTDRREIDALVWSDD--DEPKTLLQKLW 566
           VD+DT R  ID  +  ++  +  K L  K W
Sbjct: 553 VDLDTGRVNIDIEIIKEEVAERKKFLRNKAW 583

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  301 bits (771), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 170/532 (31%), Positives = 286/532 (53%), Gaps = 19/532 (3%)

Query: 32  HRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASP 91
            R++T   G   + E       +   D   +++ ++ RH+ M+SLG  IGTGL +  A+ 
Sbjct: 40  RREDTSRSGDLEDGE-------INSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAAS 92

Query: 92  IRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYL 150
           +   GP G L+ YL +  +++ +  + GEMA   P +  +F  Y+  F+S   G A  +L
Sbjct: 93  LHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWL 152

Query: 151 YWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAA 210
           +   W   F LEL     +I+YW  +V  +V++V+F++ +   +    R YGE EF    
Sbjct: 153 FCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNM 212

Query: 211 LKVLSIFGFLIYALVMVCGGSSE-GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLI 269
            KVL I GF+I  +++  G   + G +G RYW+NPG +    +S    + +  G    L+
Sbjct: 213 CKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSF----VSGTPLD-KLKGTAYVLV 267

Query: 270 KAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLS 329
            A F++ G EL  ++  E  NP+  +P A  K  +RIL  Y+L++  +G LVP+   RL 
Sbjct: 268 TAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLM 327

Query: 330 TTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLA 389
            +  +D++ SP+V+AI+  G KVLP + N VIL++++S GNS +Y   R+L  L++ G A
Sbjct: 328 GSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387

Query: 390 PSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLS 449
           P      +++G P  +++  +IFG +A+   S N +K+F WL  I  ++  F W  I LS
Sbjct: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447

Query: 450 HIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSE 505
           H RF Q +K +G S   L ++A    WG+ YA FF  ++ + Q + +  P    +     
Sbjct: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLS 507

Query: 506 FIADYISVFLFIVCWLGFQVLFKTRLILRKED-VDIDTDRREIDALVWSDDD 556
           F  +Y++  L+++ +LG+ V  +   +L   D +D+DT RR  D  V   ++
Sbjct: 508 FFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  301 bits (771), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 166/506 (32%), Positives = 270/506 (53%), Gaps = 11/506 (2%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
           N D  +K+ +K RH+ M++LG  IGTGL +  A  +   GP   ++ Y  +  + + + Q
Sbjct: 86  NTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQ 145

Query: 117 SLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175
           + GEMA   P +  +F  Y   F+S   G A  +L+   W     LEL     +I+YWT 
Sbjct: 146 AAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTE 205

Query: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEG 234
            V   V++V+F++ L   + I V+ YGE EF     K+L I GF+I+++V+ CGG+  +G
Sbjct: 206 KVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDG 265

Query: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294
            +G +YW +PG +      +N  E RF G    L+   F+Y GTEL  ++  E +NPRK+
Sbjct: 266 YIGGKYWHSPGAFA----GTNAAE-RFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKS 320

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLP 354
            P A  +  +RIL  Y+L++  +G  VP+ D +L     S  + SP+V+A    G +V+P
Sbjct: 321 TPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVVP 380

Query: 355 SVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGC 414
            + N VIL+ ++S  NS++Y   R+L  L++ G AP      +++G P YA+L  ++FG 
Sbjct: 381 HIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGV 440

Query: 415 LAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM 474
           +A+   S   ++VF WL  I  ++  F W  I LSH+RF Q +K +G   N++ + A   
Sbjct: 441 IAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTG 500

Query: 475 PWGAYYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKTRL 531
            WG+ Y   F  ++ + Q + + AP         F   Y++  ++I  + G+ +  K   
Sbjct: 501 YWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDYT 560

Query: 532 ILRKED-VDIDTDRREIDALVWSDDD 556
            L   D +D+D  RR  D  V   +D
Sbjct: 561 FLNPLDKIDLDHHRRIYDPEVLKQED 586

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  300 bits (769), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 167/545 (30%), Positives = 287/545 (52%), Gaps = 25/545 (4%)

Query: 15  QHNDRSAESSESSDVLHHRKETKNE-----GIFINQENMSEVESLYGNDDPDVKRDLKPR 69
           +  D  +E         ++ + +NE       F  Q   S+   L   +  ++ + +K R
Sbjct: 38  EKQDEESEQQVKPQKTGNKSKLQNECKKILSSFKRQLPPSQNSELESQEKNNLTKSIKSR 97

Query: 70  HMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVT 128
           H+ MISLG  IGTGL +G    +  AGP G +L Y     + +C+ Q+ GE+   +  +T
Sbjct: 98  HLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAGLT 157

Query: 129 SSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWI 188
            ++T Y    + P+LG A   +Y   W     L+L      ++YWT +V   +++ V +I
Sbjct: 158 GNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-SVNSDIFVAVVFI 216

Query: 189 LLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYWKNPGPW 247
            +   N+   R Y E EF     K+L + GF+I A+++ CGG+ +   +G  YW NPGP+
Sbjct: 217 FVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPGPF 276

Query: 248 GMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRIL 307
             G          F G  +    AAF+Y G E++ ++A E +NP K++P A  KV +RIL
Sbjct: 277 AHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRIL 326

Query: 308 FFYILSLFFVGLLVPY-TDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTIL 366
             Y+L+   V  LVPY +D  L +   S  + SPFV+A+ + G KV+P   N VIL++++
Sbjct: 327 LIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVPHFINAVILISVI 386

Query: 367 SAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKK 426
           S  NS++Y G R+L  L++ G+ P      +++G P    L S  FGC+ ++  S   ++
Sbjct: 387 SVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFVATSDAEEE 446

Query: 427 VFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFIT 486
           VF WLL I++++  F W+ +SLSHIRF   +  +G S N++ +KA+   WG++ A     
Sbjct: 447 VFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAV 506

Query: 487 VIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDI 540
             ++ Q + + AP     +     F  +Y+++ + +V + G ++ FK+    +  + +D+
Sbjct: 507 FFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKSWSFWIPADKIDL 566

Query: 541 DTDRR 545
           ++ R 
Sbjct: 567 NSHRN 571

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  299 bits (765), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 182/518 (35%), Positives = 284/518 (54%), Gaps = 31/518 (5%)

Query: 32  HRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASP 91
           H  E+     F  + N+ E          D+KRDL PRH++MIS+ G IGTGL++  +  
Sbjct: 48  HSLESIESASFDPESNIRE----------DLKRDLSPRHINMISIAGVIGTGLYLSTSKS 97

Query: 92  IRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLY 151
           + V GP    + Y   G + +     LGEM+T++P++ SF  Y ++F S +   A  + Y
Sbjct: 98  LHVGGPASLFMNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNY 157

Query: 152 WFSWCVTFALELSIIGQLIQYWT---FAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWI 208
           WF+  V+ A +L+ +  ++ YW       P     ++FW+ +   N+I VR YGE E+W+
Sbjct: 158 WFNDAVSVASDLTALQLVLDYWKTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWL 217

Query: 209 AALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYWKN-PGPWGMGMISSNKYEARFLGWVS 266
           A LKV++I  F I ++V+  G + E   +GF  W +   P+  G          F G+ S
Sbjct: 218 ALLKVIAIIIFFILSIVVNVGHNPEHKYIGFHNWNHGDAPFVNG----------FKGFAS 267

Query: 267 SLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDP 326
             + A+F Y GTE + +T GE+ NP +  PK I  VF+RIL FY+ S FF+ + VPY  P
Sbjct: 268 LFVSASFAYGGTESITLTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYP 327

Query: 327 RLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKS 386
            L+T S   + TSPF +  Q +G+K   S  N VI+ +++SA N  ++ GSRV+Y +S  
Sbjct: 328 GLATKS---VMTSPFTIVFQMAGSKGAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLD 384

Query: 387 GLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLI 446
           G  P    KTN+   P+ AV  +   G L +      A  V+ WL  I  V+   AWL I
Sbjct: 385 GYLPKWVTKTNRYKAPYVAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCI 444

Query: 447 SLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEF 506
           +++ IRF + L+ +G   ++L FK    PWG Y+   F++ +ILIQG+ +F P +  S F
Sbjct: 445 AITSIRFRRGLELQG-KTHELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDP-WSTSNF 502

Query: 507 IADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDR 544
            + Y+ +F+F  C+L +  L+K    ++ ED+D  TD+
Sbjct: 503 FSVYLELFVFPACYLIWW-LYKRDKFIKYEDMDFVTDK 539

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  296 bits (758), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 172/508 (33%), Positives = 285/508 (56%), Gaps = 31/508 (6%)

Query: 21  AESSESSDVLHHRKETKNEGIFINQENMSEVESLYG----------NDDPDVKRDLKPRH 70
           +ES E+S +   + ++K     I + N+ E E   G          ND   +K+ LK RH
Sbjct: 2   SESGEASGLSQEKVKSK-----ICETNVDEQELECGSETAKQGVLYNDRTRLKQGLKERH 56

Query: 71  MSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSS 130
           + M++L G  GTGLF+     ++  GPVG L+AYLF+G +  C   ++ E+A+F+P T +
Sbjct: 57  IKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGA 116

Query: 131 FTMYTQRFLSPALGAANGYLYWFSWCVTFAL----ELSIIGQLIQYWTFAVPLSVWIVVF 186
              + ++F+  ++G      + F W  T++     ELS    +++YWT   P +V+I VF
Sbjct: 117 TIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMKYWTDVSP-AVFITVF 169

Query: 187 WILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG-SSEGALGFRYWKNPG 245
            +L  A+N+  +RFYGEIE+    LK++ IF  +I  LV+  GG   +  LGF YW++PG
Sbjct: 170 GVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPG 229

Query: 246 PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFR 305
           P+   +++   +  +F+G+ +++    ++Y G + + I AGE+KN R  +      VF R
Sbjct: 230 PFANYLVAG--HIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLR 287

Query: 306 ILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTI 365
           I+  Y++++F + L+VPY D +L  T      +SPFV+A+  +G KVLP + N +IL + 
Sbjct: 288 IIVLYLVTVFVLTLIVPYND-KLIATGTGTAKSSPFVIAMNRAGIKVLPHIVNALILTSA 346

Query: 366 LSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAK 425
            SAGN  I  GSR L+ L+    AP +F KT+K+G+P+  V+  S F  LAY++ S+++ 
Sbjct: 347 WSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSA 406

Query: 426 KVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFI 485
            VF W   + +      W+LIS +HI   + LK +G SR+DLP   +  P+ A+++    
Sbjct: 407 TVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMS 466

Query: 486 TVIILIQGFDSFAP-EFVFSEFIADYIS 512
            + +   GF +F    F    F+ D +S
Sbjct: 467 VIFLFTGGFYNFMHGHFDIESFLLDTLS 494

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  301 bits (770), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 179/572 (31%), Positives = 300/572 (52%), Gaps = 20/572 (3%)

Query: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMS----EVESL---YGNDDP 60
           ET  A     D +A  + S     +  E K   + I  + +      V+S      +++ 
Sbjct: 89  ETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENA 148

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
            +K+ +KPRH+ M+SLG  IGTGL +G  +P+  AGP   ++ Y  MGT  +C+ Q+ GE
Sbjct: 149 QLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGE 208

Query: 121 MA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPL 179
           +A  +  V  SF  +    + P    A  ++Y   W     LEL      I+YWT  V  
Sbjct: 209 LAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP 268

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGF 238
            V++V+F++L+   N    + Y E EF+    KV+ + GF I A+ +  G + ++G +G 
Sbjct: 269 DVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           +YW +PG +        K E RF G + + + AAF +  TE + +TA E  NPRK +P A
Sbjct: 329 KYWNDPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSA 383

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
             KV +RIL  ++ S+  +G LVPY   +L  +S    + SP+V+A    G  V+    N
Sbjct: 384 AKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFIN 443

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            VIL+++LS  NS  Y  SR+L GL++ G AP  F   ++ G P  ++L ++I   +A+ 
Sbjct: 444 AVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFC 503

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
             S     VF WLL I+ ++  F W  I +SHIRF + ++ +G S  +L F+A+    G+
Sbjct: 504 ATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGS 563

Query: 479 YYAAFFITVIILIQGFDSFAPEFVFS----EFIADYISVFLFIVCWLGFQVLFKT-RLIL 533
           YYAA  + + ++ Q + +  P    +     F  +Y+++ + +  ++GF++  +  RL +
Sbjct: 564 YYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFI 623

Query: 534 RKEDVDIDTDRREID-ALVWSDDDEPKTLLQK 564
           R +++D+ + R   D  L+  +D+E K  L+ 
Sbjct: 624 RAKNIDLISHRIIFDEELLRQEDEEYKEKLRN 655

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  298 bits (762), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 176/504 (34%), Positives = 288/504 (57%), Gaps = 32/504 (6%)

Query: 57  NDDPD---------VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFM 107
           +DDP+         + R L PRH++MI++ G IGTGLF+  A  +   GP   L+ Y+ M
Sbjct: 48  SDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIM 107

Query: 108 GTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIG 167
           G + +    SLGEM+TF+P++ S+  Y+++F+S +   A     W+S  V+ A +L+ + 
Sbjct: 108 GGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQ 167

Query: 168 QLIQYW---TFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
            ++ YW   T   P     ++FW L+   N++ V+ YGE E+W+A LKV+++  F I A+
Sbjct: 168 LVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAI 227

Query: 225 VMVCGGSSEGA-LGFRYWKN-PGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVG 282
           +  CG + +   +GF+ W +   P+  G          F G+V+  + ++F+Y GTE V 
Sbjct: 228 IANCGHNQQHEYIGFKNWSHGDAPFVQG----------FKGFVTIFVTSSFSYGGTETVT 277

Query: 283 ITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFV 342
           +T GE+KNP +  PK I  VF+RIL FY+ ++FFVG+ +PY  P L T S   + TSPF 
Sbjct: 278 LTGGEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKS---VLTSPFT 334

Query: 343 MAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAP--SLFKKTNKQG 400
           +  Q +GTK   S  N VI+ + +SA N  ++ GSR+LY +   G  P    F KTN+  
Sbjct: 335 IVFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNK 394

Query: 401 VPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDR 460
            P+ AV+T+   G L +      A ++F WL  I  V+   +WL I++  IRF + L+ +
Sbjct: 395 APYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQ 454

Query: 461 GISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCW 520
           G   ++L F+    P+G ++   FI++IIL+QG+ +F P +  S F + Y+ + +F  CW
Sbjct: 455 G-KVHELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVFPACW 512

Query: 521 LGFQVLFKTRLILRKEDVDIDTDR 544
           + + V+ + R   + +D+D  TD+
Sbjct: 513 IFWWVIKRDRF-KKAKDMDFITDK 535

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  299 bits (765), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 168/544 (30%), Positives = 290/544 (53%), Gaps = 16/544 (2%)

Query: 33  RKETKNEGIFINQENMSEVESLYGN--DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIAS 90
           R E     I    EN S++E    +   D  +K+ +K RH+ M+SLG  IGTGL +  A 
Sbjct: 60  RAEGSTTKIKPINENTSDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAK 119

