Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10861.82ON2091209192630.0
AFR669W1.82ON1918124832500.0
SAKL0C02618g1.82ON198867219710.0
Kwal_33.133921.82ON196863219700.0
NCAS0A005901.82ON194661819480.0
KAFR0D039501.82ON195761719420.0
YNL271C (BNI1)1.82ON195363019290.0
Smik_14.661.82ON195263019240.0
Suva_14.711.82ON194862919210.0
KLTH0F02376g1.82ON197651218770.0
TDEL0C061901.82ON187963918630.0
Skud_14.691.82ON194662918630.0
CAGL0J08206g1.82ON189861718560.0
NDAI0F042201.82ON202261018430.0
KNAG0F004701.82ON202860918400.0
TBLA0A054401.82ON217063118390.0
TPHA0B044901.82ON194064018210.0
KLLA0C02321g1.82ON184259717960.0
Kpol_2000.661.82ON193062417620.0
ZYRO0F16676g1.82ON199460817320.0
NCAS0G001205.717ON13144288601e-93
AFR301C5.717ON16554238574e-92
CAGL0H06765g5.717ON12944998361e-90
Ecym_40045.717ON14544208348e-90
SAKL0E15224g5.717ON13354218309e-90
Ecym_5679na 1ON13064668253e-89
TDEL0F055605.717ON12924858234e-89
ZYRO0B16654g5.717ON14244198161e-87
Kwal_55.196205.717ON13894317944e-85
Kpol_416.105.717ON14914267965e-85
AGL364Cna 1ON12604177852e-84
KLLA0F10912g5.717ON12834847711e-82
KLTH0E00704g5.717ON13894177632e-81
KNAG0L022505.717ON13674237562e-80
NDAI0F001605.717ON13494257481e-79
Smik_9.95.717ON13744937446e-79
Skud_9.85.717ON13744967364e-78
YIL159W (BNR1)5.717ON13754947312e-77
KAFR0D021205.717ON13244167222e-76
TPHA0E001205.717ON16424297218e-76
Suva_9.265.717ON13754327142e-75
TBLA0E018105.717ON14514857152e-75
SAKL0A03190g6.269ON1553132880.26
Smik_12.1658.295ON490964774.4
Skud_4.202.30ON746111765.9
TBLA0D031305.222ON678106748.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1086
         (2091 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...  3572   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...  1256   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   763   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   763   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...   754   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   752   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   747   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   745   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   744   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   727   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   722   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   722   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   719   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           714   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     713   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   712   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   706   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   696   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   683   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   671   0.0  
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      335   1e-93
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   334   4e-92
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   326   1e-90
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   325   8e-90
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   324   9e-90
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   322   3e-89
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   321   4e-89
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   318   1e-87
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   310   4e-85
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   311   5e-85
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   306   2e-84
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   301   1e-82
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   298   2e-81
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   295   2e-80
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     292   1e-79
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   291   6e-79
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   288   4e-78
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   286   2e-77
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   282   2e-76
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   282   8e-76
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   279   2e-75
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   280   2e-75
SAKL0A03190g Chr1 complement(290009..294670) [4662 bp, 1553 aa] ...    39   0.26 
Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa]...    34   4.4  
Skud_4.20 Chr4 complement(31386..33626) [2241 bp, 746 aa] {ON} Y...    34   5.9  
TBLA0D03130 Chr4 complement(758404..760440) [2037 bp, 678 aa] {O...    33   8.6  

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score = 3572 bits (9263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1807/2091 (86%), Positives = 1807/2091 (86%)

Query: 1    MKRSTHSNKSSKGQHSHFSXXXXXXXXXXXXXXXXLFSNLMKLTGSSSALSQQRIATXXX 60
            MKRSTHSNKSSKGQHSHFS                LFSNLMKLTGSSSALSQQRIAT   
Sbjct: 1    MKRSTHSNKSSKGQHSHFSNGHGGTNTPINGGGGGLFSNLMKLTGSSSALSQQRIATSDI 60

Query: 61   XXXXXXXXXXXLDLSTAKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXX 120
                       LDLSTAKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLG         
Sbjct: 61   SSPKKVSIPSSLDLSTAKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGSPSKYSYSK 120

Query: 121  XXXXXXGGNSNKXXXXXXXXXXXXXTLSRQPTXXXXXXXXXXXXVTLLQKITDSDGNLSL 180
                  GGNSNK             TLSRQPT            VTLLQKITDSDGNLSL
Sbjct: 121  RSSQWSGGNSNKQLLLLPQPQHSQHTLSRQPTNQSNNSDNSFSSVTLLQKITDSDGNLSL 180

Query: 181  EKPKYPXXXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNN 240
            EKPKYP            KRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNN
Sbjct: 181  EKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNN 240

Query: 241  VPQSTVADPLSNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKII 300
            VPQSTVADPLSNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKII
Sbjct: 241  VPQSTVADPLSNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKII 300

Query: 301  SDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXK 360
            SDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQR             K
Sbjct: 301  SDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRESLESLLDSDLLEK 360

Query: 361  ETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELK 420
            ETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELK
Sbjct: 361  ETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELK 420

Query: 421  TADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLY 480
            TADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLY
Sbjct: 421  TADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLY 480

Query: 481  VLEYTLDGRGRMGSLVGASEDYKNGENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRL 540
            VLEYTLDGRGRMGSLVGASEDYKNGENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRL
Sbjct: 481  VLEYTLDGRGRMGSLVGASEDYKNGENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRL 540

Query: 541  KSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNF 600
            KSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNF
Sbjct: 541  KSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNF 600

Query: 601  WTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTES 660
            WTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTES
Sbjct: 601  WTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTES 660

Query: 661  GFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXX 720
            GFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQA          
Sbjct: 661  GFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQG 720

Query: 721  XXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAV 780
                  RILEKSNRVTDQ                         MLTILNSKPNDASNDAV
Sbjct: 721  EVQQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTILNSKPNDASNDAV 780

Query: 781  SPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKM 840
            SPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKM
Sbjct: 781  SPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKM 840

Query: 841  DDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQ 900
            DDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQ
Sbjct: 841  DDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQ 900

Query: 901  ESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGD 960
            ESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGD
Sbjct: 901  ESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGD 960

Query: 961  ASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVDPTTANSGADISTS 1020
            ASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVDPTTANSGADISTS
Sbjct: 961  ASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVDPTTANSGADISTS 1020

Query: 1021 ISTDDFNIDNTSLPSTVVEGSPSSYFKKASLXXXXXXXXXXXXXXXLSAETAEDSNKNNE 1080
            ISTDDFNIDNTSLPSTVVEGSPSSYFKKASL               LSAETAEDSNKNNE
Sbjct: 1021 ISTDDFNIDNTSLPSTVVEGSPSSYFKKASLSTFASSSFSTDAEDELSAETAEDSNKNNE 1080

Query: 1081 DSVVGEHGVSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXX 1140
            DSVVGEHGVSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRL     
Sbjct: 1081 DSVVGEHGVSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLSSSSA 1140

Query: 1141 XXXXXXXQRNSGYHRKSFVNRMKKNSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSS 1200
                   QRNSGYHRKSFVNRMKKNSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSS
Sbjct: 1141 FRAGDSSQRNSGYHRKSFVNRMKKNSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSS 1200

Query: 1201 STPQSAKSEDAVGIGIFSKGTNTGMAVDTANDGQTPWIENGEDSIXXXXXXXXXXXXXXX 1260
            STPQSAKSEDAVGIGIFSKGTNTGMAVDTANDGQTPWIENGEDSI               
Sbjct: 1201 STPQSAKSEDAVGIGIFSKGTNTGMAVDTANDGQTPWIENGEDSISPMSPSKRNSKSKNV 1260

Query: 1261 XXXXXXAXXXXXXXXMFVXXXXXXXXXXXXXXXXXXXXREGISLSTXXXXXXXXXXXNLF 1320
                  A        MFV                    REGISLST           NLF
Sbjct: 1261 SKGVSKAPLPPPLPPMFVNNNNNNNNNNNNNNDNNNNNREGISLSTAPLPPAPALPANLF 1320

Query: 1321 GNTSLPPTPTVQDDDHENESIPLAPPQPPVFRNISAETKXXXXXXXXXXXXXXXXXQLGR 1380
            GNTSLPPTPTVQDDDHENESIPLAPPQPPVFRNISAETK                 QLGR
Sbjct: 1321 GNTSLPPTPTVQDDDHENESIPLAPPQPPVFRNISAETKPGAAPGGPPPPPPPPPPQLGR 1380

Query: 1381 TKKYKGXXXXXXXXXXXXXFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYE 1440
            TKKYKG             FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYE
Sbjct: 1381 TKKYKGSSPSPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYE 1440

Query: 1441 RGVLTELEKAFAAREIKSLISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKIL 1500
            RGVLTELEKAFAAREIKSLISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKIL
Sbjct: 1441 RGVLTELEKAFAAREIKSLISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKIL 1500

Query: 1501 KCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQR 1560
            KCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQR
Sbjct: 1501 KCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQR 1560

Query: 1561 ADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVF 1620
            ADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVF
Sbjct: 1561 ADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVF 1620

Query: 1621 DVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQ 1680
            DVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQ
Sbjct: 1621 DVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQ 1680

Query: 1681 ELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLP 1740
            ELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLP
Sbjct: 1681 ELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLP 1740

Query: 1741 EARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKK 1800
            EARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKK
Sbjct: 1741 EARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKK 1800

Query: 1801 MEEEERAYERRKIMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEK 1860
            MEEEERAYERRKIMIEEQQKRARKNIQIDT                 GDDRDVMDRLLEK
Sbjct: 1801 MEEEERAYERRKIMIEEQQKRARKNIQIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEK 1860

Query: 1861 LKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPA 1920
            LKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPA
Sbjct: 1861 LKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPA 1920

Query: 1921 ILGSPTSTVGATADVEGLNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHR 1980
            ILGSPTSTVGATADVEGLNPDHDLPSAPISAEKG              KKILDEDAVTHR
Sbjct: 1921 ILGSPTSTVGATADVEGLNPDHDLPSAPISAEKGSVSSALSHSSESPSKKILDEDAVTHR 1980

Query: 1981 ARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNKKLIEESGGNNTSNEVMEAVRSTENH 2040
            ARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNKKLIEESGGNNTSNEVMEAVRSTENH
Sbjct: 1981 ARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNKKLIEESGGNNTSNEVMEAVRSTENH 2040

Query: 2041 ESTPNFKSVSPNNDIPITTPSAIHTLRTGSTPSTDETSEDDLNDKYVDADT 2091
            ESTPNFKSVSPNNDIPITTPSAIHTLRTGSTPSTDETSEDDLNDKYVDADT
Sbjct: 2041 ESTPNFKSVSPNNDIPITTPSAIHTLRTGSTPSTDETSEDDLNDKYVDADT 2091

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score = 1256 bits (3250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1248 (57%), Positives = 849/1248 (68%), Gaps = 70/1248 (5%)

Query: 1    MKRSTHSNKSSKGQHSHFSXXXXXXXXXXXXXXXXLFSNLMKLTGSSSALSQQRIATXXX 60
            MK+STHSNK SK QH+                   LFSNLMKLTGSS +   QRIAT   
Sbjct: 1    MKKSTHSNKHSKTQHA--GQVAGATHANGGHSGGGLFSNLMKLTGSSGS---QRIATSDI 55

Query: 61   XXXXXXXXXXXLDLSTAKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXX 120
                       LDLS AKPL+K +T+N S+L Q + E+ Q+R+ SG              
Sbjct: 56   SSPKKVTLPSNLDLSGAKPLNKLNTINASNLPQVSGEVTQARSASGAALSSPSKYSYSKR 115

Query: 121  XXXXXXGGNSNKXXXXXXXXXX----------XXXTLSRQPTXXXXXXXXXXXXVTLLQK 170
                     +N                         L+RQ T            ++LL K
Sbjct: 116  SSQWASSKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMTNQSNYSASSYTSLSLLHK 175

Query: 171  ITDSDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDL 230
             TD DG L+LEKP+ P            KRNI  SVSVH HRELM Y +DKKWLMVKQDL
Sbjct: 176  ATDIDGTLTLEKPEDPQEIEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDL 235

Query: 231  QAELKRMKNNVPQSTVADPLSNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHL 290
            Q E K+MKN++P S+  + +++S  L    G   SS    RSISQNSAK +AV+Y+P+HL
Sbjct: 236  QTEYKKMKNSMPPSSTVESIASSA-LAKSPGGSISSGSITRSISQNSAKPMAVAYEPAHL 294

Query: 291  SPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRXXXX 350
            SPDHYVRKIISDR+TA ELNDLW+SLRTESIDWVIGFIDAQGQVAIANRL+KF QR    
Sbjct: 295  SPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLD 354

Query: 351  XXXXXXXXXKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETL 410
                     KE AYYKCLRVLTNLREGMQ AL SKLVIS+VVEGLLS RL+TRR+ATETL
Sbjct: 355  ILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETL 414

Query: 411  LYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHV 470
            LYML+DDELKTADT  DAIFP+L ALDQESK++++IHLRGRLHETNKR+SLPTGRAD HV
Sbjct: 415  LYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHV 474

Query: 471  IAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKNGENTVLEYLLYSMILINLLCSSHPDL 530
            +AK++EQWLYV+EYTLDGRGRMGSLVGAS+DYK GENTVLEYLLYSMIL+NLLCS+HPD+
Sbjct: 475  VAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYKGGENTVLEYLLYSMILLNLLCSNHPDV 534

Query: 531  HQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDM 590
             QRNLLRSRLKSYGL+R+IKKMELLKYPALENEV KFED TLDDYN LM S+TVDS+VDM
Sbjct: 535  QQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDM 594

Query: 591  KDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSN 650
            KDP +LW +FWT+H+GTE+E HLLSL+QHLFLW S+AF+E  DPAE  KQLKLLDALV+N
Sbjct: 595  KDPAALWQDFWTQHRGTEAEGHLLSLLQHLFLW-SRAFAEYRDPAESIKQLKLLDALVTN 653

Query: 651  VTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQA 710
            VTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKK EE+KAERD+L +KL+QA
Sbjct: 654  VTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQA 713

Query: 711  XXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNS 770
                            RILEKSNRVTDQ                         MLTILNS
Sbjct: 714  QNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELRKMLTILNS 773

Query: 771  KPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPN 830
            KP+    +  SP+ +N  TPSPLKPEKKMAIQKALQDRLRQTEKDLTRDS+R  TVPAPN
Sbjct: 774  KPH--GENGGSPE-VNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPN 830

Query: 831  RRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKIERNVRSEKVKELAA 890
            RRLKMLRSKMD IEKEA +LEMTNFA+FKKE + E+ P+L SPPKI+R++R E+VKELAA
Sbjct: 831  RRLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENEPKLLSPPKIQRSLRGEQVKELAA 890

Query: 891  LRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELL 950
            LR+RLA+IQQESNE+SKFNVEERVNELFYEKK KALDRLRDLE KY+ FGIDFN + EL+
Sbjct: 891  LRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPELM 950

Query: 951  IETDREGDGDASVGEAS---NSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVD 1007
              + R  +G   +   +    S+AP       LDPA LDAKIEEMTKIL+ LN+LK  +D
Sbjct: 951  --SLRLANGSVDLDGPTIDLESSAP-------LDPAHLDAKIEEMTKILDRLNKLKKDID 1001

Query: 1008 -PTTANSGADISTSISTDDFNIDNTSLPSTVVEGSPSSYFKKASLXXXXXXXXXXXXXXX 1066
              +   S ++ S SIST++   +N+S  S +   SP S  K +                 
Sbjct: 1002 MSSVGTSTSNESASISTEELAGNNSS-HSEISCTSPHSLSKPS----------------- 1043

Query: 1067 LSAETAEDSNKNNEDSVVGEHGVSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQ 1126
            +S+ T     +   D+           S +M  + +    SN SFLE+LSQKYGTG+   
Sbjct: 1044 ISSTTGGSDAETAADAADDISDNDDETSSSMIVTGAEAIISNASFLETLSQKYGTGS--- 1100

Query: 1127 PAEDGAKRLXXXXXXXXXXXXQR-------NSGYHRKSFVNRMKKNSTPKSSSFVDEVSQ 1179
              + GA  +            +R       NSG HRKSFVNRMK+  TP SS+F++E++Q
Sbjct: 1101 --QSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKRTITPTSSNFLEELTQ 1158

Query: 1180 KMTPVHVAQSPDSLQNTATSSSTPQSAKSEDAVGIGIFSKGTNTGMAV 1227
            K++P   +QS  S + +AT   TPQS KS+ A    IF+ G +    V
Sbjct: 1159 KVSPAR-SQSARSSRGSAT---TPQSIKSDAA---DIFTAGQDKTAVV 1199

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/631 (72%), Positives = 504/631 (79%), Gaps = 58/631 (9%)

Query: 1377 QLGRTKKYKGXXXXXXXXXXXXXFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFAD 1436
            QLGR+K Y G             FE+YPRPKK+LKQLHWEKIDD DNSIWENARAEKFAD
Sbjct: 1345 QLGRSKTY-GGSPSPLLPQSPSLFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFAD 1403

Query: 1437 DLYERGVLTELEKAFAAREIKSLISRKKDEN-KVTFLSRDISQQFGINLHMYSSLTVDQI 1495
            DLYE+GVL+ELEKAFAAREIKS   RKKDEN K+TFLSRDISQQFGINLHMYSSL V  +
Sbjct: 1404 DLYEKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAV 1463

Query: 1496 VTKILKCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDP 1555
            V+KILKCDKDFL+TQSAIEFLSK EIVEVS NMAR FAPYTTDWEGVSSVE+AK PEKDP
Sbjct: 1464 VSKILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDP 1523

Query: 1556 NELQRADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSEN 1615
            +ELQR+DQL+L+LIVNLQSYW+SRMR LKLITTYEKDYNDLIIKLRSLDKAVGAIQKSEN
Sbjct: 1524 SELQRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSEN 1583

Query: 1616 LRNVFDVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGF 1675
            LRNVFDVILAVGNYMND+SKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVE+IV  NYP F
Sbjct: 1584 LRNVFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSF 1643

Query: 1676 DVFLQELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKV 1735
            + FLQELEPVLQVVKISIEQLANDC EFCSTVTNVERSLEIGNLSDSSKFHP+DRVLAKV
Sbjct: 1644 NSFLQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKV 1703

Query: 1736 LPVLPEARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQ 1795
            LP+LPEARK+ANLLADEVQLSLMEFE+LMR+FGED+DDKFAKNSFF+KFADFILEYKRAQ
Sbjct: 1704 LPILPEARKKANLLADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQ 1763

Query: 1796 EFNKKMEEEERAYERRKIMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMD 1855
            EFN+K++EEERAYERRK+MI+EQQ+RA+   + D                  GDDRDVMD
Sbjct: 1764 EFNRKIDEEERAYERRKLMIQEQQRRAKLVQEGD-----ETTCARLSAISASGDDRDVMD 1818

Query: 1856 RLLEKLKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQS 1915
            +LLEKLKNAGPSK DPSSARKRALARKKLM G++ GSIIL+GLDV++L +          
Sbjct: 1819 KLLEKLKNAGPSKGDPSSARKRALARKKLMGGRE-GSIILEGLDVDDLQS---------- 1867

Query: 1916 DSNPAILGSPTSTVGATADVEGLNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDED 1975
                           A  DV+   PD  L +A  S                        D
Sbjct: 1868 ---------------AAPDVQ---PDTPLRAASASPPP---------------------D 1888

Query: 1976 AVTHRARNLLQELRSSDDHTEDRKSLLDEHK 2006
                RAR+LL ELR+  +H E RKS+LDEHK
Sbjct: 1889 PAADRARHLLLELRNG-EHPESRKSMLDEHK 1918

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/672 (61%), Positives = 506/672 (75%), Gaps = 39/672 (5%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FE+YPRPKK+LKQLHWEKI+D  NSIW++A+AEK+ADDLYERGVL +LEKAFAAREIK L
Sbjct: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366

Query: 1460 ISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             +R+K D NKVTFLSRD+SQQFGINLHMY++L+V ++V KIL+CDKDFL + S I+FL K
Sbjct: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EIVEVS N+AR FAPY+T+WEGVSSV+EAK PEKDP ELQRADQLYL+++VNLQ YW S
Sbjct: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRALK+ITTYEK+Y+DL+ KLRS+DKAV +IQ S+NLR+VF+VILAVGNYMNDSSKQA 
Sbjct: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKL+TLQRLTFIKDEKNSMTFLNYVEKI+R NY  F+ FLQELEPVL VVKIS+EQLA 
Sbjct: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC EF   + NVERS+E+GNLSDSSKFHP DRVL KVLPVLPEARKR++LL+DEV+L+LM
Sbjct: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EF+ LM++FGED+ DKFAKNSFF+KFADFI EYK+AQ  N KMEEEERAYERRK M+EEQ
Sbjct: 1667 EFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEEEERAYERRKKMVEEQ 1726

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
             KRAR  ++ +                  G +RDVMD+LLEKLKNAGP K+DPSSARKRA
Sbjct: 1727 HKRAR--LEAEKGGVDDGSEAEGVTAVSRG-ERDVMDKLLEKLKNAGPGKSDPSSARKRA 1783

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGL 1938
            LARKKL+DGK+S + ILD  +V+E A +           N +++ SP +T+ A       
Sbjct: 1784 LARKKLLDGKRSSANILDNFEVDEAAPV-----------NQSLVYSPETTLKAA------ 1826

Query: 1939 NPDHDLPSAPISAEKGXXXXXXXXXX----XXXXKKILDEDAVTHRARNLLQELRSSDDH 1994
            N  H     P ++ +G                  +     + V  RARNLL+ELR  +  
Sbjct: 1827 NAAHAESPTPKASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPE-- 1884

Query: 1995 TEDRKSLLDEHKEKVRQRRNKKLIEESGGNNTSNEVM----EAVRSTENHESTPNFKSVS 2050
            +E RK LL++H+EK+R RR +  + E  G ++ N+++     +   T++H+  PN  +  
Sbjct: 1885 SEKRKPLLEDHREKMRARRRR--VNE--GASSENKLVFVGGASEAPTDSHKGLPNDTTA- 1939

Query: 2051 PNNDIPITTPSA 2062
               DIP T  SA
Sbjct: 1940 ---DIPATPVSA 1948

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1037 (43%), Positives = 603/1037 (58%), Gaps = 106/1037 (10%)

Query: 36   LFSNLMKLTGSSS-ALSQQRIATXXXXXXXXXXXXXXLDLSTAKPLSKHSTLNTSSLSQY 94
            LFSNL KLTGS + A +  +I                 + S  KPLSK +TLNT +LS Y
Sbjct: 27   LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFS-GKPLSKQTTLNTQNLSSY 85

Query: 95   AD--EIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXXXXXXXXXXXTLSRQPT 152
             D      +R+PSG                      +                 LSRQ T
Sbjct: 86   VDMNTPHHNRSPSG------------MSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQT 133

Query: 153  XXXXXXXX--XXXXVTLLQKITDSDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHS 210
                          +T L K   +DG + L++P  P            KRN   S+    
Sbjct: 134  NQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAG 193

Query: 211  HRELMGYDLDKKWLMVKQDLQAELKRMKNN------------------------------ 240
             +ELM YDLDKKWL+VKQDLQ+ELK++ N                               
Sbjct: 194  QKELMNYDLDKKWLLVKQDLQSELKKLANKKNTHVAPAGAAGLAATISAATQGTSGAGGV 253

Query: 241  ----VPQSTVADPLSNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPDHYV 296
                  Q+      S S  +    G + S N       QNS+    +S DP HLSPD+YV
Sbjct: 254  GGVDGTQAGSKGHNSTSSPILGGGGFYESGN-------QNSSTA-TLSQDPLHLSPDYYV 305

Query: 297  RKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXX 356
            RKIISD+I+  +L DLWVSLRTE +DWV+GF+DAQGQVAIAN L++F  +          
Sbjct: 306  RKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDE 365

Query: 357  XXXKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTD 416
               KE A++KCL+ L NL+EG   A+ +KLV+SA+ +GLLS+R++TRRIA+E L+++   
Sbjct: 366  ALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFI--- 422

Query: 417  DELKTADTDFDAIF---PVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVI-- 471
                   T +D  +    V+  LDQES  SS++HL+ RL   NKR SL     +L +   
Sbjct: 423  -------TQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRD 475

Query: 472  --AKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLLCSSH 527
              +KK EQWL+V+EYTLDGRG+MGSLVGASED+K+  GEN +LEY   +++L+N LC++ 
Sbjct: 476  HASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTP 535

Query: 528  PDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSS 587
             D++QR LLRSR KS GLSR+++K+ELL Y  ++ ++  FEDRT DDYN++MAS +++ +
Sbjct: 536  ADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHN 595

Query: 588  VDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDAL 647
            VDM++P SL  N W  +KGT +E +L+SL+QHLF+ SSK   E  DP E SKQLKL+D+L
Sbjct: 596  VDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSL 655

Query: 648  VSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKL 707
            VSNVT SSIDTES FNGAIQRLYD+MQTDEVARRAI+E+RELT+K EE+KAERD+L  KL
Sbjct: 656  VSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKL 715

Query: 708  AQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTI 767
            ++A                RILEK+ RVT+Q                         +LTI
Sbjct: 716  SKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLLTI 775

Query: 768  LNSKPNDASNDAVSPDGI-NNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTV 826
            LNS+P  +S       G  ++  P  L  ++K+AIQKALQDRL+QT+KDLT++S+R GT 
Sbjct: 776  LNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTT 835

Query: 827  PA----PNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQS---------- 872
                  PNRRLK+LRS+M+DIE EA  LEMTNFA+ +++T  E                 
Sbjct: 836  LGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVLDR 895

Query: 873  PPKIERNVRSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDL 932
             PK ++ V+ ++V++L  LRQRLA +Q+ESN++SKFNVEER+NELF +KK  ALDRL++L
Sbjct: 896  APKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKEL 955

Query: 933  EEKYRSFGIDFNMESELLIETDREGDGDASVGEA--SNSTAPNSLDSCVLDPARLDAKIE 990
            E KY+ FGIDF  + EL           A + +A   N  A +      LDP  L  KIE
Sbjct: 956  ETKYKGFGIDFQADPEL----------SAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIE 1005

Query: 991  EMTKILEELNRLKCQVD 1007
            EM+KI++EL   K +++
Sbjct: 1006 EMSKIVDELTAFKKEIE 1022

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (44%), Gaps = 20/137 (14%)

Query: 1106 TSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQRNSGYHRKSFVNRMKKN 1165
             S  SFLE+LSQKYGTG N  P       +                GYHR+SF+ R+KK+
Sbjct: 1050 ASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYP-------GRGYHRRSFMERVKKS 1102

Query: 1166 STPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSSSTPQSAKSEDAVGIGIFSKGTNTGM 1225
                ++ F+ E++QK+ P         ++  A S         E+ +GIGI SK    G 
Sbjct: 1103 D---AAPFLSELTQKVAPKTPIDGAYEIEVGARS--------EEEHIGIGIPSK--RNGT 1149