Query: 91  PIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGY 149
            +   GP   ++ Y+ +  I + + Q+ GEMA   P + ++F  Y+  F+S   G A  +
Sbjct: 120 GLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVW 179

Query: 150 LYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIA 209
           LY F W     LEL      IQ+W   +   ++I++F++ L   +   V+ YGE EF   
Sbjct: 180 LYCFQWTTVLPLELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFN 239

Query: 210 ALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSL 268
             K+L I GF++ ++V+ CGG+ ++G +G  YW  PG +     + +   ARF      L
Sbjct: 240 CCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYIL 294

Query: 269 IKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL 328
           + A F++ G EL  ++  E  NPRK+ P A  +  +RI+  Y+L++  +G  VPY D +L
Sbjct: 295 VTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQL 354

Query: 329 STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGL 388
                S  + SP+V+A    G +++P + N VIL++++S  NS++Y G R++  L++ G 
Sbjct: 355 LGAGGSATHASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGY 414

Query: 389 APSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISL 448
           AP      +++G P  A++   + G +A++  S   + VF WL  I  ++  F W  I L
Sbjct: 415 APKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIML 474

Query: 449 SHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVF 503
           SH+RF Q +K +G S N+L +KA    WG+ Y +FF  ++ + Q + + AP     +   
Sbjct: 475 SHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNA 534

Query: 504 SEFIADYISVFLFIVCWLGFQVLFKTRLILRKED-VDIDTDRREID-ALVWSDDDEPKTL 561
             F   Y++  ++++ ++G+ +  +   +L   D +D+D  RR  D  L+  +D+E K  
Sbjct: 535 EAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENKEK 594

Query: 562 LQKL 565
           ++ +
Sbjct: 595 IKNM 598

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  296 bits (759), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 190/529 (35%), Positives = 291/529 (55%), Gaps = 38/529 (7%)

Query: 34  KETKNEGIFINQENMS---EVESLYG-----NDDPDVKRDLKPRHMSMISLGGTIGTGLF 85
           K T  + I I  EN S   E  SL G     N    + R L PRH++MI++ G IGTGL+
Sbjct: 11  KVTPEQYISIADENYSSDLEQPSLEGLTTDNNVREHLNRSLSPRHVNMIAIAGVIGTGLY 70

Query: 86  MGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGA 145
           +G    + + GP   L+ Y  +G I +    SLGEM+T++P++ SF  + ++F S +   
Sbjct: 71  LGTGRALHLGGPASLLINYSIIGLIVYATLLSLGEMSTYMPISGSFCSFAKKFGSESFAF 130

Query: 146 ANGYLYWFSWCVTFALELSIIGQLIQYW-TFAVPLSVWI--VVFWILLTASNMIPVRFYG 202
           A    YWF+  V+ A +L+ +  ++ YW T       WI  ++FW+ L   N+I V+ YG
Sbjct: 131 ALMCNYWFNDAVSVASDLTALQLVLDYWKTSESGFPYWIASLIFWVFLLFLNVIHVKIYG 190

Query: 203 EIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYW-KNPGPWGMGMISSNKYEAR 260
           E E+W+A LKV++I  F I ++V   G + +   +GFR W +   P+  G          
Sbjct: 191 EAEYWLAMLKVIAIIIFFILSIVANVGHNEQHEYIGFRNWTRGDAPFVNG---------- 240

Query: 261 FLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLL 320
           F G+ +  + A+F Y GTE + +T+GE+KNP +  PK I  VF+RIL FYI ++FF+G+ 
Sbjct: 241 FRGFATLFVSASFAYGGTESITLTSGETKNPVRNTPKVIKTVFWRILIFYIFTVFFIGMN 300

Query: 321 VPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVL 380
           VPY  P LS  S   + TSPF +  Q  G+K   S  N VIL +++SA N  ++ GSR+L
Sbjct: 301 VPYDYPNLSEKS---VMTSPFTIVFQMVGSKAAGSFMNAVILTSVVSACNHALFAGSRIL 357

Query: 381 YGLSKSG-LAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAG 439
           + L   G   P L  +TN   VP+ AVL +   G L + +    A  ++ WL  +  V+ 
Sbjct: 358 FNLGLEGYFFPKLVTRTNWYQVPYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQNLVGVSN 417

Query: 440 FFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM----PWGAYYAAFFITVIILIQGFD 495
             AWL I +  IRF      RG+SR     + KF+    P+G Y+    ++ IIL+QG+ 
Sbjct: 418 QIAWLSIGVISIRF-----RRGLSRQGKTHELKFVNWTYPYGPYFVIISVSFIILVQGWS 472

Query: 496 SFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDR 544
           S +P  V + F + Y+ +F+F+ CWL +   FK    +R++D+D  TD+
Sbjct: 473 SSSPMDV-TSFFSYYVELFIFLACWLVWWA-FKRDGFVREKDMDFVTDK 519

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  298 bits (762), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 160/512 (31%), Positives = 281/512 (54%), Gaps = 14/512 (2%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +K ++K RH++MISLG  IGTGL +     +   GP G ++ Y+   T+ +CV Q+  E+
Sbjct: 68  LKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127

Query: 122 A-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
              +  +  ++  Y    +    G A   +Y   W     LEL      ++YWT +V   
Sbjct: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPD 187

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRY 240
           V++ +F++ L   +    R Y E EF   +LKVL + GF+I A+ +  G S +G +G +Y
Sbjct: 188 VFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQY 247

Query: 241 WKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAIN 300
           W +PG +G      ++   RF G  S  ++AAF Y G+E + +TA E  NPR++VPKA  
Sbjct: 248 WHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATK 302

Query: 301 KVFFRILFFYILSLFFVGLLVPY-TDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNG 359
           +  +R++  ++L +  +G LVP+ +D  LS    S    SPFV+A    G +V+P + N 
Sbjct: 303 RWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINF 362

Query: 360 VILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLN 419
           +IL +++S GNS +Y   R+L  L++ G+ P +F   ++QG P   ++  S+FG +A++ 
Sbjct: 363 IILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVA 422

Query: 420 ISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAY 479
            S   + VF WL  I  ++  F W  I++SH+RF + ++ +G S  +L ++A     G+Y
Sbjct: 423 ASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSY 482

Query: 480 YAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLIL 533
           YA FF  ++++ Q + + AP     E     F  +Y++  + +V +LG+++  +  RL++
Sbjct: 483 YAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVI 542

Query: 534 RKEDVDIDTDRREID-ALVWSDDDEPKTLLQK 564
              +VD+ + R+  D  ++  ++ E K  L+ 
Sbjct: 543 PSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  298 bits (763), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 172/579 (29%), Positives = 299/579 (51%), Gaps = 27/579 (4%)

Query: 1   MVENVELETYPAGKQHN-DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDD 59
           M +  E E   +  + N + S  +S S +V  H +E+++  +    ++    ES    DD
Sbjct: 11  MEKTAEFEVTDSALRDNFNTSTAASFSPEVKEHSEESRSGLVHRFVDSFRRAESQRLEDD 70

Query: 60  PDV-------------KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLF 106
            D+             K+ +K RH+ M+SLG  IGTGL +  A  +++AGP   ++ Y+ 
Sbjct: 71  NDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVL 130

Query: 107 MGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
           +  + + + Q+ GEM    P +  +F  Y   F+S + G A  +L+   W     LEL  
Sbjct: 131 VSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELIT 190

Query: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225
               I+YW   +   V+I +F++ L   +   V+ YGE EF   + K+L I GF+I +++
Sbjct: 191 SSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVI 250

Query: 226 MVCGGSS-EGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGIT 284
           + CGG+  +G +G  YW+NPG +  G  ++     RF G    L+ A F++ G EL  ++
Sbjct: 251 INCGGAGVDGYIGGEYWRNPGSFADGSSAT-----RFKGICFILVTAYFSFGGIELFVLS 305

Query: 285 AGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMA 344
             E  NPRK+ P A  +  +RIL  Y+L++  +G  VP+ + +L  +  S  + SP+V+A
Sbjct: 306 INEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVLA 365

Query: 345 IQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFY 404
               G KV+P + N VIL++++S  NS +Y   R++  L++ G AP      +++G P  
Sbjct: 366 ASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLR 425

Query: 405 AVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISR 464
           A++  S  G + ++  S   ++ F WL  I  ++  F W  I LSHIRF + +K +G S 
Sbjct: 426 ALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSL 485

Query: 465 NDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVC 519
           +++ +K+    WG+YY   F  ++ + Q + + +P     +     F   Y++  L+I  
Sbjct: 486 DEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFM 545

Query: 520 WLGFQVLFKTRLILRKED-VDIDTDRREIDALVWSDDDE 557
           +LG+ +  K   +L   D +D+D  RR  D  +   +DE
Sbjct: 546 YLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDE 584

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  299 bits (765), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 176/549 (32%), Positives = 301/549 (54%), Gaps = 13/549 (2%)

Query: 16  HNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMIS 75
            ND +   S +S ++H   + + +   +     +E   +   +  D+++ +KPRH+ MIS
Sbjct: 77  ENDITTSISHAS-LVHAVSKAREDDEIMQSVASAEHRKVNNTESDDLQKTIKPRHVIMIS 135

Query: 76  LGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT-FIPVTSSFTMY 134
           LG  IGTGL +G +S +  AGP   ++ Y  MG+  +C+ Q+ GEMA  +  +   F  Y
Sbjct: 136 LGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNY 195

Query: 135 TQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASN 194
               L PALG +  ++Y   W     LEL      I+YWT  V   V++++F++L+ + N
Sbjct: 196 PSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTKVDPDVFVIIFYVLIISIN 255

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMIS 253
           +   R Y E EF+    KVL + GF I  +++  GG+ ++G LG +YW  PG +      
Sbjct: 256 VFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAF-----R 310

Query: 254 SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313
                 RF G + + + AAF +  TE + +TA E  NPRK +P A  KV +RI+  +++S
Sbjct: 311 GEHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVS 370

Query: 314 LFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNI 373
           +  +G LVPY   +L  +S S +  SP+V+A+   G +V+P   N VIL+++LS GNS  
Sbjct: 371 IIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAF 430

Query: 374 YIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLT 433
           Y  SR+L  LS+ G AP  F   ++QG P  A+L S++FG +A+   S     VF+WLL 
Sbjct: 431 YSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLA 490

Query: 434 ITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQG 493
           I+ ++  F W  I +SH+RF   +K +G S  ++ F ++   +G+ YAA  + + ++ Q 
Sbjct: 491 ISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMILALMAQF 550

Query: 494 FDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
           + + AP    +     F   Y+++ + I  + G+++ ++  +L ++ + +D+ + R+  D
Sbjct: 551 WVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQIFD 610

Query: 549 ALVWSDDDE 557
             +   +DE
Sbjct: 611 ENILKQEDE 619

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  297 bits (761), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 166/522 (31%), Positives = 280/522 (53%), Gaps = 12/522 (2%)

Query: 45  QENMSEVESL-YGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLA 103
           ++  S++E +   + D  +K+ +K RH+ M++LG  +GTGL +  A  +   GP   ++ 
Sbjct: 48  EDEKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIG 107

Query: 104 YLFMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALE 162
           Y+ +  + + + Q+ GEMA   P +  SF  YT  F+S  +G A  +L+   W     LE
Sbjct: 108 YILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLE 167

Query: 163 LSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIY 222
           L      IQYW  ++   VWIV+F++ L   ++  V+ YGE+EF     K+L I GF+I+
Sbjct: 168 LITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIF 227

Query: 223 ALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281
           ++V+  GG+ ++G +G +YWKNPG +     +S+    RF      L+ A F+Y GTEL 
Sbjct: 228 SIVVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELY 282

Query: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPF 341
            ++  E  NPR++ PKA  +  +RIL  Y+L++  +G  VP+ + +L     S  + SP+
Sbjct: 283 VLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPY 342

Query: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401
           V+A    G KV+P + N VIL+ + S GNS++Y   R+   L++ G AP      +++G 
Sbjct: 343 VLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGR 402

Query: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461
           P  A+   ++ G +A+   S   ++VF WL  I A++  F W  I LSHIRF   +K +G
Sbjct: 403 PIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQG 462

Query: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIV 518
              N+L +KA    WG+ +   F  ++ + Q + + +P         F   Y++  L++ 
Sbjct: 463 KDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWLF 522

Query: 519 CWLGFQVLFKTRLILRK-EDVDIDTDRREIDALVWSDDDEPK 559
            +  + +  +    L K ED+D+D  RR  D      +DE +
Sbjct: 523 FYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEER 564

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  298 bits (762), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 170/585 (29%), Positives = 306/585 (52%), Gaps = 28/585 (4%)

Query: 3   ENVELETYPAGKQHN-DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD 61
           +N E E   +   +N + S  +S S +V  H +E++N  +    ++    ES +  DD D
Sbjct: 13  KNAEFEVTDSALYNNFNTSTTASLSQEVKEHSEESRNGLVHRFVDSFKRAESQHLEDDND 72

Query: 62  V-------------KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMG 108
           +             K+ +K RH+ M+SLG  IGTGL +  A  +++AGP   ++ Y+ + 
Sbjct: 73  LEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVS 132

Query: 109 TIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIG 167
            + + + Q+ GEM    P +  +F  Y   F+S + G A  +++   W     LEL    
Sbjct: 133 FVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSS 192

Query: 168 QLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMV 227
             I+YW   +   V+IV+F++ L   +   V+ YGE EF  ++ K+L I GF+I ++V+ 
Sbjct: 193 MTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVIN 252

Query: 228 CGGSS-EGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAG 286
           CGG+  +G +G +YW++PG +  G  ++     RF G    L+ A F++ G EL  ++  
Sbjct: 253 CGGAGVDGYIGGKYWRDPGSFAEGNGAT-----RFKGICFILVTAYFSFGGIELFVLSIN 307

Query: 287 ESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQ 346
           E  NPRK+ P A  +  +RIL  Y+L++  +G  VP+ + +L  +  +  + SP+V+A  
Sbjct: 308 EQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAAS 367

Query: 347 NSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAV 406
               +V+P + N VIL++++S  NS +Y   R++  L++ G AP      +++G P  A+
Sbjct: 368 IHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRAL 427

Query: 407 LTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRND 466
               + G + ++  S   ++ F WL  I  ++  F W  I LSHIRF + +K +G S ++
Sbjct: 428 FVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDE 487

Query: 467 LPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWL 521
           + +KA    WG+YY  FF  ++ + Q + + +P     +     F   Y++  L++  +L
Sbjct: 488 VGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYL 547

Query: 522 GFQVLFKTRLILRKED-VDIDTDRREID-ALVWSDDDEPKTLLQK 564
           G+ +  +    L   D +D+D  RR  D  ++  +++E K  L+ 
Sbjct: 548 GYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEENKERLKN 592

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  298 bits (763), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 177/556 (31%), Positives = 304/556 (54%), Gaps = 18/556 (3%)

Query: 13  GKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYG------NDDPDVKRDL 66
           G + N      + S ++ ++   +   G   +  +++  E+  G      +  P + +DL
Sbjct: 41  GDEKNGFMGAGTTSYEMYNYSNSSTGAGGKGDSHSLTRDEAGSGVMKEDVDGHPQMNKDL 100

Query: 67  KPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP 126
             RH+  +++GG IGTGLF+   + +   GP   ++ ++ + T  F V  SLGE+A   P
Sbjct: 101 DVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGELAAAFP 160

Query: 127 VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVF 186
           V   F +Y  RF+ P+ G A    Y   W V   LEL      I+YW   +    W+ +F
Sbjct: 161 VVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIF 220

Query: 187 WILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVC-GGSSEGALGFRYWKNPG 245
           +  +  +NM+ V+ +GE EF ++ +K+L+I GF I  +V+ C GG   G +G +YW +PG
Sbjct: 221 YAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGKYWHDPG 280

Query: 246 PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFR 305
            + +G  S  K++    G  S  + AAF+Y G EL  ++A ES NPR+T+PKA  + F+ 
Sbjct: 281 AF-VGETSGTKFK----GLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAAKRTFWL 335

Query: 306 ILFFYILSLFFVGLLVPYTDPRLSTTSDS-DINTSPFVMAIQNSGTKVLPSVFNGVILVT 364
           I   Y+  L  +G LVPY +P+L   S S D  +SP V+AI+N G + LPS+ N +IL+ 
Sbjct: 336 ITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMNAIILIA 395

Query: 365 ILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNA 424
           I+S  NS +Y  SR +  +++    P    + +++G P  A L +  FG L+++  S   
Sbjct: 396 IVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAASDKQ 455

Query: 425 KKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFF 484
           ++VF WL  ++ ++  FAW+ I+LSHIRF Q +  +GIS ++LP+ +     G++Y    
Sbjct: 456 EEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIV 515

Query: 485 ITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQV-LFKTRLILRKEDVD 539
           + ++++   + S  P        + F   Y+S  + IVC++G ++ + K RL++   D+D
Sbjct: 516 LFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLIDVADMD 575

Query: 540 IDTDRREIDALVWSDD 555
           + +DR+ +D  V  ++
Sbjct: 576 LVSDRKVVDVEVCREE 591

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  297 bits (761), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 163/528 (30%), Positives = 282/528 (53%), Gaps = 14/528 (2%)

Query: 37  KNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAG 96
           + EG   N  ++ + E +       +K+++K RH+ ++SLG  IGTGL +  AS +   G
Sbjct: 47  RVEGEVRNSSDLEDGE-VTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGG 105

Query: 97  PVGSLLAYLFMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSW 155
           P G L+ Y F+  I++ + Q+ GEMA   P +  +F  Y+  F+S   G A  +L+   W
Sbjct: 106 PGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQW 165

Query: 156 CVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLS 215
                LEL     +++YWT  +   +++++F++ +   +    R YGE EF   + KVL 
Sbjct: 166 TTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLM 225

Query: 216 IFGFLIYALVMVCGG-SSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFT 274
           + GF+I  +++ CG    +G +G +YW  PG +  G         RF G    L+ A F+
Sbjct: 226 VAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTAYFS 280

Query: 275 YQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDS 334
           Y G EL  ++  E  NPRK +P A  K  +RIL  Y+L++  +G LVP+   +L  +  S
Sbjct: 281 YGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSS 340

Query: 335 DINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFK 394
            ++ SP+V+A+   G K++P + N VIL++++S GNS +Y G R+L  L++ G AP +  
Sbjct: 341 GVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILD 400

Query: 395 KTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFM 454
             ++QG P  A++  S+FG +A++  S+  + +F WL  I+ ++  F W  I LSH RF 
Sbjct: 401 YVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFR 460

Query: 455 QVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIAD 509
           + +K +G S   L +++    WG+ YA  F   +++ Q + +  P     +F        
Sbjct: 461 RAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKS 520

Query: 510 YISVFLFIVCWLGFQVLFKTRLILRK-EDVDIDTDRREIDALVWSDDD 556
            +++ L++   +G+ ++ K   IL     + +D+ RR  D  V   +D
Sbjct: 521 CLALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQED 568

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  298 bits (763), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 165/509 (32%), Positives = 280/509 (55%), Gaps = 23/509 (4%)

Query: 46  ENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           +  SE+ES   N+   +++ +K RH+ MISLG  IGTGL +G    +  AGP G +L Y 
Sbjct: 77  DQNSELESQEKNN---LRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYG 133

Query: 106 FMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELS 164
               + +C+ Q+ GE+   +  +T ++T Y+   + P+LG A   +Y   W     L+L 
Sbjct: 134 IASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLV 193

Query: 165 IIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
                ++YWT  V   +++ V +I +   N+   R Y E EF     K+L + GF+I A+
Sbjct: 194 TAAMTVKYWT-NVNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAI 252

Query: 225 VMVCGGSSEGA-LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           V+ CGG+ +   +G  YW NPGP+  G          F G  +    AAF+Y G E++ +
Sbjct: 253 VINCGGAGDRRYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLL 302

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPY-TDPRLSTTSDSDINTSPFV 342
           +A E +NP +++P A  KV +RIL  Y+L+   +G LVPY +D  L + S S  + SPFV
Sbjct: 303 SAAEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFV 362

Query: 343 MAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVP 402
           +A+ + G KV+P   N VIL++++S  NS++Y G R+L  L++ G+ P      ++ G P
Sbjct: 363 IAVSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRP 422

Query: 403 FYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGI 462
               L S  FGC+ ++  S   ++VF WLL I++++  F W+ + LSHIRF   +  +G 
Sbjct: 423 LLCFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGR 482

Query: 463 SRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFI 517
           S +++ +KA+   WG++ A       ++ Q + + AP     +     F  +Y+++ + +
Sbjct: 483 SMDEVGYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVL 542

Query: 518 VCWLGFQVLFKT-RLILRKEDVDIDTDRR 545
           + + G ++ FK+ R  +  E +D+D+ R 
Sbjct: 543 LAYFGHKMYFKSWRFWIPAEKIDLDSHRN 571

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  298 bits (762), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 167/561 (29%), Positives = 290/561 (51%), Gaps = 21/561 (3%)

Query: 12  AGKQHNDRSAESSESSDVLHH------RKETKNEGIFINQENMSEVESLYGN--DDPDVK 63
           +     + S +++ ++ ++H       R E          EN S++E    +   D  +K
Sbjct: 33  SSSSEKNYSGQTTRNNKLIHRFVDSFKRAEGSTTHTKQINENTSDLEGDVNSFTSDSKLK 92

Query: 64  RDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMAT 123
           + +K RH+ M++LG  IGTGL +  A  +   GP   ++ Y  +  + + + Q+ GEMA 
Sbjct: 93  KSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAV 152

Query: 124 FIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVW 182
             P + ++F  Y+  F+S   G A  ++Y F W     LEL      I++W   +   ++
Sbjct: 153 TYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWNDTINPDIF 212

Query: 183 IVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYW 241
           I++F++ L   +   V+ YGE EF     K+L I GF+I ++V+ CGG+ ++G +G +YW
Sbjct: 213 ILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYW 272

Query: 242 KNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 301
           +NPG +     + +    RF      L+ A F++ G EL  ++  E  NPRKT P A  +
Sbjct: 273 RNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKR 327

Query: 302 VFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVI 361
             +RIL  Y+L++  +G  VPY D +L     S  + SP+V+A    G KV+P + N VI
Sbjct: 328 SIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKVVPHIINAVI 387

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           L++++S  NS++Y G R++  L++ G  P      +++G P  A++  S+FG + ++  S
Sbjct: 388 LISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAAS 447

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
              + VF WL  I  ++  F W  I LSH+RF Q +K +G S ++L +KA    WG+ Y 
Sbjct: 448 SKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYG 507

Query: 482 AFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKE 536
            FF  ++ + Q + + AP     +     F   Y++  ++I  +LG+ +  +    L   
Sbjct: 508 VFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRDFTFLNPL 567

Query: 537 D-VDIDTDRREIDALVWSDDD 556
           D +D+D  R   D  +   +D
Sbjct: 568 DKIDLDFHRHIYDPELMRQED 588

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  297 bits (760), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 175/573 (30%), Positives = 299/573 (52%), Gaps = 32/573 (5%)

Query: 6   ELETYP-----AGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDP 60
           + E YP       + H +R  +S +       R E  + GI + ++  + ++S     D 
Sbjct: 29  KFEPYPDTTAVKHRTHFNRFVDSFK-------RAEVNHNGIDL-EDGTNSIQS-----DD 75

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           ++K+ +K RH+ M+SLG  IGTGL +  A  + +AGP   ++ Y  +  I + V Q+ GE
Sbjct: 76  NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGE 135

Query: 121 MATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPL 179
           MA   P +   F  Y   F+S   G A  +L+   W     LEL      I+YW   +  
Sbjct: 136 MAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINA 195

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSS-EGALGF 238
            V++V+ ++ L   +   VR YGE EF   + K+L I GF+I ++V+ CGG+  +G +G 
Sbjct: 196 DVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGG 255

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           +YW++PG +     +S+   +RF G    L+ A F+Y G EL  ++  E +NPR++ P A
Sbjct: 256 KYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAA 310

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358
             +  +RIL  Y+L++  +G  VP+   +L     S  + SP+V+A+   G KV+P + N
Sbjct: 311 AKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIIN 370

Query: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418
            VIL+++ S  NS +Y   R+L  L++ G AP  F   +++G P  A++  SIFG +A+ 
Sbjct: 371 AVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFC 430

Query: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478
             S   + +F WL  I  ++  F W  I LSH+RF   +K +G S N+L + +    WG+
Sbjct: 431 ACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIWGS 490

Query: 479 YYAAFFITVIILIQGFDSFAPE-----FVFSEFIADYISVFLFIVCWLGFQVLFKTRLIL 533
            Y  FF  ++ + Q + + +P      +    F   Y++  +++  +LG+ +  +    L
Sbjct: 491 LYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFL 550

Query: 534 RK-EDVDIDTDRREID-ALVWSDDDEPKTLLQK 564
              + +D+D  RR  D  L+  +D+E K  ++ 
Sbjct: 551 TDLKKIDLDNHRRLYDPELLRQEDEETKERIRN 583

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  296 bits (759), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 182/496 (36%), Positives = 283/496 (57%), Gaps = 16/496 (3%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           +  +KR LK RH+ MI +GG IGTGLF+G    +  AGP G L+ +   GT+ +C+  ++
Sbjct: 73  NAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 119 GEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFAV 177
           GE+A   PV   +T Y  RF+  + G A   +Y   W +T  LE+      + YW T A 
Sbjct: 133 GELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAK 192

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALG 237
               ++ +F++++   N+  V+ YGE EF  + +KV+++ GF+I  +++VCGG  +G   
Sbjct: 193 YRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYI 252

Query: 238 F-RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
             R W NPG +  G          F G  S  + AAF++ G+ELVG+ A E+ NPRK++P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIP 302

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
            A  +VF+RI  FYIL+L  VGLLVPYT  RL   S  D   SPFV++IQN+G K LPSV
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSV 362

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+ +LS GN  ++  SR +  L+  G  P +F   ++ G P   ++ + +FG L+
Sbjct: 363 INVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLS 422

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           ++  S    +VFDWLL ++ ++  F W  I L HIR  + L  +  +  +L F A    W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVW 482

Query: 477 GAYYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLI 532
           G+ Y+   I +I++ Q + +  P   +   + F   Y+S  ++IV ++G ++  K  +L 
Sbjct: 483 GSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLF 542

Query: 533 LRKEDVDIDTDRREID 548
           ++  D+DID+ RRE D
Sbjct: 543 IKASDIDIDSGRRETD 558

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  296 bits (759), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 165/545 (30%), Positives = 290/545 (53%), Gaps = 19/545 (3%)

Query: 34  KETKNEGIFINQENMSE-VESLYGND----DPDVKRDLKPRHMSMISLGGTIGTGLFMGI 88
           K  + +G  I +E +   +E++  ND       +K+ +K RH++MISLG  IGTGL +  
Sbjct: 43  KRAEPQGQTIREEKLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVAN 102

Query: 89  ASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAAN 147
              +   GP G ++ Y+   T+ +CV Q+  E+  ++  +  ++  Y    +      A 
Sbjct: 103 GKALHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAV 162

Query: 148 GYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFW 207
            ++Y   W +   LEL      I+YW  ++   V++ +F+  +   +    + Y E EF 
Sbjct: 163 AWVYGLQWAIVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFI 222

Query: 208 IAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSS 267
             + KVL + GF+I  + + CG S  G +G +YW  PG +        K    F G  S 
Sbjct: 223 FNSCKVLMMVGFIIMGISVNCGASKSGYIGGKYWHTPGAF-----VGEKAIDHFKGICSV 277

Query: 268 LIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPR 327
            +++AF Y G+E + +TA E  NPRK+VPKA  +  +R+L  ++  +  VG LVPY  P 
Sbjct: 278 WVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPL 337

Query: 328 L-STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKS 386
           L  +   +  + SPFV+A  + G KV+P + N VIL++++S GNS  Y   R+L  L++ 
Sbjct: 338 LLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQ 397

Query: 387 GLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLI 446
           G+ P +F   +++G P   +L  +IFG ++++  S N + VF WL  I +++  F W  I
Sbjct: 398 GMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAI 457

Query: 447 SLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EF 501
           SLSHIRF   +K +G S  +L +KA    WG++YA  F  +++  Q + + AP     + 
Sbjct: 458 SLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKL 517

Query: 502 VFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREIDA-LVWSDDDEPK 559
             + F  +Y++  + +  + G+++ ++  +L +  + VD+++ R+  DA L+  +D E K
Sbjct: 518 DVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLFIPADKVDLESHRKIFDADLIKQEDFEHK 577

Query: 560 TLLQK 564
             ++ 
Sbjct: 578 ERIRN 582

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  298 bits (763), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 162/502 (32%), Positives = 276/502 (54%), Gaps = 12/502 (2%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
            +D  +++ ++PRH+ M SL   +GTGL +G  S +  AGP G ++ Y  MGT  +C+ Q
Sbjct: 122 EEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQ 181

Query: 117 SLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175
           + GEMA ++  +  +F  Y    +    G A  ++Y   W     LEL      I YWT 
Sbjct: 182 ACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTT 241

Query: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEG 234
            V   +++V+F++L+   N+   + Y E +F+    KVL I GF I A+++  GG+ + G
Sbjct: 242 KVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSG 301

Query: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294
            +G +YW +PG +       ++   RF   +++   AAF +  +E + I A E  NPR+ 
Sbjct: 302 YIGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRA 356

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLP 354
           +P A   + +RILF ++ S+  VG LVPY    L  +       SP+V+AI + G +V+P
Sbjct: 357 IPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVP 416

Query: 355 SVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGC 414
              N VIL+ +LS  NS  Y   R+L+ LS+ G AP  F   +++G P  A++ S +FG 
Sbjct: 417 HFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGI 476

Query: 415 LAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM 474
           +A+   S   ++VF WLL I+ ++  F W+ I LSHIRF + +  +G S ++L F+++  
Sbjct: 477 IAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLG 536