Query: 1226 AVDTANDGQTPWIENGE 1242
             V+   D     + N E
Sbjct: 1150 VVEGMKDADNSGVSNAE 1166

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/632 (60%), Positives = 475/632 (75%), Gaps = 35/632 (5%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FE+YPRP K+LKQLHWEKIDD ++SIW+NA+AE+FADDLYE+G+L+ LEKAFAAREIKSL
Sbjct: 1315 FERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAFAAREIKSL 1374

Query: 1460 ISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             SRKK D +K+TFLSRD+SQQFGINLHMYSSL+V+++VTKILKCDKDFL T S IEFLSK
Sbjct: 1375 TSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTPSVIEFLSK 1434

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EIVEVS N+AR FAPYTTDWEG+++V++AK PEKDP+ELQRAD+LYL+L VNLQ YW+S
Sbjct: 1435 QEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRLYLELFVNLQGYWSS 1494

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRALK+IT+YEK+Y+DLI KLR +DKA  AIQ+SENLRNV DVILAVGN+MNDSSKQAQ
Sbjct: 1495 RMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1554

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GF+L+TLQRLTFIKD+KNSMTFLNYVEKIVR  YP F+VFL+ELEPV+  VKISIEQ++ 
Sbjct: 1555 GFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAAVKISIEQVSQ 1614

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC EF  +V NVERS++IGNLSDSSKFHP DR L KVLPVLPEARK+ +LL DE++L+L+
Sbjct: 1615 DCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDLLMDEMKLTLL 1674

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EF++LM++FGED+ DKF++NSFF+KFADF+ EYK+AQ +N K+EEEE+AYERRK M+EEQ
Sbjct: 1675 EFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAYERRKKMVEEQ 1734

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            Q+RAR     ++                   DRDVMDRLLEKLKNAGP K+DPSSARKRA
Sbjct: 1735 QRRAR-----ESNEQENSVDGNADDNTAASGDRDVMDRLLEKLKNAGPGKSDPSSARKRA 1789

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGL 1938
            +AR+KL+ G  S S ILD  ++E+                 +++ SP     + +     
Sbjct: 1790 IARRKLLQGSSSNSTILDNFEIEK-------------PEGKSLVYSPEQVTLSNS----- 1831

Query: 1939 NPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTEDR 1998
              DH  P+  +   +G                  +   +T RARNLL ELR  +  +  R
Sbjct: 1832 -VDHS-PTPDVRKREGQSTASEVQTS--------ESSDLTDRARNLLIELRGPESPSR-R 1880

Query: 1999 KSLLDEHKEKVRQRRNKKLIEESGGNNTSNEV 2030
             S  D+   K+R RR       SG +N  N V
Sbjct: 1881 ASSKDQRISKLRARRKNDGSGNSGSDNHLNFV 1912

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1142 (36%), Positives = 605/1142 (52%), Gaps = 117/1142 (10%)

Query: 36   LFSNLMKLTGSSSALSQQRIATXXXXXXXXXXXXXXLDLS--TAKPLSKHSTLNTSSLSQ 93
            +FSNL +LTG+++  S Q +                 D    + KPLSK STLN ++LS 
Sbjct: 27   IFSNLKRLTGNANNSSSQTLQKVDISDISSPKKINLPDTGEFSHKPLSKQSTLNIANLSA 86

Query: 94   YADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXXXXXXXXXXXTLSRQPTX 153
            Y D +A +   S   +                   N                 LSRQ T 
Sbjct: 87   YTD-VASTHNRSSSAASNSSPTKYSYSRRASQWSSNGG---------TAPSTKLSRQQTN 136

Query: 154  XXXXXXXXXXXVTL--LQKITDSDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHSH 211
                        +   L K    DG++ LEKP+ P            KRN+  S+   + 
Sbjct: 137  QSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKRNVYQSLPPSAQ 196

Query: 212  RELMGYDLDKKWLMVKQDLQAELKRMKNNVPQSTVADPLSNSVHLKSPR----GSFSSSN 267
            +EL  YDL+KKWLMV+QDLQ+E+K+  NN   S      S  + L +P     G F+S++
Sbjct: 197  KELNNYDLEKKWLMVRQDLQSEVKKFMNNKSVSKSPAAASTGISLIAPESPSTGHFASNS 256

Query: 268  M-------SARSISQN-------------SAKQLAVSYDPSHLSPDHYVRKIISDRITAY 307
                    S+RS +QN             ++    +S DPSHLSPD+YVRKII + I+A 
Sbjct: 257  SINESLAGSSRSRAQNPGTSDQFYGSNNGTSSTTTLSQDPSHLSPDYYVRKIICNNISAK 316

Query: 308  ELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKC 367
             LNDLWVSLRTE +DWV+GF++AQGQVAIAN ++K   R             KE AY+KC
Sbjct: 317  RLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKC 376

Query: 368  LRVLTNLREGMQAALSSKLVISAVV---EGLLSIRLTTRRIATETLLYMLTDDELKTADT 424
            L+   NL+EG   A+ S      +    EGLLS+R+ TRRIA+E LL  L+   L    T
Sbjct: 377  LKTSLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRIASE-LLVSLSQWALPHGFT 435

Query: 425  DFDAIFPVLHALDQESKYSSSIHLRGRL-HETNKRRSLPTGRADLHV------IAKKIEQ 477
                   V++ALDQES++  ++HL+ RL  +T+ +    + R+ L        I +K EQ
Sbjct: 436  H------VMNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLADNNGDRIMRKFEQ 489

Query: 478  WLYVLEYTLDGRGRMGSLVGASEDYK--NGENTVLEYLLYSMILINLLCSSHPDLHQRNL 535
            W+ V+EYTLDGRG+MGSLVGASED++   GEN ++EY   +++L+N LC +  D+ QR +
Sbjct: 490  WMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQTPVDVKQRTI 549

Query: 536  LRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPES 595
            LR+RLK+ GL R++ KM+ L Y  ++ +++ FED T DD+++L +       ++M+DP S
Sbjct: 550  LRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGELINMQDPVS 609

Query: 596  LWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSEST-DPAEGSKQLKLLDALVSNVTFS 654
            +  N W   KGTE+E HL+SL+Q+L + + +    S  DPA+ +KQLKL+DALVSNV+ +
Sbjct: 610  MTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVSNVSMA 669

Query: 655  SIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAXXXX 714
            S+D +S FN AIQRLYDAMQTDE+ARRAILE+R+  K+ EE+KAER++L+ KL+ A    
Sbjct: 670  SVDLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNLKEKLSNAEGGL 729

Query: 715  XXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPND 774
                         ILEKS RVT Q                          LT LNSK  D
Sbjct: 730  VGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRKTLTALNSKGGD 789

Query: 775  ASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLK 834
                 ++ DG     P PLKPE+ +AIQ+ALQ +L +T K++T +S R G    PN+RL+
Sbjct: 790  IQ---LTEDG---GQPKPLKPERMLAIQRALQIKLEKTSKEITVESSRLGVSLEPNKRLR 843

Query: 835  MLRSKMDDIEKEALMLEMTNFAEFK----KETKVEDLPRLQSPPKIERNVRSEKVKELAA 890
            +LRS+M++IE +A  LEMTNF+E++    KE ++        P  ++     +   +L  
Sbjct: 844  LLRSRMEEIENQARELEMTNFSEYREDADKEIEMAHEGTHMYPSDVDVGTTQDSNLKLEQ 903

Query: 891  LRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELL 950
            LR++LA +Q ESN+ISKFNVE R +E+F ++K +ALDRL+ LE  Y  FGI+++      
Sbjct: 904  LRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRLKKLENDYSGFGINYDPAESPS 963

Query: 951  IETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVDPTT 1010
            ++ ++  D + S                 LDP   +  ++E             Q++   
Sbjct: 964  LKQEQGQDVNKSR---------------TLDPKGPNNSVDE------------SQLETDR 996

Query: 1011 ANSGADISTSISTDDFNIDNTSLPSTVVEGSPSSYFKKASLXXXXXXXXXXXXXXXLSAE 1070
            AN  A I +S +++    ++  L  +  E    S+ ++ S                    
Sbjct: 997  AN--ASIDSSPASESLEEEDVHLTKSTTEEIGGSFLERLSQKYGKGQ------------- 1041

Query: 1071 TAEDSNKNNEDSVVGEHGVSPSGSVAMERS--DSILTTSNTSFLESLSQKYGTGTNLQPA 1128
                +N +N +SVVG     P GS    +S  + +  + N  +LE LS K+GT T+   +
Sbjct: 1042 ----ANLSNRNSVVGRENSYP-GSGYHRKSFMNRVKKSDNVPYLEELSGKFGTATHENES 1096

Query: 1129 ED 1130
            E+
Sbjct: 1097 EE 1098

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 58/133 (43%), Gaps = 37/133 (27%)

Query: 1090 SPSGSVAMERSDSILTTSNT-----SFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXX 1144
            S   S ++E  D  LT S T     SFLE LSQKYG G            L         
Sbjct: 1003 SSPASESLEEEDVHLTKSTTEEIGGSFLERLSQKYGKGQ---------ANLSNRNSVVGR 1053

Query: 1145 XXXQRNSGYHRKSFVNRMKK-NSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSSSTP 1203
                  SGYHRKSF+NR+KK ++ P    +++E+S K               TAT  +  
Sbjct: 1054 ENSYPGSGYHRKSFMNRVKKSDNVP----YLEELSGKF-------------GTATHEN-- 1094

Query: 1204 QSAKSEDAVGIGI 1216
               +SE+  GIGI
Sbjct: 1095 ---ESEENFGIGI 1104

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/618 (62%), Positives = 466/618 (75%), Gaps = 31/618 (5%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FE YPRP+K+LKQLHWEK+D  DNSIW+  +AEKFADDLYE+GVLT+LEKAFAAREIKSL
Sbjct: 1288 FENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSL 1347

Query: 1460 ISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             S+KK D +K++FLSRDISQQFGINLHMY++L VD +V KILKCD+DFL+T S IEFLSK
Sbjct: 1348 ASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSK 1407

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EIVEVS+N+AR +APY+TDWEGV SVE+AK PEKDPNELQRADQLYL LI+NLQSYW S
Sbjct: 1408 PEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGS 1467

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRAL +ITT++K+YN+L+ KLR +DKAV ++Q+SENL+NVF+VILAVGNYMND+SKQAQ
Sbjct: 1468 RMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQ 1527

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKL+TLQRLTFIKD  NSMTFLNYVEKIVR+NYP F+ FL ELEPVL VVKISIEQL +
Sbjct: 1528 GFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVS 1587

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC EF  ++ NVERS+E GNLSDSSKFHP DRVLAKVLP+LP+ARK+  LL DEV+L++M
Sbjct: 1588 DCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIM 1647

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EF  LM+++GEDS+DKFAKNSFF+KFADFI EYK+AQ  N K EEEE+ YER K M+E+Q
Sbjct: 1648 EFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEEEEQVYERHKKMVEDQ 1707

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            QK+    +Q                    GD R +MD+LL++LKNAGPSK DPSSARKRA
Sbjct: 1708 QKK----LQEQENGSNGSENGEEGSGDDSGDRRAMMDKLLDQLKNAGPSKTDPSSARKRA 1763

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQS-DGLDDQSDSNPAILGSPTSTVGATADVEG 1937
            L RKKLM      + +L  ++ E+ + I S +G       NP  L +P            
Sbjct: 1764 LVRKKLM---TESTALLKDIETEDDSIIYSPEG--KNPFVNPVDLDTPHD---------- 1808

Query: 1938 LNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTED 1997
               + D+ S+PI                       D+D VT RA+ LL ELR S+  ++ 
Sbjct: 1809 -ESEMDVSSSPIQRSLSPSRNSTLLSD--------DQDEVTDRAKALLMELRGSNTPSK- 1858

Query: 1998 RKSLLDEHKEKVRQRRNK 2015
            R SLLDEHKEK+R RR K
Sbjct: 1859 RNSLLDEHKEKLRARRRK 1876

 Score =  594 bits (1532), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 379/997 (38%), Positives = 540/997 (54%), Gaps = 115/997 (11%)

Query: 78   KPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXXX 137
            KPL+K ++LNT +LSQY ++    +                        G   N+     
Sbjct: 71   KPLNKKTSLNTQNLSQYINDKHSPQHTRSASVQSSSKYSYSRRSSSQTLGSTLNQ----- 125

Query: 138  XXXXXXXXTLSRQPTXXXXXXXXXXXXVTLLQKITDSDGNLSLEKPKYPXXXXXXXXXXX 197
                     ++RQ T             T L K    DG ++LE P+ P           
Sbjct: 126  ---------IARQHTNQSSASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIM 176

Query: 198  XKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMK------------------- 238
             KRNIL S+      ELM YDL+KKWL+VKQDLQ E+K+M+                   
Sbjct: 177  LKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKTNSTNTNNNNNNNRSSM 236

Query: 239  --NNVPQSTVADP----LSNSVHL------------------KSPRGSFS----SSNMSA 270
               N     +  P    +S   H+                  K P G  S    +++M  
Sbjct: 237  SPENSSTINLNSPATMQMSPHHHIGSNSNSSINSHHTPITISKRPTGPISNPIPNADMYK 296

Query: 271  RSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDA 330
             S+   S+  ++   D ++  P HYV++II+D IT+ E+ DLWV+LRTE IDWV  FI+ 
Sbjct: 297  LSMRNTSSSSMS---DKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEH 353

Query: 331  QGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAALSSKLVISA 390
            QG +A+AN L+K   +             KE A++KC RVL+ L +G++     +++   
Sbjct: 354  QGHIAMANILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQT 413