Query: 475 PWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT- 529
            WG+ YAA  + + ++ + + S AP          F  +Y+++ + IV + G+++  +  
Sbjct: 537 VWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDW 596

Query: 530 RLILRKEDVDIDTDRREIDALV 551
           +L +R +++D+ T R   DA +
Sbjct: 597 KLFIRAKNIDLITHRNIFDAEI 618

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  296 bits (759), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 177/590 (30%), Positives = 309/590 (52%), Gaps = 29/590 (4%)

Query: 1   MVENVELETYPAGKQHN-DRSAESSESSDVLHHRKETKNEGI--FINQENMSEVESLYGN 57
           M +N E E   +   +N + S  +S S +V  H +E++N  +  F++    +E + L  N
Sbjct: 11  MEKNTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESRNGLVHRFVDSFRRAESQCLEEN 70

Query: 58  DDPD-----------VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLF 106
           +D +           +K+ +K RH+ M+SLG  IGTGL +  A  +++AGP   ++ Y+ 
Sbjct: 71  NDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVL 130

Query: 107 MGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
           +  I + + Q+ GEM   +  +  +F  Y   F+S + G A  +L+   W     LEL  
Sbjct: 131 VSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELIT 190

Query: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225
               I+YW  ++   V+IV+F++ L   +   V+ YGE EF   + K+L + GF+I ++V
Sbjct: 191 SSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVV 250

Query: 226 MVCGGSS-EGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGIT 284
           + CGG+  +G +G +YW++PG +  G   SN    RF G    L+ A F++ G EL  ++
Sbjct: 251 INCGGAGVDGYIGGKYWRDPGSFADG---SNA--TRFKGICFILVTAYFSFGGIELFVLS 305

Query: 285 AGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMA 344
             E  N RK+ P A  +  +RIL  Y+L++  +G  VP+ + +L  +  +  + SP+V+A
Sbjct: 306 INEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLA 365

Query: 345 IQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFY 404
                 +V+P + N VIL++++S  NS +Y   R++  L++ G AP      +++G P  
Sbjct: 366 ASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLR 425

Query: 405 AVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISR 464
           A+   ++ G + ++  S   ++ F WL  I  ++  F W  I LSHIRF + +K +G S 
Sbjct: 426 ALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSL 485

Query: 465 NDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVC 519
            +L +KA    WG+YY  FF  ++ + Q + + +P     +     F   Y++  L+I  
Sbjct: 486 GELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFM 545

Query: 520 WLGFQVLFKTRLILRKED-VDIDTDRREIDALVWSDDDEPKTLLQKLWQS 568
           +LG+ +  K   +L   D +D+D  RR  D  +   +DE     +KL  S
Sbjct: 546 YLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENK--EKLRNS 593

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  298 bits (763), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 175/542 (32%), Positives = 295/542 (54%), Gaps = 17/542 (3%)

Query: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSE-VESLYGNDDPDVKRDLKPRHMSMIS 75
           N  +A    S++V  + K  KNE I+   +++ +   S+  ++D   K  +K RH+ M++
Sbjct: 110 NIDTAYDMNSNEVDPNNK--KNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMT 167

Query: 76  LGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-VTSSFTMY 134
           L   IGTGL +  A  +  +GP G ++ Y  +  + + V Q+ GEMA   P +   F  Y
Sbjct: 168 LATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTY 227

Query: 135 TQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASN 194
              F+S   G A  +++  +W     LEL      ++YWT ++   +++++F++ L   +
Sbjct: 228 QSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVH 287

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMIS 253
            I +R Y E EF+  + K+L I GF+I+++V+ CGG+  +G +G +YW +PGP+     +
Sbjct: 288 FIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF-----A 342

Query: 254 SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313
           S+   ARF      LI A F+Y GTEL  ++  E +NPRK VP A     +R+   Y+L+
Sbjct: 343 SDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLT 402

Query: 314 LFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNI 373
           +  +G  VPY  P L   ++S  + SP+V+A Q  G K++P   N VIL++++S  NS +
Sbjct: 403 MILIGFNVPYNSPDLMGNANSK-DASPYVLAAQIHGVKIVPHFINAVILLSVISVANSAL 461

Query: 374 YIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLT 433
           + G R+L  L++ G AP      ++ G P  A+   S+FG +A+   S+   +VF WL  
Sbjct: 462 FAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAA 521

Query: 434 ITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQG 493
           I  ++  FAW  I LSHIRF   +K  G S +++ +KA    WG+YY  FF  ++++ Q 
Sbjct: 522 IAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQF 581

Query: 494 FDSF-AP----EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK-EDVDIDTDRREI 547
           + +  AP    +     F   Y++  +++  +L + +  K   IL   +D+D+D  RR  
Sbjct: 582 WVALSAPGSGGQVTAISFFESYLAFVIWVFFYLCYMIYNKDWTILIPLKDIDVDYQRRIY 641

Query: 548 DA 549
           DA
Sbjct: 642 DA 643

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  295 bits (756), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 179/540 (33%), Positives = 300/540 (55%), Gaps = 31/540 (5%)

Query: 24  SESSDVLHHRKETKNEGIFINQEN--MSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIG 81
           S+ +++   +KE KN+ I     +     ++  Y +D+  +KR LK RH+ MI++GG+IG
Sbjct: 32  SKETEIDLDKKEDKNKNIVRRMIDSFKPPLDGSYHSDN--LKRKLKSRHLIMIAIGGSIG 89

Query: 82  TGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSP 141
           TGLF+G    +   GP+  ++ +   G+        LGE+    PV  +F  Y+ R L P
Sbjct: 90  TGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVVGAFANYSTRLLDP 149

Query: 142 ALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFY 201
           ++      +Y   W     +EL      +Q+WT  V   VW+ +F++++ + N+  V+ +
Sbjct: 150 SISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVF 209

Query: 202 GEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYWKNPGPWGMGMISSNKYEAR 260
           GE EF  + +KV++I GF+I +++++CGG  +   +G  YW +PG    G          
Sbjct: 210 GEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANG---------- 259

Query: 261 FLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLL 320
           F G  S  + A+++  G+E+V + + E+ +P K +P AI +VF+RI+FF+++SL  VG L
Sbjct: 260 FKGVASVFVTASYSLGGSEMVCLCSAET-DP-KELPHAIKQVFWRIVFFFLVSLTLVGFL 317

Query: 321 VPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVL 380
           VPYT+  L     S +N SPFV+AI+ SG +VLPS+ N VIL++ILS GNS I+  SR L
Sbjct: 318 VPYTNENL--LGGSSVNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFASSRTL 375

Query: 381 YGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGF 440
             ++  GL P +F   ++ G P   ++ +S+FG LA+L  S +   VFDWL+ I  +A  
Sbjct: 376 CSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATC 435

Query: 441 FAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP- 499
             WL I++SHIRF   +K +  S ++L FK+    +G+ Y+A    +I++ Q + S  P 
Sbjct: 436 VVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPV 495

Query: 500 ----------EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK-EDVDIDTDRREID 548
                     E  F  ++   + VF+F+   + F+         +   ++D++TDR+ ID
Sbjct: 496 GGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNID 555

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  296 bits (757), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 180/595 (30%), Positives = 301/595 (50%), Gaps = 37/595 (6%)

Query: 2   VENVELETYPAGKQHNDR-----SAESSESSDVLHHRKETKNE-----GIFINQENMSEV 51
           +E  E+ +    K  +D      S+  SES  +        NE     G F+N    +E 
Sbjct: 1   MERSEIHSMSEIKDSDDSAQPVLSSVKSESGSIGQEWNAWDNENRNAWGRFVNSFKRAEK 60

Query: 52  ESLYGNDDPD------------VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVG 99
            S   N D +            +KR +KPRH++M+S+   IGTGL +     +R  GP G
Sbjct: 61  HSTPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAG 120

Query: 100 SLLAYLFMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVT 158
            ++ Y  +  +A+ + Q+ GEMA   P +  +F  Y+ + +S   G A  +LY   W   
Sbjct: 121 LIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTV 180

Query: 159 FALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFG 218
             LEL      I+YW  ++   V+I +F++ +   +    R YGE EF     KVL I G
Sbjct: 181 LPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIG 240

Query: 219 FLIYALVMVCGGSSEGA-LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQG 277
           F+I ++V+ CGG+ +   +G +YW +PG + +G  ++     +F G    L+   F+Y G
Sbjct: 241 FVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGAT-----KFKGVAYVLVTGYFSYGG 295

Query: 278 TELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL-STTSDSDI 336
           TEL  +T  E  NPR+ +     +  +RIL  Y+L++  +G LVP+T   L  ++  S  
Sbjct: 296 TELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSAT 355

Query: 337 NTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKT 396
           + SP+V+A+   G K++P + N VIL+ ++S GNS +Y G R+L  L++ G AP      
Sbjct: 356 HASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYV 415

Query: 397 NKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQV 456
           ++ G P  A++  S+FG LA++  S   + VF WL  I  ++  F W  I LSH+RF Q 
Sbjct: 416 DRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQA 475

Query: 457 LKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYI 511
           ++      ++L +KA     G+     F  ++ + Q + S AP     +     F   Y+
Sbjct: 476 MRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYL 535

Query: 512 SVFLFIVCWLGFQVLFKTRLILRK-EDVDIDTDRREIDA-LVWSDDDEPKTLLQK 564
           +  L++V + G+ ++F+   I++  +D+D+D  R   D   ++ +D E K L+Q 
Sbjct: 536 AFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLEHKILIQN 590

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  294 bits (752), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 176/494 (35%), Positives = 279/494 (56%), Gaps = 20/494 (4%)

Query: 56  GNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
            N   D++R LKPRH++MIS+ G IGTGL++  A  +   GP    + Y  MG + +   
Sbjct: 48  ANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTL 107

Query: 116 QSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-T 174
             LGEM+T++P++ SF  Y ++F S +   A  + YWF+  V+ A +++ +  ++ YW T
Sbjct: 108 LCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDT 167

Query: 175 FAVPLSVWIV--VFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSS 232
            A     W    +FW L+   N+I VRFYGE E+W+A LKV++I  F I ++V+  G + 
Sbjct: 168 EASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNP 227

Query: 233 EGA-LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNP 291
           +   +GF+ W +             +   F G+ S  + A+F Y GTE + +T GE+ NP
Sbjct: 228 QHEYIGFKNWNH---------GEAPFVDGFKGFASLFVSASFAYGGTESITLTNGEAANP 278

Query: 292 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTK 351
            +  PK +  VF+RIL FY+ S FF+ + +PY  P L T S   + TSPF +  Q +GTK
Sbjct: 279 LRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDTKS---VVTSPFTLVFQMAGTK 335

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAP-SLFKKTNKQGVPFYAVLTSS 410
              S  N VI+ +++SA N  ++ GSRV+Y +   G  P  +  +TN+  VP+ +VL +S
Sbjct: 336 AAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITS 395

Query: 411 IFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFK 470
             G L +      A  V+ WL  I  V+   AWL I ++ IRF + L+ +G   ++L +K
Sbjct: 396 SIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQG-KTHELRYK 454

Query: 471 AKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTR 530
               P+G Y+   F+T IIL+QG+ +F P  V + F + Y+ +F+F  C++ +  L+K  
Sbjct: 455 NWTYPYGPYFLVIFVTFIILVQGWSAFDPWDV-TNFFSYYLDLFVFPFCFIIWW-LYKRD 512

Query: 531 LILRKEDVDIDTDR 544
             ++ ED+D  TDR
Sbjct: 513 RFVKLEDMDFVTDR 526

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  295 bits (754), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 168/579 (29%), Positives = 305/579 (52%), Gaps = 27/579 (4%)

Query: 1   MVENVELETYPAGKQHN-DRSAESSESSDVLHHRKETKNEGI--FINQENMSEVESLYGN 57
           M ++ E E   +   +N + S  +S + ++  H +E++N  +  F++    +E + L  +
Sbjct: 11  MEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFRRAESQRLEED 70

Query: 58  DDPD-----------VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLF 106
           +D +           +K+ +K RH+ M+SLG  IGTGL +  A  + +AGP   ++ Y+ 
Sbjct: 71  NDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVM 130

Query: 107 MGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165
           +  + + + Q+ GEM    P +  +F  Y   F+S + G A  +L+   W     LEL  
Sbjct: 131 VSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELIT 190

Query: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225
               ++YW   +   V+IV+F++ L   +   V+ YGE EF   + K+L + GF+I ++V
Sbjct: 191 SSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVV 250

Query: 226 MVCGGSS-EGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGIT 284
           + CGG+  +G +G +YW++PG +  G  ++     RF G    L+ A F++ G EL  ++
Sbjct: 251 INCGGAGVDGYIGGKYWRDPGSFAEGSGAT-----RFKGICYILVSAYFSFGGIELFVLS 305

Query: 285 AGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMA 344
             E  NPRK+ P A  +  +RIL  Y+L++  +G  VP+ + +L  +  S  + SP+V+A
Sbjct: 306 INEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLA 365

Query: 345 IQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFY 404
                 +V+P + N VIL++++S  NS +Y   R++  L++ G AP      +++G P  
Sbjct: 366 ASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLR 425

Query: 405 AVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISR 464
           A++  S+ G + ++  S   ++ F WL  I  ++  F W  I LSHIRF + +K +G S 
Sbjct: 426 ALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSL 485

Query: 465 NDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVC 519
           +++ +KA    WG+YY  FF  ++ + Q + + +P     +     F   Y++  L+I  
Sbjct: 486 DEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFM 545

Query: 520 WLGFQVLFKTRLILRKED-VDIDTDRREIDALVWSDDDE 557
           ++G+ V  +    L   D +D+D  RR  D  +   +DE
Sbjct: 546 YVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDE 584

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  293 bits (750), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 186/537 (34%), Positives = 292/537 (54%), Gaps = 37/537 (6%)

Query: 20  SAESSESSDVLHHR--KETKNE--GIFINQEN--MSEVESLYGND--DPD--VKRDLKPR 69
           S E + + +V+ +R  K+  NE   + ++ +N   +E +SL   D  DPD  VKR LK R
Sbjct: 4   SYELNHTGEVVSNRGLKDAYNEVTEMEVDPKNNEYAEEQSLNREDTFDPDSGVKRQLKDR 63

Query: 70  HMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTS 129
           H+S+++LGG IG G  +G  + + + GP+  LL +  +G +AF + +S+GEM T  P   
Sbjct: 64  HISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGG 123

Query: 130 SFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWIL 189
            FT  T+RF S AL A  GY Y   +    A E + +  ++Q+W   VPL  +I++FW  
Sbjct: 124 GFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAA 183

Query: 190 LTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG-SSEGALGFRYWKNPGPWG 248
                ++ V  +GE E+W+A  K+L +  + I+++V + GG  +  A GF+YW +PG   
Sbjct: 184 FQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALS 243

Query: 249 MGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILF 308
            G          F G  +  +  +  Y GTE V + A ESKNPR+ VP AI + F+RIL 
Sbjct: 244 NG----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILI 293

Query: 309 FYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSA 368
            Y+    F G+ VPY D  L+    + +  SP  +AI  +G      + N  IL+T +SA
Sbjct: 294 VYLGISIFYGVTVPYNDENLNFA--TKVLKSPIAIAISRAGWPAGVHLVNAFILITCISA 351

Query: 369 GNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVF 428
            N ++YIGSR L  L+  GLAP L   T+++GVP  A+   +  G ++ +N+S  A   +
Sbjct: 352 INGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAY 411

Query: 429 DWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVI 488
           ++++ ++ V  F  W +ISL+H+RF +  K +G +R++LP+KAK  P       F I  I
Sbjct: 412 NYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFP------VFPIVSI 465

Query: 489 I------LIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVD 539
           I      L+QG+  F P F    F+  YI +   I+ +LG    +KT+  L   D+ 
Sbjct: 466 IANIFLGLVQGWSYFKP-FDAKNFVDAYILIPAGIILYLGVS-YWKTKGFLTAVDLS 520

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  292 bits (748), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 173/497 (34%), Positives = 284/497 (57%), Gaps = 26/497 (5%)

Query: 56  GNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
            N   D+ R LKPR ++MIS+ G IGTGL++  +  +   GP    + Y  MG + +   
Sbjct: 44  ANIREDLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIMGGVVYLTL 103

Query: 116 QSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWT- 174
            +LGEM+T++P++ SF +Y ++F S +   A  + YWF+  V+ A +L+ +  ++ YW  
Sbjct: 104 LALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVMDYWKT 163

Query: 175 --FAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSS 232
                P     ++FW ++   N+I VRFYGE E+W+A LK+++I  F I ++V+  G   
Sbjct: 164 SEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFFILSIVVNVG--- 220

Query: 233 EGALGFRYWKNPGPWGMGMISSNKYEARFL----GWVSSLIKAAFTYQGTELVGITAGES 288
                    KNP    +G  +  + EA F+    G+ S  + A+F Y GTE + +T GE+
Sbjct: 221 ---------KNPQHEYIGFKNWTRGEAPFVDGIKGFASLFVSASFAYGGTESITLTNGEA 271

Query: 289 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNS 348
           +NP +  PK +  VF+RIL FY+ S FF+ + +PY  P L + S   I TSPF +  Q +
Sbjct: 272 ENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKS---IVTSPFTLVFQMA 328

Query: 349 GTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPS-LFKKTNKQGVPFYAVL 407
           GTK   S  N VI+ +++SA N  ++ GSR++Y +   G  P+ +  +TN+  VP+ +VL
Sbjct: 329 GTKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVPYVSVL 388

Query: 408 TSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDL 467
            ++  G L +      A  ++ WL  I  V+   AWL I ++ IRF + L+ +G   ++L
Sbjct: 389 ITAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQG-KTHEL 447

Query: 468 PFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLF 527
            +K    P+G Y+   F++ IILIQG+ +FAP  V S F + Y+ +F+F VC++ + ++ 
Sbjct: 448 IYKNWTYPYGPYFVIIFVSFIILIQGWSAFAPWNV-SNFFSYYLELFVFPVCFIIWWLVK 506

Query: 528 KTRLILRKEDVDIDTDR 544
           + R + + ED+D  TDR
Sbjct: 507 RDRFV-KYEDMDFTTDR 522

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  293 bits (750), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 161/529 (30%), Positives = 279/529 (52%), Gaps = 25/529 (4%)

Query: 42  FINQENMSEVESLYGNDDP-----DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAG 96
           F  +    +V+ L G ++       +K+ +K RH+ MISLG  IGTGL +G    +  AG
Sbjct: 45  FRRKGESEDVKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAG 104

Query: 97  PVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSW 155
           P G ++ Y     + +C+ Q+ GE+   +  +  ++T Y+   + PALG +  ++Y   W
Sbjct: 105 PAGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQW 164

Query: 156 CVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLS 215
                L+L      ++YWT A P  +++ VF++++   NM   + Y E EF     KVL 
Sbjct: 165 MTVLPLQLVTAAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLM 223

Query: 216 IFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFT 274
           I GF+I  + + CGG+ + G +G +YW +PG +  G          F G       AAF+
Sbjct: 224 IAGFVILGIAINCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFS 273

Query: 275 YQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL-STTSD 333
           Y G E++ +TA E +NPRK++P A  KV +RIL  Y+L+   V  LVPY    L  ++ +
Sbjct: 274 YGGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGE 333

Query: 334 SDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLF 393
           S  + SP V+A+ + G K++P + N VIL++++S GNS++Y   R+L  LS+ G AP   
Sbjct: 334 SASHASPLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFL 393

Query: 394 KKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRF 453
              ++QG P      + +   +A++  S   + +F WLL I+ ++  F W  I LSH+RF
Sbjct: 394 NYVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRF 453

Query: 454 MQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIA 508
              +  +G+S   + +K++   WG+++A     ++++ Q + + AP           F  
Sbjct: 454 RDAMHAQGLSLGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQ 513

Query: 509 DYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREIDALVWSDDD 556
           +Y++  + +  + G++V  K  RL +   +VD+ + R   D  +   +D
Sbjct: 514 NYLAFPILLGAYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEILRQED 562

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  293 bits (751), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 278/508 (54%), Gaps = 23/508 (4%)

Query: 46  ENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           +  SE+ES   N+   + R +K RH+ MISLG  IGTGL +G    +  AGP G +L Y 
Sbjct: 77  DQNSELESQERNN---LTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYG 133

Query: 106 FMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELS 164
               + +C+ Q+ GE+   +  +T ++T Y+   + P+LG A   +Y   W     L+L 
Sbjct: 134 IASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLV 193

Query: 165 IIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
                I+YWT  V   +++   +I +   N+   + Y E EF     K+L + GF+I A+
Sbjct: 194 TAAMTIKYWT-NVNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAI 252

Query: 225 VMVCGGSSEGA-LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           V+ CGG+ +   +G +YW NPGP+  G          F G  +    AAF+Y G E++ +
Sbjct: 253 VINCGGAGDRKFIGTKYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLL 302

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPY-TDPRLSTTSDSDINTSPFV 342
           +A E +NP K++P A  KV +RILF Y+L+   +  LVPY +D  L + S S  + SPFV
Sbjct: 303 SAAEQENPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPFV 362

Query: 343 MAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVP 402
           +A+ + G KV+P   N VIL++++S  NS++Y   R+L  L++ G  P      ++ G P
Sbjct: 363 IAVASHGVKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRP 422

Query: 403 FYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGI 462
               L S IFGC+ ++  S   ++VF WLL I++++  F W+ +SLSHIRF   +  +G 
Sbjct: 423 LLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGR 482

Query: 463 SRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFI 517
           S +++ +KA+   WG++ A       ++ Q + + AP     +   + F  +Y+++ + +
Sbjct: 483 SMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVL 542

Query: 518 VCWLGFQVLFKT-RLILRKEDVDIDTDR 544
             + G ++  K+ +  +  E +D+D+ R
Sbjct: 543 FAYFGHKIYTKSWKFWIPAEKIDLDSHR 570

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 275/512 (53%), Gaps = 11/512 (2%)

Query: 59  DPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSL 118
           +  +K+ +K RH+ M++LG  IGTGL +  AS +  +GP   +LAY  +  + + + Q+ 
Sbjct: 98  ESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAA 157

Query: 119 GEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177
           GEMA   P +  +F  Y   F+S   G A  +L+   W     LEL      I+YW   +
Sbjct: 158 GEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWNDKI 217

Query: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236
              V++V+F++ L   +   V+ YGE EF   + K+L I GF+I+++V+ CGG+  +G +
Sbjct: 218 NSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYI 277

Query: 237 GFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVP 296
           G +YW +PG +     +S+    RF G    L+ A F+Y GTEL  ++  E +NPRK+ P
Sbjct: 278 GGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTP 332

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
           +A  +  +RI+  Y+L++  +G  VP+ + +L  +  S  + SP+V+A    G +++P  
Sbjct: 333 QAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVPHF 392

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL++++S  NS++Y   R+L  L++ G AP      ++QG P  A+ T S+FG + 
Sbjct: 393 INAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIG 452

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           +   S   ++VF WL  I  ++  F W  I LSH+RF Q +K +G   N+L +KA    W
Sbjct: 453 FAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVW 512

Query: 477 GAYYAAFFITVIILIQGFDSFAP---EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLI 532
           G+ Y  FF  ++   Q + + AP   +     F   Y++  +F   + G+ +  K    +
Sbjct: 513 GSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDFTFL 572

Query: 533 LRKEDVDIDTDRREIDALVWSDDDEPKTLLQK 564
           +  E +D+D  RR  D      + E K +  K
Sbjct: 573 IPLESIDLDFHRRVYDPEFIRQEREEKKIKLK 604

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  291 bits (746), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 167/517 (32%), Positives = 275/517 (53%), Gaps = 14/517 (2%)

Query: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
           +DD  +K+ +K RH+ M++LG  IGTGL +     + +AGP   +L Y  +  + + + Q
Sbjct: 73  SDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQ 132

Query: 117 SLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF 175
           + GEMA   P + +SF  Y   F+S   G A  +L+   W     LEL      I+YW  
Sbjct: 133 AAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWND 192

Query: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSS-EG 234
            +   V+IV+F++ L   +   V+ YGE EF   + K+L I GF+I ++V+ CGG+  +G
Sbjct: 193 TINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDG 252

Query: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294
            +G +YW NPG +     +S    ARF G    L+   F+Y GTEL  ++  E KNPRK+
Sbjct: 253 YIGNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKS 307

Query: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLP 354
            P A  +  +RIL  Y+L++  +G  VP+   +L     S  + SP+V+A    G KV+P
Sbjct: 308 TPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVP 367

Query: 355 SVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGC 414
              N VIL++++S  NS +Y   R++  L++ G AP  F   +++G P  A+    +FG 
Sbjct: 368 HFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGV 427

Query: 415 LAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM 474
           + ++  S   ++ F WL  I  ++  F W  I +SHIRF   +K +G S  +L ++A   
Sbjct: 428 IGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTG 487

Query: 475 PWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKT 529
            WG+ Y+ FF  ++ + Q + + +P     ++    F   Y++  L++V + G+ +  + 
Sbjct: 488 IWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRD 547

Query: 530 RLILRKED-VDIDTDRREID-ALVWSDDDEPKTLLQK 564
              L   D +D+D  RR  D  L+  +D E K  L+ 
Sbjct: 548 FTFLTPLDKIDLDFHRRIYDPELLRQEDAETKERLRN 584

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  290 bits (742), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 166/539 (30%), Positives = 286/539 (53%), Gaps = 22/539 (4%)

Query: 18  DRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLG 77
            R  +S + +DV+    E         +E   E  +        +K ++K RH++MISLG
Sbjct: 36  QRFKDSFKRADVVEDVHE---------KEGQEEYATGLNKTQQKLKHNIKTRHLTMISLG 86

Query: 78  GTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQ 136
             IGTGL +     +   GP G L+ YL   T+ +CV Q+  E+   +  +  ++  Y  
Sbjct: 87  TGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPT 146

Query: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMI 196
             +    G A   +Y   W +   LEL      I+YWT +V   V++ +F++ +   +  
Sbjct: 147 FLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFF 206

Query: 197 PVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNK 256
             R Y E EF    LKVL + GF+I  + + CG S  G +G +YW NPG +  G  S N 
Sbjct: 207 GSRGYAESEFIFNTLKVLLMAGFIIMGISLNCGASKLGYIGAKYWSNPGTFA-GERSINH 265

Query: 257 YEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFF 316
            +    G  S  +++AF Y G+E + +TA E  NPR++VP A  +  +R++  +++ +  
Sbjct: 266 LK----GICSVWVQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIAL 321

Query: 317 VGLLVPYT-DPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYI 375
           +  LVPYT D  LS++  S  + SPFV+A    G K++P + N +IL +++S GNS +Y 
Sbjct: 322 ICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYS 381

Query: 376 GSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTIT 435
             R+L  L+++GL P +F   ++ G P   +L   +FG L+++  S+N + VF WL  I 
Sbjct: 382 APRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIA 441

Query: 436 AVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFD 495
            ++  F W  I+LSHIRF   +K +G S  +L + +     G+YYA FF  V+++ Q + 
Sbjct: 442 GLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWI 501

Query: 496 SFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFK-TRLILRKEDVDIDTDRREID 548
           + AP     E     F  +Y++  + ++ ++G+++ ++  +L++  + +D++T R+  D
Sbjct: 502 AIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQIFD 560

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  288 bits (738), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 180/536 (33%), Positives = 289/536 (53%), Gaps = 33/536 (6%)

Query: 23  SSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDP------DVKRDLKPRHMSMISL 76
           SS  SD    + ++  + I+    ++ +++ L  + DP      D+ R L PRH++MIS+
Sbjct: 2   SSSISDREAVKVDSGKQEIYEVSSSL-DIDELRSDFDPEQNIREDLTRALSPRHINMISI 60

Query: 77  GGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQ 136
            G IGTGL++  A  +   GP    + Y  +G + +     LGEM+TF+P++ SF  Y +
Sbjct: 61  AGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYAR 120

Query: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA---VPLSVWIVVFWILLTAS 193
           +F S +   A  + YWF+  V+ A +L+ +  ++ YW  A    P     ++FW  +   
Sbjct: 121 KFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFL 180

Query: 194 NMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYWKNPGPWGMGMI 252
           N+I VR YGE E+W+A LKV++I  F I ++++  G + +   +GF+ W +         
Sbjct: 181 NVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTH--------- 231

Query: 253 SSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYIL 312
               +   F G+ S  + A F Y GTE + +T GE+ NP +  PK +  VF+RIL FY+L
Sbjct: 232 GEAPFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVL 291

Query: 313 SLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSN 372
           S FF+G+ +PY  P LST S   + TSPF +  Q +GT+   S  N VIL +++SA N  
Sbjct: 292 STFFIGMNIPYDYPGLSTKS---VMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHA 348

Query: 373 IYIGSRVLYGLSKSGLAP-SLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWL 431
           ++ GSR++Y ++  G  P  +  +TN+   P+ AVL +   G L        A  ++ WL
Sbjct: 349 LFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWL 408

Query: 432 LTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILI 491
             I  V+   AWL I ++ IRF + L+ +G   + L FK    P+G Y+   F   IILI
Sbjct: 409 QNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIILI 467

Query: 492 QGFDSFAPEFV---FSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDR 544
           QG+ +F P  V   FS ++  ++  F++I+ W     L+K    ++ ED+D  TDR
Sbjct: 468 QGWQAFDPWSVTDFFSVYLELFVFPFVYIIWW-----LWKRDWFVKYEDMDFVTDR 518

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  290 bits (741), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 187/568 (32%), Positives = 308/568 (54%), Gaps = 35/568 (6%)

Query: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISL 76
           N    +  E ++ L    +T+N  IF    +  +  +       ++KR LK RH+ MI++
Sbjct: 31  NKNIDDKYEHAESLTDYTKTENRNIFQRVIDSFKPPANGSFHTSNLKRSLKSRHLIMIAI 90