Query: 391  VVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRG 450
            V  GL SI L+TRR+ATE  + ML     K     F  I   L+ALDQ+ K   + H+  
Sbjct: 414  VARGLFSITLSTRRMATEIFVCMLE----KKNPERFKVI---LNALDQKFKIGYNAHM-- 464

Query: 451  RLHETNKRRSLPTGRADLHVIAK-KIEQ-WLYVLEYTLDGRGRMGSLVGASEDYKN--GE 506
                T   +  P     L + ++ K+ Q WL+ +E+TLDGRG+MGSLVGAS+D+KN  GE
Sbjct: 465  ----TQNIKMFPDYFTHLTLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGE 520

Query: 507  NTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSK 566
            N +LEY  +SMI IN LCS   +++QR LLR++L++ G+ R++ K++ L Y  +  ++  
Sbjct: 521  NAILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDL 580

Query: 567  FEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSK 626
            +E+  LDD N+L+ S+  +++++++DP S+  N W   KGTE+E  L+SLMQHLFL SS+
Sbjct: 581  YENNKLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQ 640

Query: 627  AFSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILES 686
               E  DP + S+QLKLLD+LV+NV+ SS D E+  N AIQRLYDAMQTDEVARR+ILES
Sbjct: 641  FIEEKKDPVKLSRQLKLLDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILES 700

Query: 687  RELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXX 746
            R LTKK EE++AERD L  KL  A                RIL K+ RV +Q        
Sbjct: 701  RTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEEL 760

Query: 747  XXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKT----PSPLKPEKKMAIQ 802
                             MLTILN++P     + V  +G + KT    PS L P KK +IQ
Sbjct: 761  KKKHLLEKHEQEVELRKMLTILNARP-----EIVEGNGTSKKTKAKNPSALDPSKKQSIQ 815

Query: 803  KALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKET 862
            +ALQD L +T+KD + D+R FG    PN+RLK+LR +M+DIE EA  LEMTNF E++K  
Sbjct: 816  QALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEYEKR- 874

Query: 863  KVEDLPRLQSPPKIERNVRSEK-------VKELAALRQRLAVIQQESNEISKFNVEERVN 915
                  +L++P KI++  +          + +L  LRQ LA IQ ESN+ISKFNV+ERVN
Sbjct: 875  ------KLEAPSKIKKPKKVATKKEIDPSINKLNDLRQTLAEIQMESNDISKFNVDERVN 928

Query: 916  ELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSL 975
            ELF +K+  AL RL+DLE KY+ FGIDFN++ EL+    ++ +G+             S 
Sbjct: 929  ELFNQKRITALKRLQDLETKYKDFGIDFNID-ELVDSASKDENGNNQ----------QSG 977

Query: 976  DSCVLDPARLDAKIEEMTKILEELNRLKCQVDPTTAN 1012
            D   LDP     K++E+ ++ +EL R+K +V+ +  N
Sbjct: 978  DYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNN 1014

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/617 (61%), Positives = 471/617 (76%), Gaps = 34/617 (5%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FE+YPR +K++KQLHWEKI+  DNSIW   +AE+FADDL+E+GV + LEKAFAARE+KSL
Sbjct: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359

Query: 1460 ISRKKDE-NKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             S++KD+ +K+TFLSRDISQQFGINLHMYSSL+V+ +VTKILKCD+DFL+T S IEFLSK
Sbjct: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EI EVS+N+AR ++PYTTDWEG+ S+E+AK PEKDPN+LQRADQ+YL L+VNLQ YW S
Sbjct: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRALK+ITTYEK+YN+L++KLR +DKAVG++Q+SENLRNVF+VILAVGNYMND+SKQAQ
Sbjct: 1480 RMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ FLQELEPVL+VVKISIEQLAN
Sbjct: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC EF  +VTNVERS+EIGNLSDSSKFHP DRVLAKVLP LP+ RK+ +LL DEV L+LM
Sbjct: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EF+ LM+++GED+ DKFA+NSFF+KFADFI EY++AQE N K+EEEE AYER K M+EEQ
Sbjct: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEEEEEAYERHKRMVEEQ 1719

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            Q++A +                        D R  MD+LLE+LKN GPS+ADPSSARKRA
Sbjct: 1720 QRKAERK----EAKNQNNIDENEDDDQERTDRRGTMDKLLEQLKNVGPSRADPSSARKRA 1775

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGL 1938
            LARKK++  K+    ++  L+ E      SD +    D N AI  +P    GA++     
Sbjct: 1776 LARKKMLTDKEGTVNMMHDLETE------SDSIIYSPD-NKAIGSTPFGANGASS----- 1823

Query: 1939 NPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTEDR 1998
               H   S  +S  KG              +  L E+ ++ RA+ LL  LR +   ++ R
Sbjct: 1824 ---HKQNSNELSPSKG-------------FRDDLSEEEISERAKTLLMGLRGTASPSK-R 1866

Query: 1999 KSLLDEHKEKVRQRRNK 2015
             S+LDEHKEK+R RR +
Sbjct: 1867 NSMLDEHKEKLRARRRR 1883

 Score =  559 bits (1441), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 366/988 (37%), Positives = 531/988 (53%), Gaps = 116/988 (11%)

Query: 75   STAKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXX 134
            +T KPL+K STLNT +LSQY D    S T S                       +S++  
Sbjct: 80   TTNKPLNKKSTLNTQNLSQYMDHARSSSTNS-----------------ASASKYSSSRRS 122

Query: 135  XXXXXXXXXXXTLSRQPTXXXXXXXXXXXXVTLLQ--KITDSDGNLSLEKPKYPXXXXXX 192
                        LSRQ T             + +   K    DG  +LE P+ P      
Sbjct: 123  STQVSTSESLRRLSRQHTGQSSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENL 182

Query: 193  XXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMK--NNVPQST----- 245
                  KRNIL ++SV   RELM YD+ KKWL+VKQD+Q E KR++   N P+++     
Sbjct: 183  FEEIMYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNV 242

Query: 246  ----------------------------VADPLSNSVH-LKSPRGSFSSSNMSARSISQN 276
                                        +A   SN  + + SP+    +S+     ++++
Sbjct: 243  EQLVYSPTTTTTNNNNNNNNSNYNNTSPMASVASNEYYPMTSPQTKKPTSH-ELYQLTES 301

Query: 277  SAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAI 336
            +A    +S D ++  P+ YV KII+D+++  E+ DLWV+LRTE +DWV  F++ QG +A+
Sbjct: 302  NASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAM 361

Query: 337  ANRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLL 396
            AN L+K   +             KE +++KC +VL+ L +G+      KL+   +  GL 
Sbjct: 362  ANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLF 421

Query: 397  SIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETN 456
            S RL TR++A E  + ML     K   + F+AI   L++LDQ  +  S+ H+   L    
Sbjct: 422  STRLGTRKMAIEIFVCMLE----KRNKSRFEAI---LNSLDQNFRIGSNFHMFQNL---- 470

Query: 457  KRRSLPTG----RADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKN--GENTVL 510
              + LP        D H+  K ++ WL+ +E T+DGRG+MGSLVGAS D KN  GEN +L
Sbjct: 471  --KKLPQYFIHLTPDSHL--KVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAIL 526

Query: 511  EYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDR 570
            EY L++M+ +N+LC++   + QR LLR++L++ G  R++ K++LL Y  + +E+  +E+ 
Sbjct: 527  EYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENN 586

Query: 571  TLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSE 630
             LDD+N ++ S   +S+V+++DP SL NN W   KGTE+E  L+SL+QHLFL SS+   E
Sbjct: 587  KLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEE 646

Query: 631  STDPAEGSKQLKLLDALVSNVTFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESREL 689
              DP + SKQLKL+D+LV+NV+ SS  D ES  N AIQRLYD+MQTDEVARRAILESR L
Sbjct: 647  VDDPTKLSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTL 706

Query: 690  TKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXX 749
            TKK EE++AE+D L  KL++A                +IL K+ RVT Q           
Sbjct: 707  TKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKK 766

Query: 750  XXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRL 809
                          MLTILN++   ++ND       +    S L  +K   IQK LQD L
Sbjct: 767  HLLEKHEHEVELRKMLTILNTR--SSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGL 824

Query: 810  RQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPR 869
             + + D T D+++FG    PN+RLKMLR +M+DIE EA  LEMTNF EF+++       +
Sbjct: 825  IRAKNDFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERK-------K 877

Query: 870  LQSPPKI------------------ERNVRSEKVKELAALRQRLAVIQQESNEISKFNVE 911
            L+ P ++                  E N +  ++ +L  LR+ LA IQ ESN ISKFN+E
Sbjct: 878  LEPPVEVTKPKHRHKKHKIEKINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLE 937

Query: 912  ERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTA 971
            ERVNELF EKK KAL RL++LE KY+ FGI+F M+ + L     +G  + S  E   S  
Sbjct: 938  ERVNELFNEKKLKALQRLKELETKYKDFGINFEMK-DFLENKPNDGTKEGSTEEEYES-- 994

Query: 972  PNSLDSCVLDPARLDAKIEEMTKILEEL 999
                    LDP   + K++++ ++ E+L
Sbjct: 995  --------LDPKIYEKKLDDIDRLTEQL 1014

 Score = 33.9 bits (76), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 16/75 (21%)

Query: 1110 SFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQRNSGYHRKSFVNRMKKNSTPK 1169
            SFLE+LS+KYGT         G K +            Q       K F++RM+++ST  
Sbjct: 1061 SFLETLSEKYGT---------GQKNVAMTATPNSRIVTQ-----SEKQFLDRMRRSST-- 1104

Query: 1170 SSSFVDEVSQKMTPV 1184
            ++ F+ E+++K+ P 
Sbjct: 1105 AAPFLQELTEKVAPA 1119

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/630 (60%), Positives = 473/630 (75%), Gaps = 28/630 (4%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FEKYPRP K+LKQLHWEK+D  DNSIW   +AEKFADDLYE+GVL +LEKAFAAREIKSL
Sbjct: 1348 FEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1407

Query: 1460 IS-RKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             S RK+D  K+TFLSRDISQQFGINLHMYSSL+V  +V KIL CD+DFL T S +EFLSK
Sbjct: 1408 ASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSK 1467

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EI+EVS+N+AR +APY+TDWEGV ++E+AK PEKDPN+LQRADQ+YL L+VNL+SYW S
Sbjct: 1468 SEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1527

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRAL ++T+YE++YN+L+ KLR +DKAV A+Q+S+NLRNVF+VILAVGN+MND+SKQAQ
Sbjct: 1528 RMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1587

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKLSTLQRLTFIKD  NSMTFLNYVEKIVR NYP F+ FL ELEPVL VVK+SIEQL N
Sbjct: 1588 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVN 1647

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LPVLPEARK+ +LL DEV+L++M
Sbjct: 1648 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIM 1707

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EFESLM  +GEDS DKFAK SFF+KFADFI EYK+AQ  N   EEEER Y + K ++EEQ
Sbjct: 1708 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQ 1767

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            QKRA++  +                     D R VMD+LLE+LKNAGP+K+DPSSARKRA
Sbjct: 1768 QKRAQEKEK--QKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSDPSSARKRA 1825

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQS-DGLDDQSDSNPAILGSPTSTVGATADVEG 1937
            L RKK +  K +   +L+ LD EE + + S + +D  +D+   ++ + + T  AT  V  
Sbjct: 1826 LVRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADT---VIHAESPTPLATRGV-- 1880

Query: 1938 LNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTED 1997
            +N   DLPS   ++                   + D++ ++ RAR LL+ELR SD   + 
Sbjct: 1881 MNTSEDLPSPSKTS------------------ALEDQEEISDRARMLLKELRGSDTPVK- 1921

Query: 1998 RKSLLDEHKEKVRQRRNKKLIEESGGNNTS 2027
            + S+LDEH EK+R R+ + + E S GN  S
Sbjct: 1922 QNSILDEHLEKLRARKERSIGEASTGNRLS 1951

 Score =  562 bits (1448), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 370/1002 (36%), Positives = 534/1002 (53%), Gaps = 115/1002 (11%)

Query: 77   AKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXX 136
            A+PL+K STLNT +LSQY +       P                         SNK    
Sbjct: 82   ARPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQSKYSYSKRNSSQASNKLTRQ 141

Query: 137  XXXXXXXXXTLSRQPTXXXXXXXXXXXXVTLLQKITDSDGNLSLEKPKYPXXXXXXXXXX 196
                     +L  Q +            +T L K T  DG + LE P  P          
Sbjct: 142  HTGQSHSASSLLSQGS------------LTNLSKFTTPDGKIYLEMPSDPYEVEVLFEDI 189

Query: 197  XXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNNV--------------- 241
              KRNI  S+S      LMGY ++KKWL+VKQDLQ ELK+M+ N                
Sbjct: 190  MYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMRANTTSSSTASRTSMASDH 249

Query: 242  -----------------------PQSTV-ADPLSNSVHLKSPRGSFS------------- 264
                                   P STV ++ L++S  L S   S S             
Sbjct: 250  HPILTANSSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKGKKLVSGSLKKQ 309

Query: 265  -SSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDW 323
             S N   R  ++N+     +  D ++  P HYV++I++D++T+ E+ DLWV+LRTE +DW
Sbjct: 310  PSLNNIYRGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDW 369

Query: 324  VIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAALS 383
            V  FID QG +A+AN L+    +             KE +++KC RVL+ L +G+    +
Sbjct: 370  VDAFIDHQGHIAMANVLMNSIYKTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEFST 429

Query: 384  SKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYS 443
             +L+   V EGL S +L TR++ATE  + ML     K   + F+A   VL +LD++ +  
Sbjct: 430  HRLMTDTVAEGLFSTKLATRKMATEIFVCMLE----KKNKSRFEA---VLTSLDKKFRIG 482

Query: 444  SSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYK 503
             ++H+     +  +  S  T  + L +I    + WL+ +E TLDGRG+MGSLVGAS+++K
Sbjct: 483  QNLHMIQNFKKMPQYFSHLTLESHLKII----QAWLFAVEQTLDGRGKMGSLVGASDEFK 538

Query: 504  NG--ENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALE 561
            NG  EN +LEY  ++M+ IN LCS   +++QR LLR++L++ G+ R++ K++LL Y  + 
Sbjct: 539  NGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVI 598

Query: 562  NEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLF 621
            +++  +++  LDD+N  + ++    +VD+ DP SL  N W   KGTE+E  L+SL+QHLF
Sbjct: 599  DQIELYDNNKLDDFNVKLEANNKAFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLF 658

Query: 622  LWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSI-DTESGFNGAIQRLYDAMQTDEVAR 680
            L SSK   E+ + ++ +KQLKL+D+LV+NV+ +S  D E+  N AIQRLYDAMQTDEVAR
Sbjct: 659  LSSSKLIEENQNSSKLTKQLKLMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVAR 718

Query: 681  RAILESRELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXX 740
            RAILESR LTKK EE++AERD L  KL++A                RIL K+ RV  Q  
Sbjct: 719  RAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLE 778

Query: 741  XXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMA 800
                                   MLTILNS+P ++ N      G+N    S L   +K  
Sbjct: 779  AELEELKKKHLLEKHQQEVELRKMLTILNSRPEESFNKNEGTRGMN----SSLNSSEKAN 834

Query: 801  IQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKK 860
            IQK LQD L + +KD   DS++FG    PN+RLKMLR +M++IE EA  LEMTNFAEF+K
Sbjct: 835  IQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK 894

Query: 861  ETKVEDLPRLQSPPKIERNV---------------RSEKVKELAALRQRLAVIQQESNEI 905
            +       RL+ P  I++                 +   V +L  LR+ LA IQ ESN+I
Sbjct: 895  D-------RLEPPIHIKKPKVKKMKNKDRKPLVKPQEADVNKLNDLRRALAEIQMESNDI 947

Query: 906  SKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGE 965
            SKFNVEERVNELF EKK+ AL RL++LE KY+ FGIDFN++   ++++ ++  GD    E
Sbjct: 948  SKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVDE--IMDSPKKNTGDVETEE 1005

Query: 966  ASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVD 1007
             +N  +        LDP     K++E+ +I ++L  ++ Q +
Sbjct: 1006 DANYAS--------LDPKTYQKKLDEINRITDQLLDIQTQTE 1039

 Score = 38.9 bits (89), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 24/104 (23%)

Query: 1089 VSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQ 1148
             SP+  +  E S+    +   SFL++LSQKYGTG N+  +                   +
Sbjct: 1068 ASPTQELRSEHSELSSGSGPGSFLDALSQKYGTGQNVTAS---------------AAFGE 1112

Query: 1149 RNSG-----YH---RKSFVNRMKKNSTPKSSSFVDEVSQKMTPV 1184
             N+G      H    K+F+NR++K ST  S+ +++E++QK+  V
Sbjct: 1113 NNNGSGIGPLHSKVEKTFMNRLRK-STVSSAPYLEELTQKVNKV 1155

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/630 (60%), Positives = 473/630 (75%), Gaps = 28/630 (4%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FEKYPRP K+LKQLHWEK+D  DNSIW   +AEKFADDLYE+GVL +LEKAFAAREIKSL
Sbjct: 1347 FEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1406

Query: 1460 IS-RKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             + RK+D  K+TFLSRDISQQFGINLHMYSSL+V  +V KIL CD+DFL T S +EFLSK
Sbjct: 1407 ATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSK 1466

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EI+EVS+N+AR +APY+TDWEGV ++++AK PEKDPN+LQRADQ+YL L+VNL+SYW S
Sbjct: 1467 PEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1526

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRAL ++T+YEK+YN+L+ KLR +DKAVGA+Q+S+NLRNVF+VILAVGN+MND+SKQAQ
Sbjct: 1527 RMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1586

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ FL+ELEPVL VVK+SIEQL N
Sbjct: 1587 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1646

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC +F  ++ NVERS+EIGNLSDSSKFHP D++L K LPVLPEARK+ +LL DEV+L++M
Sbjct: 1647 DCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIM 1706

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EFESLM  +GEDS DKFAK SFF+KFADFI EYK+AQ  N   EEEER YE+ K ++EEQ
Sbjct: 1707 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQ 1766

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            QKRA++  +                     D R VMD+LLE+LKNAGP K+DPSSARKRA
Sbjct: 1767 QKRAQEREK--QKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAGPGKSDPSSARKRA 1824

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQS-DGLDDQSDSNPAILGSPTSTVGATADVEG 1937
            L RK+ +  K +   +L+ LD EE + + S + LD  +D   A++ + + T   T     
Sbjct: 1825 LVRKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDAD---AVIHAESPTPLTTRGT-- 1879

Query: 1938 LNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTED 1997
            LN   DLPS P  A                   + D++ ++ RA+ LL+ELR SD   + 
Sbjct: 1880 LNIPEDLPS-PSKA-----------------STLEDQEEISDRAKMLLKELRGSDTPVK- 1920

Query: 1998 RKSLLDEHKEKVRQRRNKKLIEESGGNNTS 2027
            + S+LDEH EK+R R+ + + E S GN  S
Sbjct: 1921 QNSILDEHLEKLRARKERTIGEGSAGNKLS 1950

 Score =  558 bits (1439), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 418/1213 (34%), Positives = 614/1213 (50%), Gaps = 202/1213 (16%)

Query: 77   AKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXX 136
            A+PL+K STLNT +LSQY +    +  P                         SNK    
Sbjct: 83   ARPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQSKYSYSKRNSSQASNKLTRQ 142

Query: 137  XXXXXXXXXTLSRQPTXXXXXXXXXXXXVTLLQKITDSDGNLSLEKPKYPXXXXXXXXXX 196
                     +L  Q +            +T L K T  DG + LE P  P          
Sbjct: 143  HTGQSHSVSSLLSQGS------------LTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDI 190

Query: 197  XXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNNV--------------- 241
              KRNI  S+S      LM Y  +KKWL+VKQDLQ ELK+++ N                
Sbjct: 191  MYKRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTSSSTASRTSIASDH 250

Query: 242  -----------------------PQSTV-ADPLSNSVHLKSPRGSFSSS----------- 266
                                   P STV ++ L++S  L S   S S S           
Sbjct: 251  HPILTANSSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKSKKLMGGSLKKQ 310

Query: 267  ---NMSARSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDW 323
               N   R  S+N+     +  D ++  P HYV++I++D++T  E+ DLWV+LRTE +DW
Sbjct: 311  PSLNNIYRGGSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDW 370

Query: 324  VIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAALS 383
            V  FID QG +A+AN L+    +             KE +++KC RVL+ L +G+    +
Sbjct: 371  VDAFIDHQGHIAMANVLMNSIYKTAPRDSLTKELLEKENSFFKCFRVLSMLSQGLYEFST 430

Query: 384  SKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYS 443
             +L+   V EGL S RL TR++ATE  + ML     K   + F+A   VL ALD++ +  
Sbjct: 431  HRLMTDTVAEGLFSTRLATRKMATEIFVCMLE----KKNKSRFEA---VLTALDKKFRIG 483

Query: 444  SSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYK 503
             ++H+     +  +  S  T  + L +I    + WL+ +E TLDGRG+MGSLVGAS+++K
Sbjct: 484  QNLHMIQNFKKMPQYFSHLTLESHLKII----QAWLFAVEQTLDGRGKMGSLVGASDEFK 539

Query: 504  NG--ENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALE 561
            NG  EN +LEY  ++M+ IN LCS   +++QR LLR++L++ G+ R++ K++LL Y  + 
Sbjct: 540  NGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVM 599

Query: 562  NEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLF 621
            +++  +++  LDD+N  + ++    +VD++DP SL  N W   KGTE+E  L+SL+QHLF
Sbjct: 600  DQIELYDNNKLDDFNVRLEANNKAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQHLF 659

Query: 622  LWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSI-DTESGFNGAIQRLYDAMQTDEVAR 680
            L SSK   E+ +P++ +KQLK++D+LV++V+ +S  D ES  N AIQRLYDAMQTDEVAR
Sbjct: 660  LSSSKLIEENQNPSKLTKQLKVMDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEVAR 719

Query: 681  RAILESRELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXX 740
            RAILESR LTKK EE++AERD L  KL++A                RIL K+ RV  Q  
Sbjct: 720  RAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQLE 779

Query: 741  XXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMA 800
                                   MLTILNS+P +  N +++ +GI  K  S L   +K  
Sbjct: 780  AELEELKKKHLLEKHQQEVELRKMLTILNSRPEE--NSSIN-EGIRGKNSS-LNSSEKAN 835

Query: 801  IQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKK 860
            IQK LQD L + +KD   DS++FG    PN+RLKMLR +M++IE EA  LEMTNFAEF+K
Sbjct: 836  IQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK 895

Query: 861  ETKVEDLPRLQSPPKIERNV-------------RSEKV--KELAALRQRLAVIQQESNEI 905
            +        L+ P +I++               R ++V   +L  LR+ LA IQ ESN+I
Sbjct: 896  D-------HLEPPIQIKKPKLKKIKHKDKKLISRPQEVDMNKLNDLRRALAEIQMESNDI 948

Query: 906  SKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGE 965
            SKFNVEERVNELF EKK+ AL RL++LE KY+ FGIDFN+E   ++E+ ++   +    +
Sbjct: 949  SKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEE--IMESPKKNSANERKED 1006

Query: 966  ASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVDPTTANSGADISTSISTDD 1025
             +N ++        LDP     K       L+E+NR+  Q+         D+      DD
Sbjct: 1007 GANYSS--------LDPRTYQNK-------LDEINRITDQL--------LDLQAQTKQDD 1043

Query: 1026 FNIDNTSLPSTVVEGSPSSYFKKASLXXXXXXXXXXXXXXXLSAETAEDSNKNNEDSVVG 1085
              + + S  S+  EG                                ED  ++       
Sbjct: 1044 GGVSSLSSSSSSAEG--------------------------------EDVYQD------- 1064

Query: 1086 EHGVSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXX 1145
                 P+  V  E S+  + + + SFL++LSQKYGTG N                     
Sbjct: 1065 ---AFPAQEVRSENSELSVESGSGSFLDALSQKYGTGQN-----------------NTVS 1104

Query: 1146 XXQRNSGY-----H-----RKSFVNRMKKNSTPKSSSFVDEVSQKMTPVH-VAQSPDSLQ 1194
               R+S Y     H      K+F+N+++K ST  S+ +++E++QK+  V    Q  D ++
Sbjct: 1105 VGLRDSDYVSVIGHMPSKVEKTFMNKLRK-STASSAPYLEELTQKVNKVESYEQDEDEVR 1163

Query: 1195 NTATSS-STPQSA 1206
            +  +SS + P++A
Sbjct: 1164 SKESSSKNAPRNA 1176

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/629 (60%), Positives = 464/629 (73%), Gaps = 28/629 (4%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FEKYPRP K+LKQLHWEKID  DNSIW + +AEKFADDLYE+GVL +LEKAFAAREIKSL
Sbjct: 1345 FEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1404

Query: 1460 IS-RKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             + RK+D  KVTFLSRDISQQFGINLHMYSSL+V  +V KILKCD+DFL T S +EFLSK
Sbjct: 1405 ATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSK 1464

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EI EVS+N+AR +APY+TDWEG+  +E+AK PEKDPN+LQRADQ+YL L+VNL+ YW S
Sbjct: 1465 PEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGS 1524

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRAL ++T+YEK+YN+L+ KLR +D+AVGA+Q+S+NLRNVF+VILAVGN+MND+SKQAQ
Sbjct: 1525 RMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1584

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ FL+ELEPVL VVK+SIEQL N
Sbjct: 1585 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1644

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LPVLPEAR++ +LL DEV+L++M
Sbjct: 1645 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIM 1704

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EFESLM+ +GEDS DKFAK SFF+KFADF+ EYKRAQ  N   EEEER YE+ K M+EEQ
Sbjct: 1705 EFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQ 1764

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            QKRA    Q                     D R VMD+LLE+LKNAGP+K+DPSSARKRA
Sbjct: 1765 QKRA----QDKEKHREHSALPEGNEEEETEDRRAVMDKLLEQLKNAGPAKSDPSSARKRA 1820

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGL 1938
            L RKK +  K + + +L+ L+ EE                 +IL SP +T   T  V   
Sbjct: 1821 LVRKKYISDKDNSAQVLNDLNDEE----------------GSILYSPEATTPDTDTV--- 1861

Query: 1939 NPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTEDR 1998
               H     P+ A +G                + D++ +T RAR LL+ELR SD   + +
Sbjct: 1862 --IHAESPTPL-ATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVK-Q 1917

Query: 1999 KSLLDEHKEKVRQRRNKKLIEESGGNNTS 2027
             S+LDEH EK+R R+ +   E + GN  S
Sbjct: 1918 NSILDEHLEKLRARKERANGETNTGNKLS 1946

 Score =  563 bits (1451), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 378/999 (37%), Positives = 542/999 (54%), Gaps = 110/999 (11%)

Query: 77   AKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXX 136
            A+PL+K +TLNT +LSQY +    +  P+                        SNK    
Sbjct: 82   ARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTSSQASNK---- 137