Query: 77  GGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQ 136
           GG+IGTGLF+G    +   GP+  +L +   G+        LGE+    PV  +F  Y  
Sbjct: 91  GGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGEITVRFPVVGAFANYQT 150

Query: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMI 196
           RFL P+L      +Y   W     LE+      +QYW   +   V++ +F+  + + N+ 
Sbjct: 151 RFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDTIDPVVFVAIFYCAIVSINLF 210

Query: 197 PVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSN 255
            VR +GE EF  + +KV+++ GF+I  ++++CGG  +   +G +YW +PG    G     
Sbjct: 211 GVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGAKYWHDPGCLANG----- 265

Query: 256 KYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLF 315
                F G++S LI A+++  GTE+  + +GE+ +P K +P AI +VF+RILFF+++SL 
Sbjct: 266 -----FRGFLSVLITASYSLGGTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLVSLT 318

Query: 316 FVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYI 375
            VG LVPYT+  L     S ++ SPFV+AI+    KVLPS+ N VIL++ILS GNS I+ 
Sbjct: 319 LVGFLVPYTNENL--LGGSSVDNSPFVIAIKLHNIKVLPSIVNAVILISILSVGNSCIFA 376

Query: 376 GSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTIT 435
            SR L  ++  GL P  F   ++ G P   ++ +S+FG LA+L  S +  +VFDWL+ I 
Sbjct: 377 SSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLVKSSSVSEVFDWLMAIA 436

Query: 436 AVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFD 495
            +A    WL I++ HIRF   +K +  + ++L F +    WG+ Y+A   ++I+++Q + 
Sbjct: 437 GLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWGSVYSAIINSLILIVQFYV 496

Query: 496 SFAP------------EFVFSEFIADYISVFLFIVCWLGFQVLFKTRL---ILRKEDVDI 540
           S  P            +F F  ++   +S+  FI   L F+  +KT+    I+  +D+D+
Sbjct: 497 SLWPIGGWTDSKDRAGKF-FQNYLCAIVSLIFFICHKLYFR--YKTKKWWEIIPLKDIDL 553

Query: 541 DTDRREIDALVWSDD--DEPKTLLQKLW 566
           DT R+ ID  +  ++  +  + L  K W
Sbjct: 554 DTGRKNIDIDIVKEEIKERKQYLATKPW 581

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  290 bits (743), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 164/514 (31%), Positives = 280/514 (54%), Gaps = 15/514 (2%)

Query: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120
           + K+ +K RH+ M+SLG  IGTGL +     + +AGP   ++AY  +  + + + Q+ GE
Sbjct: 92  EQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGE 151

Query: 121 MATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPL 179
           MA   P +  SF  YT  F+S   G A  +L+   W     LEL      I+YW  ++  
Sbjct: 152 MAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDP 211

Query: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGF 238
            V++++F++ L   +   V+ YGE EF   A K+L I GF+I+A+V+ CGG+  +G +G 
Sbjct: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGG 271

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298
           +YW +PG +     +S+   +RF G   +L+ A F+Y G EL  ++  + KNPRK+ P A
Sbjct: 272 KYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326

Query: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSD-INTSPFVMAIQNSGTKVLPSVF 357
                +RI+  Y+L++  +G +VP+    L   S  + ++ SP+V+A    G KV+P + 
Sbjct: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHII 386

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N VIL+ ++S  NS++Y G R+L  L++ G AP      +++G P  A+L S++ G + +
Sbjct: 387 NAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGF 446

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
              S   ++VF WL  I+ ++  F W  I  SHIRF + +K +  S + L +KA    WG
Sbjct: 447 AATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWG 506

Query: 478 AYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLI 532
           +Y+   F  ++   Q + + +P     +   + F A Y+++ +++V + G+   +K   +
Sbjct: 507 SYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTV 566

Query: 533 LRK-EDVDIDTDRREID-ALVWSDDDEPKTLLQK 564
           L     VD+D  R+  D   +  +D E K  L+ 
Sbjct: 567 LTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  288 bits (738), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 183/546 (33%), Positives = 287/546 (52%), Gaps = 34/546 (6%)

Query: 22  ESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD--VKRDLKPRHMSMISLGGT 79
           + S S D+    KE  +        N+   E      DP+  VKR LK RH+S+++LGG 
Sbjct: 12  DESRSDDLSKFSKEEPD------THNIKSFEQF----DPNTGVKRALKNRHISLLALGGI 61

Query: 80  IGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFL 139
           IG G  +G  + +   GP+  LL +  +G +AF V +S+GEM T  P  S F+  ++RF 
Sbjct: 62  IGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFH 121

Query: 140 SPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVR 199
           S AL A +GY Y   +    A E + +  ++Q+W   VPL  +I++F +      M+ V 
Sbjct: 122 SDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGVG 181

Query: 200 FYGEIEFWIAALKVLSIFGFLIYALVMVCGG-SSEGALGFRYWKNPGPWGMGMISSNKYE 258
            +GE E+W+A  K++ +  + I++++ + GG  +  A GF YW NPG    G        
Sbjct: 182 IFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWNNPGALADG-------- 233

Query: 259 ARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVG 318
             F G     +  +  Y GTE V + A ES+NP K VP AI + F+RI+  Y+    F G
Sbjct: 234 --FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYG 291

Query: 319 LLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSR 378
             VPY D  L   + +    SP  +AI  +G +    + N  IL+T +SA N ++YIGSR
Sbjct: 292 ATVPYNDTSLGAHTKA--LKSPIAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSR 349

Query: 379 VLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVA 438
            L  L+  GLAP   K T+K+GVP  A+   +  G ++ +N+S  A   + +++ ++ V 
Sbjct: 350 TLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVG 409

Query: 439 GFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFA 498
            F  W +ISL+H+RF +    +G S ++LP+K+   PWG  ++      + LIQG+ +F 
Sbjct: 410 VFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFV 469

Query: 499 PEFVFSEFIADYI----SVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRRE-IDALVWS 553
           P F   +F+  YI    +V L+IV  L     FK   ++    VD++  RRE +D+    
Sbjct: 470 P-FSAKDFVDAYILLPAAVILYIVISLVKIGGFK---LVDLRTVDLEEGRREDLDSDGTD 525

Query: 554 DDDEPK 559
           +D E K
Sbjct: 526 EDSEGK 531

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  288 bits (737), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 174/547 (31%), Positives = 292/547 (53%), Gaps = 26/547 (4%)

Query: 6   ELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRD 65
           E E  P+G+     + +  E+ +      +  NE          E   LY ND   +K+ 
Sbjct: 4   EKEELPSGELKKTEAVQVCETYEADSVEPQNANE---------PEEGVLY-NDRTRLKQG 53

Query: 66  LKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFI 125
           LK RH+ M++L G  GTGLF+     ++ AGP G  LAY+ +G +  C   ++ E+A+F+
Sbjct: 54  LKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAEVASFM 113

Query: 126 PVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFAL----ELSIIGQLIQYWTFAVPLSV 181
           P T +   + ++F+  ++G      + F W  T++     ELS    +++YWT   P +V
Sbjct: 114 PATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVVMRYWTDINP-AV 166

Query: 182 WIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYW 241
           WI +F IL   +N+  +RFYGE+E++   +K++ I   ++  LV+  GG+ +  LGF YW
Sbjct: 167 WITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGAKQERLGFHYW 226

Query: 242 KNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 301
           + PGP+   ++       +F+G+ ++L    ++Y G + + I AGE+KN R  +      
Sbjct: 227 REPGPFAEYIVKGEI--GKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGARN 284

Query: 302 VFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVI 361
           VF RI+  Y++++  + L+VPY D +L  T      +SP+V+AIQ +  K+LP + N +I
Sbjct: 285 VFLRIIVLYLIAVLVLTLIVPYND-KLIATGTGTAKSSPYVIAIQRANIKILPHIINAII 343

Query: 362 LVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNIS 421
           L +  SAGN  I  GSR L+ L+    AP +F  TNK+G+P+  +   S F  L+Y+++S
Sbjct: 344 LTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSYMSVS 403

Query: 422 QNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYA 481
            ++  VF W   + +      W+LIS +HI   + LK +G SR+DLP      P+ A+++
Sbjct: 404 SSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPFAAWFS 463

Query: 482 AFFITVIILIQGFDSFAP-EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540
                + +L  GF +F    F    F   Y  + L I+ +  F  LFK    LR  +VD+
Sbjct: 464 GIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFT-FWKLFKKTKYLRPAEVDL 522

Query: 541 DTDRREI 547
           ++   +I
Sbjct: 523 ESIFEDI 529

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  288 bits (738), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 185/543 (34%), Positives = 281/543 (51%), Gaps = 35/543 (6%)

Query: 15  QHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD--VKRDLKPRHMS 72
           + +D S ES  SS +   + ET         E  +   SLY   DP   VKR LK RH+S
Sbjct: 13  KGDDASCESYTSSGITPDQIETG--------EGKNHNASLY---DPKTGVKRALKDRHIS 61

Query: 73  MISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFT 132
           +++LGG IG G  +G  + +   GP+  LL +  +G IAF + +S+GEM T  P    FT
Sbjct: 62  LLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEMITLYPSGGGFT 121

Query: 133 MYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTA 192
              +RF S +L A  GY Y   +    A E + +  + Q+W   VPL  +I++FW    A
Sbjct: 122 TLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYGYILIFWAAFQA 181

Query: 193 SNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG-SSEGALGFRYWKNPGPWGMGM 251
             M  V  +GEIE+W++  K+L +  F I++ + + GG     A GF YW NPG    G 
Sbjct: 182 FQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHYWNNPGALSHG- 240

Query: 252 ISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYI 311
                    F G     +  +  Y GTE V  +A ESKNP + +P AI + F+RIL  YI
Sbjct: 241 ---------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIRQTFWRILVVYI 291

Query: 312 LSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNS 371
              FF G+ VPY D  L+  + +    SP  +AI  +G +    + N  ILVT +SA N 
Sbjct: 292 GIGFFYGVTVPYNDHNLNAGTKAL--KSPISIAITRAGWEGGTHLVNAFILVTCISAING 349

Query: 372 NIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWL 431
           +++IGSR +  L+  GLAP     T+++GVP  A+   +  G ++ +N+S  A   + ++
Sbjct: 350 SLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVSVGASTAYSYI 409

Query: 432 LTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILI 491
           + ++ V  F  W  I L+H+RF +    +G +  +LP+KA F P+           + LI
Sbjct: 410 VNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIGIAANIFLALI 469

Query: 492 QGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVL----FKTRLILRKEDVDIDTDRR-E 546
           QG+ SF P F   +F+  Y+ +    V ++G  +L    FKT  +L    +D+D  RR +
Sbjct: 470 QGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKTVDLL---TIDLDEGRRVD 525

Query: 547 IDA 549
           +DA
Sbjct: 526 LDA 528

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  289 bits (739), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 171/568 (30%), Positives = 290/568 (51%), Gaps = 32/568 (5%)

Query: 16  HNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD----------VKRD 65
            + RS +   S   L HR        F++    +E   L  ND  D          +K+ 
Sbjct: 5   QSPRSDDVEISKSNLVHR--------FVDSFRRAESPELEENDLEDGTRSIVTKTHLKKA 56

Query: 66  LKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFI 125
           +K RH+ M+S+G  IGTGL +  A  +  +GP   ++ Y+ +  + + + Q+ GEMA   
Sbjct: 57  MKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAY 116

Query: 126 P-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIV 184
           P +  SF  YT  F+S   G A  +L++  W   F LEL      ++YW   +   V+I+
Sbjct: 117 PTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFII 176

Query: 185 VFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKN 243
           +F+  L   +   V+ YGE EF   + KVL + GF+I ++V+ CGG+ ++G +G +YW +
Sbjct: 177 IFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHD 236

Query: 244 PGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVF 303
           PG +  G   +     RF G    L+ A F+Y G EL  ++  E +NPRK+ P A  +  
Sbjct: 237 PGSFADGPPIT-----RFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSI 291

Query: 304 FRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILV 363
           +RIL  Y+ ++  +G  VP+    L     +  + SP+V+A      KV+P   N VIL+
Sbjct: 292 YRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILI 351

Query: 364 TILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQN 423
           +++S  NS +Y   R++  L++ G AP      +++G P   ++  ++FG + +++ S  
Sbjct: 352 SVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSK 411

Query: 424 AKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAF 483
            ++VF WL  I  ++  F W  I LSHIRF Q +K  G S +++ FKA    WG+YY   
Sbjct: 412 EEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCA 471

Query: 484 FITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK-ED 537
           F  ++ + Q + + +P     +     F   Y++  +++V + G+ +  +   IL   E 
Sbjct: 472 FNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEK 531

Query: 538 VDIDTDRREIDA-LVWSDDDEPKTLLQK 564
           +D+D  RR  D   +  +D+E K  L+ 
Sbjct: 532 IDLDFHRRIYDPDFIKQEDEENKERLKN 559

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  287 bits (735), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 172/493 (34%), Positives = 268/493 (54%), Gaps = 19/493 (3%)

Query: 59  DPD--VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
           DP+  VKR LK RH+S+++LGG IG G  +G  + ++  GP+  LL ++ +G IAF V +
Sbjct: 27  DPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVME 86

Query: 117 SLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
           S+GEM T  P    FT   +RF S AL A  GY Y   +    A E + +  ++Q+W   
Sbjct: 87  SIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFWGPQ 146

Query: 177 VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG-SSEGA 235
           VPL  + ++FWI+     +I V  +GE E+W++ LK+L +  + I++++ + GG  ++ A
Sbjct: 147 VPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPA 206

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295
            GF YWK+PG    G          F G     +  +  Y GTE V +TA ESKNP K+V
Sbjct: 207 FGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSV 256

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPS 355
           P A+ +  +RI+  YI    F G  VP+ DP LS   ++ +  SP  +AI  +G      
Sbjct: 257 PYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNLSV--NTKVLKSPIAIAISRAGWAGGSH 314

Query: 356 VFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCL 415
           + N  IL + +SA N ++YIGSR L  L+  GLAP     T+K+GVP  A+   +  G +
Sbjct: 315 LVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLI 374

Query: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475
           + +N+S  A   + +++ ++ V  F  W +IS +H+R  +    +G    +LP+KA F P
Sbjct: 375 SLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYP 434

Query: 476 WGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTR--LIL 533
           W   ++      + LIQG+ S  P F   EF+  YI +   I+ ++G  V FK     I+
Sbjct: 435 WTPIFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCV-FKNHNFRIV 492

Query: 534 RKEDVDIDTDRRE 546
               V++D  RR+
Sbjct: 493 DLTSVNLDEGRRK 505

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  289 bits (740), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 158/501 (31%), Positives = 278/501 (55%), Gaps = 22/501 (4%)

Query: 56  GNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVT 115
           G+++  +K+ +KP H+ MI++   IGTGL +G    I  AG  G+L+ Y  +G++  C  
Sbjct: 64  GSENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCM 123

Query: 116 QSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWT 174
           QS+GE+    P +   F  Y +RF+ P+ G    +L+   W +   LEL      I+YW 
Sbjct: 124 QSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWN 183