Query: 137  XXXXXXXXXTLSRQPTXXXXXXXXXXXXVTL--LQKITDSDGNLSLEKPKYPXXXXXXXX 194
                      L+RQ T             +L  L K T  DG + LE P  P        
Sbjct: 138  ----------LTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFE 187

Query: 195  XXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNNV------------- 241
                KRNI  S+S     ELM Y  +KKWL+VKQDLQ ELK+++ N              
Sbjct: 188  DIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRANTTSSSAASRTSIAS 247

Query: 242  -------------------------PQSTV-ADPLSNSVHLKSPRGSFSSSNMSARSISQ 275
                                     P STV ++ L++S  L S   S    + + ++I+ 
Sbjct: 248  DQHPILTANSTLSSPKSALMTSASSPTSTVYSNTLNHSTTLSSVGTSTPKGHNNKKTIAG 307

Query: 276  NSAKQLAVSY-----------------DPSHLSPDHYVRKIISDRITAYELNDLWVSLRT 318
               KQ +++                  D ++  P HYV++I++D++T  E+ DLWV+LRT
Sbjct: 308  GLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRT 367

Query: 319  ESIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGM 378
            E +DWV  FID QG +A+AN L+    +             KE +++KC RVL+ L +G+
Sbjct: 368  EQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGL 427

Query: 379  QAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQ 438
                + +L+   V EGL S +L TR++ATE  + ML     K     F+A   VL ALD+
Sbjct: 428  YEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLE----KKNKNRFEA---VLTALDK 480

Query: 439  ESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGA 498
            + +   ++H+     +  +  S  T  + L +I    + WL+ +E TLDGRG+MGSLVGA
Sbjct: 481  KFRIGQNLHMIQNFKKMPQYFSHLTLESHLKII----QAWLFAVEQTLDGRGKMGSLVGA 536

Query: 499  SEDYKNG--ENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLK 556
            S+++KNG  EN +LEY  ++M+ IN LCS   +++QR LLR++L++ G+ R++ K++LL 
Sbjct: 537  SDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLD 596

Query: 557  YPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSL 616
            Y  + +++  +++  LDD+N  + +S    +VD+KDP SL  N W   KGT++E  L+SL
Sbjct: 597  YDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSL 656

Query: 617  MQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSI-DTESGFNGAIQRLYDAMQT 675
            +QHLFL SSK   E+ +P++ SKQLKL+D+LV+NV+ +S  D ES  N AIQRLYDAMQT
Sbjct: 657  VQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQT 716

Query: 676  DEVARRAILESRELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRV 735
            DEVARRAILESR LTKK EE++AERD L  KL +A                RIL K+ RV
Sbjct: 717  DEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRV 776

Query: 736  TDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKTPSPLKP 795
              Q                         MLTILNS+P ++S+ +     IN   PS L  
Sbjct: 777  MQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPEESSDLSKGTKDIN---PS-LNS 832

Query: 796  EKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNF 855
             +K  IQK LQD L + +KD   DS++FG    PN+RLKMLR +M++IE EA  LEMTNF
Sbjct: 833  SEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNF 892

Query: 856  AEFKKE------TKVEDLPRLQSPPKIERNVRSE--KVKELAALRQRLAVIQQESNEISK 907
            AEF+KE         +   + +     + +V+++   + +L  LR+ LA IQ ESN+ISK
Sbjct: 893  AEFEKERLEPPIEIKKPKIKHKKHKIKKSSVKTQGADMNKLNDLRRALAEIQMESNDISK 952

Query: 908  FNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEAS 967
            FNVEERVNELF EKK+ AL RL++LE KY+ FGIDFN+E    IET ++     SV E +
Sbjct: 953  FNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEE--FIETPKK----FSVDEEN 1006

Query: 968  NSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQV 1006
            ++  P+      LDP    +K++E+ +I +EL  L+ QV
Sbjct: 1007 DAAYPS------LDPKAYQSKLDEINRITDELLDLQTQV 1039

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 19/100 (19%)

Query: 1089 VSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQ 1148
             SPS     E S+    +   SFL++LSQKYGTG N+  A  G +               
Sbjct: 1069 ASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNV-TASAGLR-------------DN 1114

Query: 1149 RNSGYH----RKSFVNRMKKNSTPKSSSFVDEVSQKMTPV 1184
            R SG+      KSF+NR++K ST  S+ +++E++QK+  V
Sbjct: 1115 RGSGHMPSNVEKSFINRLRK-STASSAPYLEELTQKVNKV 1153

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/512 (69%), Positives = 434/512 (84%), Gaps = 9/512 (1%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            F++YPRP K+LKQLHWEKIDD ++SIW +A+AEKFADDLYE+GVL+ LEKAFAAREIKSL
Sbjct: 1332 FDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSL 1391

Query: 1460 ISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             SRKK D +K++FLSRD+SQQFGINLHMYSSL+V+++V+KIL+CD+DFL+T S I+FLSK
Sbjct: 1392 ASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSK 1451

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EIVEVS N+AR FAPYT DWEGVSSVE AK PEKDP ELQRAD+LYL+L VNLQ+YW+S
Sbjct: 1452 QEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSS 1511

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRALK+ITTYEKDY+DL+ KL  +DKA  +IQ+SENLRNV DVILAVGN+MNDSSKQAQ
Sbjct: 1512 RMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1571

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GF+L+TLQRLTFIKD+KNSMTFLNYVEKI+R  YP F+ FL+ELEPV+  VKISIEQ+A 
Sbjct: 1572 GFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQ 1631

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC EF  +V NVERS++IGNLSD +KFHP+DRVL KVLP LPEARK+ +LL DE++L+L+
Sbjct: 1632 DCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLL 1691

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EF++LMRLFGED+ DKFA+NSFF+KFADF+LEYK+AQ +N K+EEEERAYERRK ++E+Q
Sbjct: 1692 EFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQ 1751

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
             KR R++   ++                  +DRDVMDRLLEKLKNAGP+K+DPSSARKRA
Sbjct: 1752 LKRTRES---ESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKSDPSSARKRA 1808

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDG 1910
            +ARK+L+ G  S S ILD  D+E+     SDG
Sbjct: 1809 VARKRLLQGSSSNSTILDNFDIED-----SDG 1835

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1106 (38%), Positives = 602/1106 (54%), Gaps = 113/1106 (10%)

Query: 78   KPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXXX 137
            KPLSK STLN +SLS Y D +      +   S+G                 NS       
Sbjct: 72   KPLSKQSTLNMASLSAYTDAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNS------- 124

Query: 138  XXXXXXXXTLSRQPTXXXXXXXXXXXXVTL--LQKITDSDGNLSLEKPKYPXXXXXXXXX 195
                     LSRQ T             +   L K    DG + LE+P+ P         
Sbjct: 125  ---AVSGSKLSRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEE 181

Query: 196  XXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNN--------------- 240
               KRN+  S+   + REL  YDL+KKWLMV+QDLQ+E+K+  N+               
Sbjct: 182  VLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNASKSSTVVGGSSS 241

Query: 241  -VPQSTVADPLSNSVHLKSPRGSF----------SSSNMSARSISQN--SAKQLAVSYDP 287
             VP S  A   ++S    SP GSF          SS N S +  S N  ++    +S DP
Sbjct: 242  AVPDSPSASNFTSST---SPNGSFTGLSRPKISTSSVNTSEQFYSSNLGTSSTTTLSQDP 298

Query: 288  SHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRX 347
            SHLSPD+YVRKII + I+A  LNDLWVSLRTE +DWV GF++AQGQVAIAN ++K   R 
Sbjct: 299  SHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRE 358

Query: 348  XXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAAL---SSKLVISAVVEGLLSIRLTTRR 404
                        KE AY+KCL+   NLREG   A+   S+++++SA+VEGLLS+R+ TRR
Sbjct: 359  SPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRR 418

Query: 405  IATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRL------HETNKR 458
            +A+E LL  L+   L      F+    V+ ALDQES++  ++HL+ RL       +  K 
Sbjct: 419  VASE-LLISLSQWSLPHG---FNH---VMDALDQESRFCDNVHLQARLITQSASKDPKKG 471

Query: 459  RSL-PTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYK--NGENTVLEYLLY 515
             S+ PT   D   + +K EQW+ V+EYTLDGRG+MGSLVGASED++   GEN ++EY   
Sbjct: 472  SSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYL 531

Query: 516  SMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDY 575
            +++LIN LC +  D+ QR +LR+RLK+ GL R++ KM+LL Y  ++ ++++F+D T DD+
Sbjct: 532  TLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDF 591

Query: 576  NSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSEST-DP 634
            ++L +  +    VDMKDP S+  N W   KGT++E HL SL+Q+L + + +  S++  DP
Sbjct: 592  DALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDP 651

Query: 635  AEGSKQLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCE 694
             + +KQLKL+DALVSNV+ +S+D +S FN AIQRLYDAMQTDE+ARRAILE+R+  K+ E
Sbjct: 652  TQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYE 711

Query: 695  EMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXX 754
            E+KA+RD+L+ KL+ A                 ILEKS RV  Q                
Sbjct: 712  EIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAK 771

Query: 755  XXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEK 814
                      LT +NS    + N     D   ++ P PL+PE+K+AIQKALQ +L +T K
Sbjct: 772  HEHEVELRKTLTAMNSNFEGSHN---MRDEKGSENPRPLRPERKLAIQKALQAKLEKTSK 828

Query: 815  DLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFK----KETKVEDLPRL 870
            ++  +S+R G    PN+RLK+LRS+M+DIE +A  LEMTNF++++    KE +V +    
Sbjct: 829  EINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDH 888

Query: 871  QSPPKIERNVRSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLR 930
            ++  + E   +     +L  LR++LA +QQESN+ISKFNVE R +E+F  +K+ ALDRL+
Sbjct: 889  KAVSESEEKAQQISALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRLK 948

Query: 931  DLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSC-VLDPARLDAKI 989
             LE  Y+ FGI+F              D D+ +G+A    + +S D    LDP      +
Sbjct: 949  KLETDYKGFGINF--------------DPDSPLGQALAGKSVSSDDKARTLDPKEALNIV 994

Query: 990  EEMTKILEELNRLKC----QVDPTTANSGADISTSISTDDFNIDNTSLPSTVVEGSPSSY 1045
            EE++ IL  L+  K        P    + +D S+    DD N D  +  ST+    P+S 
Sbjct: 995  EEVSNILSGLDSSKAAEKSNETPLRTATSSD-SSEDEMDDKNGDKIAADSTL----PTSS 1049

Query: 1046 FKKASLXXXXXXXXXXXXXXXLSAE--TAEDSNKNNEDSVVGEHGVSPSGSVAMERSDSI 1103
            F ++                 LS +   A++S  N      GE     SG       + +
Sbjct: 1050 FLES-----------------LSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRV 1092

Query: 1104 LTTSNTSFLESLSQKYGTGTNLQPAE 1129
              T    +L  LS K G+ + ++P+E
Sbjct: 1093 KRTGAVPYLGELSGKIGSSSYIKPSE 1118

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 55/118 (46%), Gaps = 30/118 (25%)

Query: 1100 SDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQRNSGYHRKSFV 1159
            +DS L TS  SFLESLSQKYG   N          L               SGYHRKSF+
Sbjct: 1041 ADSTLPTS--SFLESLSQKYGGAQN---------SLSNRHSFAGGEINYPGSGYHRKSFM 1089

Query: 1160 NRMKKNSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSSSTPQSAKSEDAVGIGIF 1217
            NR+K+     +  ++ E+S K+                 SSS  + +++E+ VGIGI 
Sbjct: 1090 NRVKRTG---AVPYLGELSGKI----------------GSSSYIKPSEAEENVGIGIM 1128

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/639 (58%), Positives = 461/639 (72%), Gaps = 46/639 (7%)

Query: 1378 LGRTKKYKGXXXXXXXXXXXXXFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADD 1437
            LG+   Y+              F  YPR +K+LKQLHWEK+D  DNSIW + +AEKFA D
Sbjct: 1229 LGQKMAYRTAVPSPLLPQSPSLFSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGD 1288

Query: 1438 LYERGVLTELEKAFAAREIKSLISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIV 1496
            LYE+GVL +LEKAFAAREIKSL ++K+ D +K+TFLSRD+SQQFGINLHMYS L+V+++V
Sbjct: 1289 LYEKGVLEDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELV 1348

Query: 1497 TKILKCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPN 1556
            TKILKC++DF++T S +EFLSK EI+EVS N+AR ++PY+TDW+GVS VE+AK PEKDP 
Sbjct: 1349 TKILKCERDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPA 1408

Query: 1557 ELQRADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENL 1616
            ELQRADQLYL LI NLQ YW SRMRAL++IT+YE++Y++L+ KLR +DKAV  IQKS NL
Sbjct: 1409 ELQRADQLYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNL 1468

Query: 1617 RNVFDVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFD 1676
            RNVF+VILAVGNYMNDS+KQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKIVR NYP F+
Sbjct: 1469 RNVFNVILAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFN 1528

Query: 1677 VFLQELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVL 1736
             FL++L+PVL VVKISIEQL +DC EF  ++TNVERS++IGNL+DSSKFHP D+VL KVL
Sbjct: 1529 DFLEDLQPVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVL 1588

Query: 1737 PVLPEARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQE 1796
            PVLPEA KR  LL +EV+LS+MEFESLM+ +GEDS DKFAKNSFF+KFADFI EYKRAQ 
Sbjct: 1589 PVLPEASKRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQA 1648

Query: 1797 FNKKMEEEERAYERRKIMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDR 1856
             N K EEEER Y+  K M+EEQQKRA +  + +                   D R +MD+
Sbjct: 1649 QNLKAEEEERLYQTHKKMVEEQQKRAEEKERSENATEEDASEENE-------DRRAMMDK 1701