Query: 175 FAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SE 233
            ++  S+++ +F+ L+   +    R Y + EF     KVL I GF+I  +++  G + + 
Sbjct: 184 NSLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTS 243

Query: 234 GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESK--NP 291
           G +G +Y K PG +             F    S+L+ A F+  G E + ++A E    N 
Sbjct: 244 GYIGIKYLKTPGAFNT--------RNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNI 295

Query: 292 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTK 351
            K++ +A  +V  R+  FYILS+F +GLLVPY  P L  +S   I++SP+V+A+ + G K
Sbjct: 296 SKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVK 355

Query: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411
           V+P + N VIL+ ++S  NS +Y  SR L+ L++ G APS F K + +G PF  ++ S +
Sbjct: 356 VVPHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGV 415

Query: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471
           FG L+++   ++ + VF WLL+I+ ++  F W +I ++H+RF   +KD+  S  +L  +A
Sbjct: 416 FGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRA 475

Query: 472 KFMPWGAYYAAFFITVIILIQGFDSF-------APEFVFSEFIADYISVFLFIVCWLGFQ 524
               +G+YY     ++ +++Q + S         P+FV   F  +Y++V   +  ++G +
Sbjct: 476 WSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFV--NFFQNYMAVPFALCLYVGHK 533

Query: 525 VLFKT-RLILRKEDVDIDTDR 544
           +  ++ + I+  + +D+DT R
Sbjct: 534 IYTRSWQFIIPADKIDVDTSR 554

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  288 bits (737), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 183/580 (31%), Positives = 314/580 (54%), Gaps = 37/580 (6%)

Query: 3   ENVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDV 62
             VE+ T P      DR  E ++ S  +H    T +E   ++Q ++ ++ES      P +
Sbjct: 7   STVEVPTLP---YVTDRMKEKTQFS--IH---STGDE---VSQGSVLDIES----QKPGI 51

Query: 63  KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMA 122
            R LK RH+ +I+LG  IGTGLF+G    + + GP   L+AY  M    + V   + EM 
Sbjct: 52  VRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMV 111

Query: 123 TFIPVTSSFTMYT--QRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
           T IP+    T+Y+  + +++  L    G+  +++  +    E++    L+QYWT A P +
Sbjct: 112 TLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWTDANP-A 170

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG--SSEGALGF 238
           ++I +F +L  A  M+PV+ +GE EFW++++K+L+I G +I  +V+  GG  + E  LGF
Sbjct: 171 IFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGF 230

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGT-ELVGITAGESKNPRKTVPK 297
            YWK PG +   ++       +FL + +++IK+ F++    E+V   A E+  PR+ +P+
Sbjct: 231 HYWKKPGAFKPYLVEGGT--GKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPR 288

Query: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRL---STTSDSDINTSPFVMAIQNSGTKVLP 354
           A  +  +R+  FY+  +  VG++V Y + RL     +  S    SPFV+ I+ +G +VLP
Sbjct: 289 ACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLP 348

Query: 355 SVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGC 414
            + N  IL +  S G   +Y  SR L+ ++  G AP +    NK GVP+Y    +S+F  
Sbjct: 349 HIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCL 408

Query: 415 LAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM 474
           LAYLN S ++  VF+WL  I  ++GF +W+L+S+++IRF  V+    ++ + +PF+  + 
Sbjct: 409 LAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPFRVPYQ 467

Query: 475 PWGAYYAAFFITVIILIQGFDSFAP-EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLIL 533
              AY A  F +++ L  GF  F    +  S F A YI++   +V ++G  + +K     
Sbjct: 468 KPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYKE---W 524

Query: 534 RKEDV-DIDTDRREIDALVWSDDDE-----PKTLLQKLWQ 567
           R  D+ +I+ D      L  +++ E     P+  L+K+W 
Sbjct: 525 RCRDIAEIEQDILPKITLAEAEEYEYDIPVPRNWLEKIWM 564

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  288 bits (738), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 169/552 (30%), Positives = 295/552 (53%), Gaps = 16/552 (2%)

Query: 23  SSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGT 82
           + ES   L HR     +    + EN  E  +    D   +K+ +K RH+ M+ +G  IGT
Sbjct: 36  TEESRSGLVHRFVDSFKRAQDSTENDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGT 95

Query: 83  GLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSP 141
           GL +  AS +   GP   ++ Y+ +  + + + Q+ GEMA   P +  +F  YT  F+S 
Sbjct: 96  GLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISK 155

Query: 142 ALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFY 201
             G A  +L++  W   F LEL      I+YW   +   V+IV+F++ L   +   V+ Y
Sbjct: 156 PFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAY 215

Query: 202 GEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEAR 260
           GE EF   + KVL I GF+I ++V+ CGG+  +G +G +YW++PG +  G    +  E +
Sbjct: 216 GEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEG----DSVE-K 270

Query: 261 FLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLL 320
           F G    L+ A F+Y G EL  ++  E +NPRK+ P+A  +  +RIL  Y+L++  +G  
Sbjct: 271 FKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFN 330

Query: 321 VPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVL 380
           VP+ + +L  +  S  + SP+V+A    G KV+P   N VIL++++S  NS +Y   R++
Sbjct: 331 VPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLM 390

Query: 381 YGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGF 440
             L++ G AP      +++G P  A++  ++FG + +++ S   ++VF WL  I  ++  
Sbjct: 391 CSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSEL 450

Query: 441 FAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPE 500
           F W  I LSH+RF Q +K  G S  ++ F+A    WG+ Y   F  ++ + Q + + AP 
Sbjct: 451 FTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPP 510

Query: 501 FVFSE-----FIADYISVFLFIVCWLGFQVLFKT--RLILRKEDVDIDTDRREID-ALVW 552
            +  +     F   Y++  +++  + G+ +L+K     ++  + +D++  RR  D  L+ 
Sbjct: 511 SLHGKVDAESFFQSYLAAPIWLFFYFGY-MLYKRDFTFLVPLDKIDLNFHRRIYDPELIR 569

Query: 553 SDDDEPKTLLQK 564
            +D+E K  ++ 
Sbjct: 570 QEDEENKEKIKN 581

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  287 bits (734), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 175/541 (32%), Positives = 287/541 (53%), Gaps = 24/541 (4%)

Query: 27  SDVLHHRKETKNEGIFINQENMSEVESLYGND-DPD--VKRDLKPRHMSMISLGGTIGTG 83
           ++ +  R++       I +  +  +E+   N+ DP   VKR LK RH+S+++LGG IG G
Sbjct: 4   TNSIQQREDLDKLEPKIAEVELQRLETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPG 63

Query: 84  LFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPAL 143
             +G  + +   GP+  LL +  +G + F + +S+GE+ T  P    F    +RF S  L
Sbjct: 64  CLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGL 123

Query: 144 GAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGE 203
            A +GY Y   +    A E + I  ++Q+W   VP+  + ++FW       +I V  +GE
Sbjct: 124 SAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGE 183

Query: 204 IEFWIAALKVLSIFGFLIYALVMVCGG-SSEGALGFRYWKNPGPWGMGMISSNKYEARFL 262
            E+W+A  K+L +  F I+++V + GG   +  +GF+YWKNPG    G          F 
Sbjct: 184 CEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALSHG----------FR 233

Query: 263 GWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVP 322
           G     +  +  Y GTE V + A ES+NPRK VP A+ + F+RIL  Y+   FF G+ VP
Sbjct: 234 GIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVP 293

Query: 323 YTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYG 382
           Y DP L   + S    SP  +A+  +G      + N  IL+T +SA NS++YIGSR L  
Sbjct: 294 YNDPTLGAQTKSL--KSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSH 351

Query: 383 LSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFA 442
           L+  GLAP +   T+K+GVP  A++  +  G ++ +N+S  A   +++++ ++ V  F  
Sbjct: 352 LAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIV 411

Query: 443 WLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFV 502
           W  IS++H+RF +    +G S ++LP++A F PW   ++      + LIQG+ S  P FV
Sbjct: 412 WSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FV 470

Query: 503 FSEFIADYISVFLFIVCWLGFQVLFKTR--LILRKEDVDIDT-DRREIDALVWSDDDEPK 559
             +F+  YI +    + ++G    +K R    +    ++++   RR++D      DDE  
Sbjct: 471 AKDFVDAYILLPAAGLLYVGIN-FWKNRNFKTVNIHGINLEEGQRRDLDE---DSDDETG 526

Query: 560 T 560
           T
Sbjct: 527 T 527

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  290 bits (741), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 159/518 (30%), Positives = 287/518 (55%), Gaps = 13/518 (2%)

Query: 39  EGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPV 98
           E + +  E + + +   G+    +K+ ++PRH+ +ISLG  IGTGL +G  + +  AGP 
Sbjct: 93  ELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPA 152

Query: 99  GSLLAYLFMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCV 157
           G ++ Y  MG++ +C+ Q+ GEMA  ++ +   F  Y    + P    A  ++Y   W  
Sbjct: 153 GLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLC 212

Query: 158 TFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIP-VRFYGEIEFWIAALKVLSI 216
              LEL      I+YWT  V   V++++F++ +   N++   R Y E EF   + K+L +
Sbjct: 213 VCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMM 272

Query: 217 FGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTY 275
            GF I  ++++CGG+ ++G +G RYW +PG +        +   RF G V++L+ AAF++
Sbjct: 273 IGFFILGIIIICGGAGTDGYIGGRYWHDPGAF-----RGERAVDRFKGVVATLVTAAFSF 327

Query: 276 QGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSD 335
             +E + +TA E  NPR+ +P A  K+ +R L  Y+ S+  +G LVPY   +L     + 
Sbjct: 328 GQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNG 387

Query: 336 INTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKK 395
           I  SP+V+A+ N G +V+P   N VI++++LS  NS  Y   R+L  LS+ G AP +F  
Sbjct: 388 IKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSY 447

Query: 396 TNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQ 455
            ++ G P   ++ +S+F  +A+   S    +VF WLL ++ ++  F W+ I LSH+RF +
Sbjct: 448 VDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRR 507

Query: 456 VLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP----EFVFSEFIADYI 511
            +  +G S  +  F ++   +G+ Y+ F + +I++ Q + +  P    +   + F  +Y+
Sbjct: 508 AMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKVDANSFFENYL 567

Query: 512 SVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRREID 548
           +  ++I  ++G++   K  RL ++ +D+D+   R+  D
Sbjct: 568 AAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYD 605

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  286 bits (733), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 178/536 (33%), Positives = 295/536 (55%), Gaps = 20/536 (3%)

Query: 20  SAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGT 79
           S  S +   V     E   E   I   + +  + +  ND   +K+ LK RH+ M++L G 
Sbjct: 2   SISSQDKEKVKATAYEADVEDCDIRSTDETLKQGVLHNDRTKLKQGLKERHIKMLTLVGV 61

Query: 80  IGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFL 139
            GTGLF+     ++  GPVG L+AYLF+G +  C   ++ E+A+F+P T +   + ++F+
Sbjct: 62  FGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFI 121

Query: 140 SPALGAANGYLYWFSWCVTFAL----ELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNM 195
             ++G      + F W  T++     ELS    +++YWT   P +V+I +F +L   +N+
Sbjct: 122 DESVG------FTFGWISTYSSLMPGELSATAVIMRYWTDISP-AVFITIFGVLFVVTNI 174

Query: 196 IPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG-SSEGALGFRYWKNPGPWGMGMISS 254
             +RFYGE+E+    LK++ IF  +I  LV+  GG   +  LGF YW++PGP+   ++  
Sbjct: 175 YTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEYIVGG 234

Query: 255 NKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSL 314
           +    +F+G+ S+L    ++Y G + + I AGE+KN R  +      VF RI+  Y++++
Sbjct: 235 SI--GKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVTV 292

Query: 315 FFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIY 374
           F + L+VPY D  +++ + +   +SPFV+A+  +G KVLP + N ++L +  SAGN  I 
Sbjct: 293 FVLTLIVPYNDALIASGTGTA-KSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAII 351

Query: 375 IGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTI 434
            GSR L+ L+    AP +F KT+K+G+P+  V+  S F  LAY++ S+++  VF W   +
Sbjct: 352 EGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQEL 411

Query: 435 TAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGF 494
            +      W+LIS +HI   + LK +G SR+DLP+     P+ A+++     + +L  GF
Sbjct: 412 VSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGF 471

Query: 495 DSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDT---DRRE 546
            +F    F    F   Y  + L I  +  F  LFK    LR E+VD+ +   D RE
Sbjct: 472 YNFIHGHFDIESFFTRYFIIPLAIGLFT-FWKLFKKTRYLRPEEVDLASIFDDIRE 526

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  288 bits (736), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 168/554 (30%), Positives = 293/554 (52%), Gaps = 27/554 (4%)

Query: 20  SAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGT 79
           S + ++ S + + R E   +GI       + + S     D   K+ L  RH+ M+SLG  
Sbjct: 47  SYKRADPSQLHNARSEDVEDGI-------ASIRS-----DTQFKKSLSSRHVIMMSLGTG 94

Query: 80  IGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRF 138
           IGTGL +  A  +   GP   ++ Y+ +  + + + Q+ GEMA   P +  +F  Y   F
Sbjct: 95  IGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIF 154

Query: 139 LSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIP- 197
           +S + G A  +L+   W     LEL      I+YW   +   +++++F++ L A +++  
Sbjct: 155 ISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGG 214

Query: 198 VRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMISSNK 256
           +R YGE EF   + K+L + GF+I ++V+  GG+ ++G +G +YW  PG +  G  +S  
Sbjct: 215 IRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAEGDATS-- 272

Query: 257 YEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFF 316
              RF G    L+   F+Y GTEL  ++  E   PRK  P A  K  +RIL  Y+L++  
Sbjct: 273 ---RFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMIL 329

Query: 317 VGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIG 376
           +G  VP+ + +L     S  + SP+V+A    G K++P   N VIL++++S  NS+++ G
Sbjct: 330 IGFNVPHNNDQLMGAGGSATHASPYVLAATIHGVKIVPHFINAVILISVISVANSSLFAG 389

Query: 377 SRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITA 436
            R+L  L+  G AP +    +++G P  A+  S + G +A+++ + + ++VF WL  I  
Sbjct: 390 PRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAG 449

Query: 437 VAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDS 496
           ++  F W  I  SH+RF   +K +G   N+L +KA    WG+ Y AFF  ++++ Q + +
Sbjct: 450 LSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVA 509

Query: 497 FAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKED-VDIDTDRREID-A 549
            AP     +     F   Y++  +++ C+ G+ +  K   +L   D +D+D+ RR  D  
Sbjct: 510 LAPIGNGGKCDAEAFFESYLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPE 569

Query: 550 LVWSDDDEPKTLLQ 563
           L+  +D+E K  L+
Sbjct: 570 LIKQEDEENKENLK 583

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  288 bits (737), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 172/539 (31%), Positives = 292/539 (54%), Gaps = 22/539 (4%)

Query: 35  ETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRV 94
           ET     F+ Q   S        ++   +R L PR +SMI +GG IGT LF+ I + I  
Sbjct: 90  ETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQ 149

Query: 95  AGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFS 154
            GP   L+A+     +   +++ +  M T++PVT SF  +T+RF+  + G A G+ Y+  
Sbjct: 150 GGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVC 209

Query: 155 WCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVL 214
                  E++ +  +++YWT  +P +  I +  IL  + N+  V F+GE EF+++  KV+
Sbjct: 210 QAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVV 269

Query: 215 SIFGFLIYALVMVCGGSSEGA-LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAF 273
              G +I+ +V++ GG+ +   LGF+ W NPG +   +  S+    RF G++S L+ A +
Sbjct: 270 LAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYI--SDGSVGRFHGFMSCLVFALY 327

Query: 274 TYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDP---RLST 330
            + G + +G  A E+ NPRK +P +  KVF R++ FYI     VG+L+PY DP   R   
Sbjct: 328 VFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIK 387

Query: 331 TSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAP 390
                   SP+V A++  G +VLP + N +IL +I+SAGNS++Y  SRVL+ L+    AP
Sbjct: 388 EGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAP 447

Query: 391 SLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSH 450
            +FK T K+GVP Y  +   +   LAYL++S +   V  W L +   A    ++ I +S+
Sbjct: 448 RIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSY 507

Query: 451 IRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSF------APEFVFS 504
           ++F +    + +    LP+ +  +P+ A+++ F++ +++L+ G+  F         FVFS
Sbjct: 508 LQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFS 567

Query: 505 EFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREI--DALVWSDDDEPKTL 561
            F+  +  VFLF     G + L+K    +R  ++D+ T   E+  +   W+++  P TL
Sbjct: 568 YFMIPFFLVFLF-----GHK-LYKGTKSVRPLEMDLFTGIEELADEDRYWAEN--PPTL 618

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  286 bits (731), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 172/497 (34%), Positives = 264/497 (53%), Gaps = 20/497 (4%)

Query: 59  DPD--VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116
           DP+  VKR LK RH+S+++LGG IG G  +G  + +   GP+  LL +  +G IAF V +
Sbjct: 44  DPNTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVME 103

Query: 117 SLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176
           S+GE+ T  P    FT   +RF   AL A  GY Y   +    A E + +  ++Q+W   
Sbjct: 104 SIGEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQ 163

Query: 177 VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGG-SSEGA 235
           VPL  +I++FW       +I V  +GE E+W++  K++ +  + I++++ + GG     A
Sbjct: 164 VPLYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPA 223

Query: 236 LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTV 295
            GF YW +PG    G          F G     +  +  Y GTE V + A ESKNP K V
Sbjct: 224 FGFHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAV 273

Query: 296 PKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPS 355
           P A+ +  +R+L  YI    F G  VP+ DP LS T  + +  SP  +AI  +G      
Sbjct: 274 PLAVRQTLWRVLIVYIGIAVFYGATVPFDDPNLSAT--TKVLKSPISIAISRAGWAGGAH 331

Query: 356 VFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCL 415
           + N  ILVT +SA N ++YIGSR L  L+  GLAP +   T+++GVP  A+   +  G +
Sbjct: 332 LVNAFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLI 391

Query: 416 AYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMP 475
           + +N+S  A   + +++ ++ V  F  W +IS +H+R  +    +G S  +LP+KA   P
Sbjct: 392 SLMNVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYP 451

Query: 476 WGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTR--LIL 533
           W   ++      + LIQG+ SF P F    F+  YI + + IV ++   V FK     I+
Sbjct: 452 WTPIFSLIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAICV-FKNHHFRIV 509

Query: 534 RKEDVDIDTDRR-EIDA 549
             + VD+D  RR +IDA
Sbjct: 510 DLKSVDLDEGRRKDIDA 526

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  286 bits (731), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 172/534 (32%), Positives = 285/534 (53%), Gaps = 28/534 (5%)

Query: 45  QENMSEVESLY--GNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLL 102
           +E+ S+ E L   G++   +++ +KPRH+ MIS+   IGTGL +G    I  AG  G+L+
Sbjct: 6   KEDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLI 65

Query: 103 AYLFMGTIAFCVTQSLGEMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFAL 161
            YL +G +  C  QS+GE+    P +   F  Y ++F+ P+LG    +L+   W V   L
Sbjct: 66  GYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPL 125

Query: 162 ELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLI 221
           EL      I+YW   +  S+++  F+IL+   N      Y E EF    +KV+ +  F++
Sbjct: 126 ELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIV 185

Query: 222 YALVMVCGG-SSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTEL 280
             +V++ GG  + G +GF+Y K PG +       N     F     +L+ AAF+  G E 
Sbjct: 186 LGIVIITGGLGNSGPIGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEF 238

Query: 281 VGITAGESK--NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT 338
           + ++A E    N  K++ +A  +V  R+  FY+LS+  VGLLVPY  P L  +     +T
Sbjct: 239 LALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHT 298

Query: 339 SPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNK 398
           SP+V AI   G +++P + N VIL+ ++S  NS +Y  SR L+ L++   AP  F   NK
Sbjct: 299 SPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNK 358

Query: 399 QGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLK 458
            G P   ++ S+I G ++++   ++ + VF WLL+I+ ++  F W  I ++HIRF   LK
Sbjct: 359 HGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALK 418

Query: 459 DRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSF-------APEFVFSEFIADYI 511
            +G S + L +++     G+Y A     V+I++Q + S         P+ V  +F  +Y+
Sbjct: 419 LQGQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAV--KFFQNYM 476

Query: 512 SVFLFIVCWLGFQVLFKTRLI--LRKEDVDIDTDRREIDALVWSDDDEPKTLLQ 563
           +V + ++ +LG + L+       +R   VDI+TDR   D    SDD   K +++
Sbjct: 477 AVPVAVLLYLGHK-LYTNDWTPWIRTHCVDINTDR---DVYAPSDDLSTKGVVK 526

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  287 bits (735), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 168/527 (31%), Positives = 285/527 (54%), Gaps = 31/527 (5%)

Query: 46  ENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105
           +  SE+ES   N+   + + +K RH+ MISLG  IGTGL +G    +  AGP G +L Y 
Sbjct: 77  DRNSELESQEKNN---LTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYG 133

Query: 106 FMGTIAFCVTQSLGEMA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELS 164
               + +C+ Q+ GE+   +  +T ++T Y    + P+LG A   +Y   W     L+L 
Sbjct: 134 IASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLV 193

Query: 165 IIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYAL 224
                ++YWT +V   +++ V ++ +   N+   R Y E EF   + K+L + GF+I A+
Sbjct: 194 TAAMTVKYWT-SVNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAI 252

Query: 225 VMVCGGSSEGA-LGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGI 283
           ++ CGG+ +   +G  YW NPGP+  G          F G  +    AAF+Y G E++ +
Sbjct: 253 IINCGGAGDRRYIGAEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLL 302

Query: 284 TAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPY-TDPRLSTTSDSDINTSPFV 342
           +A E +NP K++P A  KV +RIL  Y+L+   V  LVPY +D  L ++  S  + SPFV
Sbjct: 303 SAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFV 362

Query: 343 MAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVP 402
           +A+ + G KV+P   N VIL++++S  NS++Y G R+L  L++ G+ P      ++ G P
Sbjct: 363 IAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRP 422

Query: 403 FYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGI 462
                 S +FGC+ ++  S   ++VF WLL I++++  F W+ +SLSHIRF   +  +G 
Sbjct: 423 LLCFFVSLVFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGR 482

Query: 463 SRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFI 517
           S N++ +KA+   WG++ A       ++ Q + + AP     +     F  +Y+++ + +
Sbjct: 483 SMNEVGYKAQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVL 542

Query: 518 VCWLGFQVLFKT-RLILRKEDVDIDTDRR--------EIDALVWSDD 555
             + G ++ FK+    +  E +D+D+ R         EID +  +DD
Sbjct: 543 FAYFGHKIYFKSWSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDD 589

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  286 bits (732), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 283/514 (55%), Gaps = 21/514 (4%)

Query: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121
           +++ ++PRH+ MIS+   IGTGL +G    I  AG  G+L+ Y  +G +  C  QS+GE+
Sbjct: 41  LRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCMQSVGEL 100

Query: 122 ATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLS 180
               P ++  F  Y +RF+ P+LG +  +L+   W +   LEL      I+YW  ++  S
Sbjct: 101 VVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYWNASLSPS 160

Query: 181 VWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMV--CGGSSEGALGF 238
           +++ VF+ L+   N      Y E EF   +LKV+ I GF+I  +++   C G+S G +GF
Sbjct: 161 LFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTS-GTIGF 219

Query: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESK--NPRKTVP 296
           RY  +PG +       NK          +L+ AAF+  G E + ++A E    N  K++ 
Sbjct: 220 RYLIDPGMF-------NKNYNIIKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIG 272

Query: 297 KAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSV 356
           +A N+V  RI  FY+LS+  VGLLVP+  P L  +  + I++SP+V A+  +G  V+P +
Sbjct: 273 RACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMNGITVVPHI 332

Query: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416
            N VIL+ ++S  NS +Y  SR L+ L++   AP  F K NK G P   +  S++FG ++
Sbjct: 333 INAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISALFGLIS 392

Query: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476
           ++   ++ + +F WLL+I+ ++  F W  I ++HIRF   +K RG S   L +K+     
Sbjct: 393 FVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKSITGVA 452

Query: 477 GAYYAAFFITVIILIQGFDSFAP-----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-R 530
           G+Y A     VI+++Q + S  P     +    +F  +Y++V + ++ ++G +V  K   
Sbjct: 453 GSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWS 512

Query: 531 LILRKEDVDIDTDRREIDALVWSDDDEPKTLLQK 564
           L++R  +VDI TDR      +  +D + K L+Q 
Sbjct: 513 LLIRASNVDITTDRDIYCPTI--EDPKIKVLMQN 544

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  287 bits (734), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 184/578 (31%), Positives = 297/578 (51%), Gaps = 36/578 (6%)

Query: 12  AGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESL--YGNDDPD-------- 61
           A    +D S  SS++   L HRK T     FI+    +E  +L     D  D        
Sbjct: 29  ASTNDDDISIASSQNRS-LSHRKNTSYYRNFIDSFKRAEHGNLNEKSADLEDGTASIQSK 87

Query: 62  --VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLG 119
             +K+ LK RH+ M+SLG  IGTGL +  A  +   GP   ++ Y+ +  I + + Q+ G
Sbjct: 88  SYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAG 147

Query: 120 EMATFIP-VTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVP 178
           EMA   P +  +F  Y   F+S + G A  +L+   W     LEL      IQYWT  + 
Sbjct: 148 EMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWT-DLN 206

Query: 179 LSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALG 237
             +++V+F++ L   + I V+ YGE EF     K+L I GF+I+++V+ CGG+ ++G +G
Sbjct: 207 GDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIG 266

Query: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297
            +YW  PG +  G  +S     RF G    L+   F+Y GTEL  ++  E   PRK  P 
Sbjct: 267 GKYWHTPGSFAEGGPTS-----RFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPA 321

Query: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357
           A  K  +RIL  Y+L++  +G  VP+   +L     S  + SP+V+A    G KV+P + 
Sbjct: 322 AAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKVVPHII 381

Query: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417
           N VIL++++S  NS++Y   R+L  L++ G AP      +++G P  A+L  ++FGC+A+
Sbjct: 382 NAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAF 441

Query: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477
           +  S   ++VF WL  I  ++  F W  I  SH+RF   +K +    +++ +KA    +G
Sbjct: 442 VASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYG 501

Query: 478 AYYAAFFITVIILIQGFDSFAP---------EFVFSEFIADYISVFLFIVCWLGFQVLFK 528
           +++ + F  ++++ Q + + +P         E  F  ++A  I VF +IV    + V  K
Sbjct: 502 SWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIV----YSVYNK 557

Query: 529 TRLILRK-EDVDIDTDRREIDA-LVWSDDDEPKTLLQK 564
              IL     +D+D  RR  D  L+  +D E K  L+ 
Sbjct: 558 EWTILTDLSKIDLDAHRRIYDPDLIRQEDAENKEKLKN 595

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  284 bits (727), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 180/532 (33%), Positives = 300/532 (56%), Gaps = 23/532 (4%)

Query: 21  AESSESSDVLHHRKETKNEGIF-INQENMSEVESL--YGNDDPDVKRDLKPRHMSMISLG 77
           + ++ SS+ +   K+ ++  I+      ++EV ++    N   D+ R LKPRH++MIS+ 
Sbjct: 6   SSATNSSEEISISKKQQDHLIYETTSYGVNEVYTIDPEANIREDLTRALKPRHINMISIA 65

Query: 78  GTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQR 137
           G IGTGL++  ++ +   GP    + Y  +G I +     L EM+T++P++ SF  Y ++
Sbjct: 66  GIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEMSTYMPISGSFCTYAKK 125

Query: 138 FLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYW-TFAVPLSVWI--VVFWILLTASN 194
           F S +   A  + YWF+  V+ A +L+ +  ++ YW T +     W   ++FW  + + N
Sbjct: 126 FGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFPYWAASLIFWFFVLSLN 185

Query: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGA-LGFRYWKNPGPWGMGMIS 253
           +I VRFYGE E+W+A LKV++I  F I ++++  G + +   +GF+ W          + 
Sbjct: 186 VIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYIGFKNWT---------VG 236

Query: 254 SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313
              +   F G+ S  + A+F Y GTE + +T+GES NP +  PK +  VF+RILFFYI +
Sbjct: 237 EAPFVDGFKGFASLFVSASFAYGGTESITLTSGESDNPLRNTPKIVKTVFWRILFFYIGT 296

Query: 314 LFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNI 373
            FF+ + VPY  P LS+ S   + TSPF +  + +GT    S  N VI+ +++SA N  +
Sbjct: 297 TFFIAMNVPYNYPGLSSGS---VVTSPFTIVFKMAGTAGAGSFMNAVIMTSVISACNHAL 353

Query: 374 YIGSRVLYGLSKSGLAP-SLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLL 432
           + GSR++Y +   G  P S+  +TN+  VP+ AVL +   G L +      A  ++ WL 
Sbjct: 354 FAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLCFGASFIGAGTLWTWLQ 413

Query: 433 TITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQ 492
            I  V+   AWL I+++ IRF Q L+ +    ++L FK    P+G Y+    +T IIL+Q
Sbjct: 414 NIVGVSNQLAWLCIAITSIRFRQGLEAQN-KTHELKFKNWTYPFGPYFLVVAVTFIILVQ 472

Query: 493 GFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDR 544
           G+ SFAP  V S F + YI +F+F  C++ +  L+K    ++ +D+D  TD+
Sbjct: 473 GWSSFAPWNV-SNFFSVYIELFVFPFCFIIWW-LYKRDPFVKCKDMDFVTDK 522

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,731,459
Number of extensions: 2464508
Number of successful extensions: 11017
Number of sequences better than 10.0: 449
Number of HSP's gapped: 9830
Number of HSP's successfully gapped: 468
Length of query: 570
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 455
Effective length of database: 40,294,809
Effective search space: 18334138095
Effective search space used: 18334138095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)