Query: 1857 LLEKLKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSD 1916
            LLE+LKNAGP KADP SARKRA+ RKK+++  ++ S +LD +  E          DD   
Sbjct: 1702 LLEQLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQE----------DD--- 1748

Query: 1917 SNPAILGSPTSTVGATADVEGLNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDA 1976
               +++ SP    G T      NP  D   +P    KG                  DE+ 
Sbjct: 1749 ---SMIYSPEKQEGIT------NPTGDSSQSP---SKGAANNQQ------------DEEE 1784

Query: 1977 VTHRARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNK 2015
            +T RA+ LL  LR  +  ++ R ++L+ HKEK+R RR K
Sbjct: 1785 ITDRAKALLMGLRGGESPSK-RNNVLNGHKEKLRARRRK 1822

 Score =  552 bits (1422), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 384/1023 (37%), Positives = 548/1023 (53%), Gaps = 103/1023 (10%)

Query: 78   KPLSKHSTLNTSSLSQY------ADEIA--QSRTPSGPVSLGXXXXXXXXXXXXXXXGGN 129
            +PL+K ST+NT +LS Y      A+ ++   SR+PS   S                 G N
Sbjct: 70   RPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQSST-KYTYSRRSSSHLSTPGVN 128

Query: 130  SNKXXXXXXXXXXXXXTLSRQPTXXXXXXXXXXXXVTL--LQKITDSDGNLSLEKPKYPX 187
            S               TL+R+PT             +   L      DG + L+ P    
Sbjct: 129  S---------------TLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMPS-SH 172

Query: 188  XXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRM-KNNVPQSTV 246
                       KRNIL ++S    +ELM YD+DKKWL+VKQDLQ + K++    VP +  
Sbjct: 173  EVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHA 232

Query: 247  A------DPLSNSVHLKSPRGS-----------FSSSNMSARS--ISQNSAKQLAVSYDP 287
            A      D L +S+ + SPR S           F+ +N  + S   S N +K   +S   
Sbjct: 233  AISSSNSDSLPSSLKVSSPRSSMTYESIQQAIKFNKTNNGSSSGPASNNKSKLQQLSDKN 292

Query: 288  SHLS----------PDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIA 337
            S  S          P HYV++II+D++T  E+NDLWV+LRTE +DWV GF++ QG +A+A
Sbjct: 293  SSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMA 352

Query: 338  NRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLS 397
            N L     +             KE A+++C RVL+ L +G+       ++   V  GL S
Sbjct: 353  NVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFS 412

Query: 398  IRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNK 457
            +RL TR++ATE  + ML     K     F+A   VL+ALD++ K   ++H+   +  + +
Sbjct: 413  VRLATRKMATEIFVCMLE----KKNKVRFEA---VLNALDKKFKIGENLHMLHYMKNSPQ 465

Query: 458  RRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYK--NGENTVLEYLLY 515
              S  T  +   ++    + WL+ +E +L+GRG+MGSLVGASED+K   GEN +LEY  +
Sbjct: 466  HFSHFTRDSQFKIV----QSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQW 521

Query: 516  SMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDY 575
            +M+ IN  C+    ++QR LLR+RL++ G  R++ + +LL Y  +   V  +E+  LDD 
Sbjct: 522  TMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDL 581

Query: 576  NSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPA 635
            NS++ +    S +DM D  SL    +   KGTESE  L SL++HLFL +S+   ++ DP 
Sbjct: 582  NSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPT 641

Query: 636  EGSKQLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEE 695
            + SKQL+L+D+LV+NV+ S++D  S  N AIQRLYD+MQTDEVARRAILESR LTKK EE
Sbjct: 642  KLSKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEE 701

Query: 696  MKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXX 755
             +AERD L  KL++                  ILEK+ RVT Q                 
Sbjct: 702  AQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKH 761

Query: 756  XXXXXXXXMLTILNSKPNDASNDAVSPDGINNKT-PSPLKPEKKMAIQKALQDRLRQTEK 814
                    MLTILNS+P     D      +++K  P  L P+KK  IQ+ALQD L +T+K
Sbjct: 762  EHEVELRKMLTILNSRP---EGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKK 818

Query: 815  DLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPP 874
            DL+ DS+RFG    PN+RLKMLR +M+DIE+EA  LEMTNFA+  K         LQ+P 
Sbjct: 819  DLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAV-------LQAPV 871

Query: 875  KIERN--VRSE---KVKELAA-----LRQRLAVIQQESNEISKFNVEERVNELFYEKKTK 924
            K+E +  VR E   + KEL A     LR+ LA IQ+ESN +SKFNVEERVNELF +KK  
Sbjct: 872  KVESSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLS 931

Query: 925  ALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPAR 984
            ALDRL DLE  Y+ +GID +    +  E     + +       N+  P++     LDP  
Sbjct: 932  ALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESE------KNAEGPST-----LDPRA 980

Query: 985  LDAKIEEMTKILEELNRLKCQVDPTTANSGADISTSISTDDFNIDNT-SLPSTVVEGSPS 1043
              AK++E+ +I +EL  +K ++    A    +  +   TDD  I +T S+ +  ++ S +
Sbjct: 981  YQAKLDEIDRISKELIEMKSELKNDKALRRHESPSKQDTDDDEIQDTGSMVNEDLQSSGT 1040

Query: 1044 SYF 1046
            S F
Sbjct: 1041 SSF 1043

 Score = 43.5 bits (101), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 55/113 (48%), Gaps = 21/113 (18%)

Query: 1089 VSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQ 1148
            +  +GS+  E    + ++  +SFLESLSQKYGTG N                        
Sbjct: 1024 IQDTGSMVNE---DLQSSGTSSFLESLSQKYGTGKN-----------ATNMLTNDILNSS 1069

Query: 1149 RNSGYHRKSFVNRMKKNS-TPKSSSFVDEVSQKM---TPVHVAQSPDSLQNTA 1197
               G+ R+SF+ RMKK S  P   ++++E+  K+    P+ VA++ DS  N A
Sbjct: 1070 ERKGHSRQSFMERMKKPSGVP---AYLEELPLKVPKAPPLGVAETEDSSDNIA 1119

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/629 (59%), Positives = 464/629 (73%), Gaps = 26/629 (4%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FEKYPRP K+LKQLHWEK+D  DNSIW + +AEKFADDLYE+GVL +LEKAFAAREIKSL
Sbjct: 1341 FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1400

Query: 1460 IS-RKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             + RK+D  K+TFLSRDISQQFGINLHMYSSL+V  +V K+L CD+DFL T S +EFLSK
Sbjct: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EI+EVS+N+AR +APY+TDWEGV ++++AK PEKDPN+LQRADQ+YL L++NL+SYW S
Sbjct: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRAL ++T+YE++YN+L+ KLR +DKAVGA+Q S+NLRNVF+VILAVGN+MND+SKQAQ
Sbjct: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ FL+ELEPVL VVK+SIEQL N
Sbjct: 1581 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC +F  ++ NVERS+EIGNLSDSSKFHP D+VL K LPVLPEAR++ +LL DEV+L++M
Sbjct: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EFESLM+ +GEDS DKFAK SFF+KFADFI EYK+AQ  N   EEEER YE+ K ++EEQ
Sbjct: 1701 EFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQ 1760

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            QK+A++  +                     D RDVMD+LLE+LKNAGP+K DPSSARKRA
Sbjct: 1761 QKKAQEKEKQKERSASPSPEGNEEDEAE--DRRDVMDKLLEQLKNAGPAKTDPSSARKRA 1818

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGL 1938
            L RKK +  K S   +L+ LD EE                 +IL SP +T   T      
Sbjct: 1819 LVRKKYLSDKDSAPQLLNDLDNEE----------------GSILYSPEATTPDT-----Y 1857

Query: 1939 NPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTEDR 1998
               H     P+ A +G                + D++ ++ RAR LL+ELR S+   + +
Sbjct: 1858 TAVHAESPTPL-ATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVK-Q 1915

Query: 1999 KSLLDEHKEKVRQRRNKKLIEESGGNNTS 2027
             S LDEH EK+R R+ +   E + GN  S
Sbjct: 1916 NSTLDEHLEKLRARKERASSETNTGNKLS 1944

 Score =  558 bits (1437), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 381/1013 (37%), Positives = 535/1013 (52%), Gaps = 131/1013 (12%)

Query: 77   AKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXX 136
            A+PL+K STLNT +LSQY      +  P                         SNK    
Sbjct: 81   ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQSKYSYSKRNSSQASNK---- 136

Query: 137  XXXXXXXXXTLSRQPTXXXXXXXXXXXXVTL--LQKITDSDGNLSLEKPKYPXXXXXXXX 194
                      L+RQ T             +L  L K T  DG + LE P  P        
Sbjct: 137  ----------LTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFE 186

Query: 195  XXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMKNNV------------- 241
                KRNI  S+S      LMGY  +KKWL+VKQDLQ ELK+M+ N              
Sbjct: 187  DIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANTTSSSAASRTSVAS 246

Query: 242  -------------------------PQSTV-ADPLSNSVHLKSPRGSFSSS--------- 266
                                     P STV ++ L++S  L S   S S S         
Sbjct: 247  DHLPILTANSSLSSPKSILMTSASSPTSTVYSNNLNHSTTLSSAGTSTSKSKKIVTGSLK 306

Query: 267  -----NMSARSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESI 321
                 N   R  S+N+     +  D ++  P HYV++I++D++T  E+ DLWV+LRTE +
Sbjct: 307  KQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQL 366

Query: 322  DWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAA 381
            DWV  FI+ QG +A+AN L+    +             KE +++KC RVL+ L +G+   
Sbjct: 367  DWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEF 426

Query: 382  LSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESK 441
             + +L+   V EGL S +L T+++ATE  + ML     K   + F+A   VL ALD++ +
Sbjct: 427  STHRLMTDTVAEGLFSTKLATKKMATEIFVCMLE----KKNKSRFEA---VLTALDKKFR 479

Query: 442  YSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASED 501
               ++H+     +  +  S  T  + L +I    + WL+ +E TLDGRG+MGSLVGAS+D
Sbjct: 480  IGQNLHMIQNFKKMPQYFSHLTLESHLKII----QAWLFAVEQTLDGRGKMGSLVGASDD 535

Query: 502  YKNG--ENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPA 559
            +KNG  EN +LEY  ++M+ IN LCS   +++QR LLR++L++ G+ R++ K++LL Y  
Sbjct: 536  FKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDK 595

Query: 560  LENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQH 619
            + +++  +++  LDD+N  + ++    +VD++DP SL  N W   KGTE+E  L+SL+QH
Sbjct: 596  VIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQH 655

Query: 620  LFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTF-SSIDTESGFNGAIQRLYDAMQTDEV 678
            LFL SSK   E+ + ++ +KQLKL+D+LV+NV+  S+ D ES  N AIQRLYDAMQTDEV
Sbjct: 656  LFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEV 715

Query: 679  ARRAILESRELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQ 738
            ARRAILESR LTKK EE++AERD L  KL++A                 IL K+ RV  Q
Sbjct: 716  ARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQ 775

Query: 739  XXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKK 798
                                     MLTILNS+P ++S+     +G  N  PS L   +K
Sbjct: 776  LESELEELKKKHLLEKHQQEVELRKMLTILNSRPEESSD---INEGTRNIDPS-LNFSEK 831

Query: 799  MAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEF 858
              IQK LQD L + +KD   DS++FG    PN+RLKMLR +M++IE EA  LEMTNFAEF
Sbjct: 832  ANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEF 891

Query: 859  KKETKVEDLPRLQSPPKIERN-------------VRSEK--VKELAALRQRLAVIQQESN 903
            +KE       RL+ P +I++               R+++  + +L  LR+ LA IQ ESN
Sbjct: 892  EKE-------RLEPPIQIKKPKLKKNKHKDKNFLARAQEADMNKLNDLRRALADIQMESN 944

Query: 904  EISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNME------SELLIETDREG 957
             ISKFNVEERVNELF EKK+ AL RL++LE KY+ FGIDFN+E       +L +  +REG
Sbjct: 945  NISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREG 1004

Query: 958  DGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVDPTT 1010
            D   S                 LDP     K++E+ +I +EL  L+ Q    T
Sbjct: 1005 DARYS----------------SLDPKAYQKKLDEINRITDELLDLQTQTKQET 1041

 Score = 43.5 bits (101), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 28/106 (26%)

Query: 1089 VSPSGSVAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQ 1148
             SP+  +  E S+    +   SFL++LSQKYGTG N+  A  G                 
Sbjct: 1067 ASPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQNV-TASAGL---------------- 1109

Query: 1149 RNSGY-----H-----RKSFVNRMKKNSTPKSSSFVDEVSQKMTPV 1184
            R+SGY     H      K+F+NR+K+ ST  S+ +++E++QK+  V
Sbjct: 1110 RDSGYVSGLGHTPSKVEKTFMNRLKR-STVNSAPYLEELTQKVNKV 1154

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/617 (59%), Positives = 457/617 (74%), Gaps = 26/617 (4%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FE YPRP+K+LKQLHWEK++  DNSIW + +AEKFADDLYE+GVL+ELEKAFAAREIKSL
Sbjct: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314

Query: 1460 ISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             +RKK D  K++FLS DISQQFGINLHMYS+LTV+Q V K+LKC++DF+NT S IEFLSK
Sbjct: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EIVEVS N+AR +APY+TDWEG+  +E+AK PEKDPNELQRADQ+YL L+VNLQSYW S
Sbjct: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRA+++IT+YE++YN+L+ KL  +DKAVG++Q S+NL+N+F+VILAVGN+MNDS+KQA+
Sbjct: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKLSTLQRLTFIKD  NSMTFLNYVEKIVR+NYP F+ FL ELEPVL+VVK+SIEQL N
Sbjct: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC +F   + NVERS+EIGNLSDSSKFHP D+VL KVLP L EARK+  LLADE++L++M
Sbjct: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EFE +M+ +GED  DKFAK SFFQKFADFI EYK+AQ  N K+EEEE AYER K M+EEQ
Sbjct: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            Q++A+++                       D R VMD+LLE+LKNAG  K DP+SARKRA
Sbjct: 1675 QRKAQED--ASKLNENSSQTGNSDEEEESEDRRAVMDKLLEQLKNAGQVKTDPTSARKRA 1732

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGL 1938
            L RKK+   ++S S          LA +Q  G         +++ SP +      ++   
Sbjct: 1733 LLRKKIHSSEESES--------SPLAEMQVGG--------DSLIYSPDAKEQIELEIHMA 1776

Query: 1939 NPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTEDR 1998
            +P       P + E G              KKI +++ +  RA+ LL ELR S D   DR
Sbjct: 1777 SP------TPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGS-DALMDR 1829

Query: 1999 KSLLDEHKEKVRQRRNK 2015
             + LDEHKE++R RR +
Sbjct: 1830 NTALDEHKERLRARRKR 1846

 Score =  529 bits (1363), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 354/1004 (35%), Positives = 518/1004 (51%), Gaps = 133/1004 (13%)

Query: 74   LSTAKPLSKHSTLNTSSLSQYAD-----------------------EIAQSRTPSGPVSL 110
            +  ++PL+K STLN+ +LSQY +                       + + SR  SG VS+
Sbjct: 71   IDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSM 130

Query: 111  GXXXXXXXXXXXXXXXGGNSNKXXXXXXXXXXXXXTLSRQPTXXXXXXXXXXXXVTLLQK 170
                             GN N               LS                +T L +
Sbjct: 131  APSSM------------GNINLTRHNTNTSFSSASVLSH-------------GSITNLSR 165

Query: 171  ITDSDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDL 230
                DG ++L  P  P            KRNIL S+      ELM Y ++KKWL+VKQDL
Sbjct: 166  FMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDL 225

Query: 231  QAELKRMK------------------------------------------NNVPQSTVAD 248
            Q E KR+K                                           +   ST + 
Sbjct: 226  QNEFKRIKASNKGDSRTGMSMPDLGSDPSNSVSPPGPISSSGSSIFSSDVTSTAPSTYSR 285

Query: 249  PLSNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYE 308
                ++ +  P    ++++     I++ +     +  D ++  P HYV+KI+ D+++  E
Sbjct: 286  SGKKNIPISKP---IAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDE 342

Query: 309  LNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKCL 368
            + DLWV+LRTE +DWV  F++ QG +A+AN L+K   +             KE A++KC 
Sbjct: 343  MKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCF 402

Query: 369  RVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDA 428
            RVL  L +G+       L+   + +GL S RL TR++ATE  +++L     K  ++    
Sbjct: 403  RVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFES---- 458

Query: 429  IFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDG 488
               VL +LD+      + H+     +  +  +  T  ++L VI    + WL+ +E TLDG
Sbjct: 459  ---VLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVI----QAWLFAVEQTLDG 511

Query: 489  RGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLS 546
            RG+MGSLVGASEDYKN  GEN +LEY  ++M+ IN LCSS  +++QR LLR +L++ G+ 
Sbjct: 512  RGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGIL 571

Query: 547  RVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKG 606
            R++ K++LL Y  + +++  +E+  LDD+N+L+ S+  + +VD++DP SL  N     KG
Sbjct: 572  RIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKG 631

Query: 607  TESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGFNGAI 666
            TE+E  L+SL+QH+FL +SK   E  DP + +KQLKL+D+LV+NV+ +S +  S  N AI
Sbjct: 632  TENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAI 691

Query: 667  QRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXX 726
            QRLYD+MQTDEVARRAILESR LTKK EEM+AERD L  KL++A                
Sbjct: 692  QRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERD 751

Query: 727  RILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGIN 786
            RIL K+ RV  Q                         MLTILNS+P              
Sbjct: 752  RILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILNSRPAKTKEQK------- 804

Query: 787  NKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKE 846
             K    ++  +K  +Q+ALQ  L++ +KD   DS++FG    PN+RLK+LR +M+ IE E
Sbjct: 805  -KKIGSIEASEKEDLQRALQSGLQKAKKDFKDDSKKFGMTIQPNQRLKVLRMQMESIENE 863

Query: 847  ALMLEMTNFAEF-KKETKVEDLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQESNEI 905
            A  LEMTNFAE+ KK  K     + +S P  E N + +++++L  LR +L  IQ ESN++
Sbjct: 864  ARKLEMTNFAEYEKKGLKPPANVQKKSKPISELN-KEQRIQKLNELRDKLRRIQMESNDV 922

Query: 906  SKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGE 965
            SKFNV+ERVNELF +KK  AL RL++LE KY+ FGIDF +E      TD   +G +S   
Sbjct: 923  SKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSS--- 979

Query: 966  ASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVDPT 1009
                          LDP     K++E+TKI EEL + K +++ T
Sbjct: 980  --------------LDPKVYQDKLDEITKISEELLQQKNELETT 1009

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/610 (60%), Positives = 451/610 (73%), Gaps = 27/610 (4%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FE YPRP K+LKQLHWEK++  DNSIW   +AE+FADDLYE+GVL+ELE AFAAREIKSL
Sbjct: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405

Query: 1460 ISR-KKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             S+ KKD  K+TFLS D+SQQFGINLHMY+SL V  ++TKILKCD+DFL T S IEFLS+
Sbjct: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EIV+VS+N+AR +APY  DWEG+ +VE+AK PEK+PNELQRADQ+YL L+VNLQSYW S
Sbjct: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRALK+ITT+EK+YN+L+ KLR +D+AV ++Q+SENL+NVF VILAVGNYMND+SKQAQ
Sbjct: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKL+TLQRLTFIKD  N+MTFLNYVEKIVRTNYP F+ FL ELEPVL VVKISIEQL +
Sbjct: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC EF  ++ NVERS+EIGNLSDSSKFHP DRVLAKVLP LP+ARK+  LL DEV+L++M
Sbjct: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EF  LM+++GEDS DKFAKNSFF+KFADFI EYK+AQ  N ++EEEE+ YER K M+EEQ
Sbjct: 1706 EFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPS-KADPSSARKR 1877
            Q++A+   + +                  GD R +MD LLE+LKN  P+ K DPSSARKR
Sbjct: 1766 QRKAQ---EAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKR 1822

Query: 1878 ALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEG 1937
            AL RKKLM   +S S IL  +D E+ + I S    D        +    +T+ +  DV  
Sbjct: 1823 ALVRKKLMG--ESTSNILKDIDTEDDSIIYS---PDAKKPMATTVDMANTTLESELDVSS 1877

Query: 1938 LNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTED 1997
                +   S+PI  E                    +E+ + +RA+ LL +L  S   T+ 
Sbjct: 1878 PTRHN---SSPIKNEISMNVDE-------------EEEEIGNRAQALLIQLTGSHSPTK- 1920

Query: 1998 RKSLLDEHKE 2007
            R SLL+EHKE
Sbjct: 1921 RHSLLNEHKE 1930

 Score =  500 bits (1287), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 300/723 (41%), Positives = 422/723 (58%), Gaps = 36/723 (4%)

Query: 286  DPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQ 345
            D ++  P  YV+KIISD +T+ E+ DLWV+LRTE +DWV  FI+ QG +A+AN L+K   
Sbjct: 332  DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIY 391

Query: 346  RXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRI 405
            +             KE +++KC RVL+ L +G++     +L+   +  GL S  L+TR++
Sbjct: 392  KTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKM 451

Query: 406  ATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGR 465
            ATE  + ML     K     F  I   L+ LDQ+ K   ++H+   L +  +     T  
Sbjct: 452  ATEIFVCMLN----KKNPERFKVI---LNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLD 504

Query: 466  ADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLL 523
            ++L V       WL+ +E++LDGRG+MGS VGAS+DYKN  GEN  LEY  +SMI IN L
Sbjct: 505  SNLKVT----RAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHL 560

Query: 524  CSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASST 583
            C    +++QR LLR++L+  G+ R++ +++ L Y  +  ++  +E+  LDD N L+  S 
Sbjct: 561  CLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSN 620

Query: 584  VDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKL 643
             ++++++ DP SL  N W   KGTE+E  L+SL+QHLFL SS+   +  D  + SKQLKL
Sbjct: 621  KNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKL 680

Query: 644  LDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHL 703
            +D+LV+NV+ +S D ES  N AIQRLYDAMQTDEVARR+ILESR LTKK EE +AE D L
Sbjct: 681  MDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLL 740

Query: 704  QTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXX 763
              KL  A                R+  K+ R+T+Q                         
Sbjct: 741  SQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRK 800

Query: 764  MLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRF 823
            MLTILN++ +    +  S    + + P   +  KK  IQK LQ+ L +T+KD T DS+ F
Sbjct: 801  MLTILNARSDKGEIEKKSSKK-HKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSF 859

Query: 824  GTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLP-----RLQSPPKIER 878
            G    PN+RLK LR +M+DIE EA  LEMTNFAEF+K+ K+E  P     + +   K E+
Sbjct: 860  GMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFEKK-KLEPAPKIKKLKQKKQNKNEK 918

Query: 879  NVRSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRS 938
                +K+K+L  LRQ LA IQ ESN+ISKFNVEERVNELF EK++ AL RL++LE KY+ 
Sbjct: 919  KEEDDKIKKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKD 978

Query: 939  FGIDFNME--SELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKIL 996
            FGI+FN++  SE     D  GD               S +   LDP     K++E+ +I 
Sbjct: 979  FGINFNIDDISEKTTGIDNSGD--------------KSTEYSSLDPNAYQIKLDELNRIT 1024

Query: 997  EEL 999
            E+L
Sbjct: 1025 EQL 1027

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 38/71 (53%)

Query: 168 LQKITDSDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVK 227
           L K    DG L+LE P  P            KRNIL S+      ELM YD+ KKWL+VK
Sbjct: 158 LSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVK 217

Query: 228 QDLQAELKRMK 238
           QDLQ E K+ K
Sbjct: 218 QDLQNEWKKFK 228

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/609 (59%), Positives = 460/609 (75%), Gaps = 30/609 (4%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FEKYPRP+K+LKQLHWEK+D  +NSIW  ++AEKFADDLYE+GVL+ LEKAFAARE+KSL
Sbjct: 1373 FEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSL 1432

Query: 1460 ISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKH 1519
             S+K D++K+TFL+RD+SQQFGINLHM+ +L+V+++VTKILKCD++ LN+ S IEFLSK 
Sbjct: 1433 SSKKGDDSKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSKQ 1492

Query: 1520 EIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSR 1579
            E+VEVS+N+AR ++PY+TDWEGV  +E+AK PEKDPNELQRADQLY+ L+VNLQ YW+SR
Sbjct: 1493 EVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYWSSR 1552

Query: 1580 MRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQG 1639
            MRALK+ITTYE++Y +L+ KLR +DKAVG++Q+SENL+NV +VILAVGNYMND+SKQAQG
Sbjct: 1553 MRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQG 1612

Query: 1640 FKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAND 1699
            FKL+TLQRLTFIKD  NSMTFLNYVEKIVR NYP F+ FL EL+PVL VVKISI+QL +D
Sbjct: 1613 FKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVSD 1672

Query: 1700 CGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLME 1759
            C EF  +V NVERS+EIGNLSDSSKFHP+DRVL KVLPVLPEARK+A+LL DEV+L+++E
Sbjct: 1673 CQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTMLE 1732

Query: 1760 FESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQ 1819
            F +LM+ +GEDS DKFAKNSFF+KFADFI EYK+AQ  N   EEEE+ YER K ++EEQQ
Sbjct: 1733 FNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQQ 1792

Query: 1820 KR---ARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARK 1876
            ++   ARK ++                     D R +MD+LLE+LKNAG  KADPSSARK
Sbjct: 1793 RQGEEARKRLE-SASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAGTVKADPSSARK 1851

Query: 1877 RALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVE 1936
            RALAR+KL+  K + S +L  +D ++ + + S     QS  +  I GSPT        + 
Sbjct: 1852 RALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSVGH-LIGGSPT----PGDKLL 1906

Query: 1937 GLNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTE 1996
            G  P  +L S+P + +                    D++ VT RA+ LL ELR       
Sbjct: 1907 GSTPTKEL-SSPTAGQ--------------------DDEDVTDRAKALLMELRGGQSSPM 1945

Query: 1997 DRKSLLDEH 2005
             + + LDE 
Sbjct: 1946 KKNAFLDEQ 1954

 Score =  530 bits (1365), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 346/911 (37%), Positives = 492/911 (54%), Gaps = 107/911 (11%)

Query: 171  ITDSDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDL 230
            I+  DG L LE P  P            KRNIL ++      ELM YD+ KKWL+VKQDL
Sbjct: 243  ISPEDGKLRLEMPDDPAEVELLYEDIMYKRNILQNLPTDKQLELMNYDVKKKWLIVKQDL 302

Query: 231  QAELKRMKNNVP---QSTVADPLSN----SVHLKSPRGSFSS-----SNMSARSISQNSA 278
            Q E K++K       Q+  + P  N    S     P   F       S  S+R  + N A
Sbjct: 303  QNERKKLKTKTSSHQQTVQSAPFMNLQDTSSSASLPGQGFHDQQSVVSETSSRVPTTNDA 362

Query: 279  KQLAVSYDPS-----------------------------HLS-------------PDHYV 296
              +  S  PS                             H S             P HYV
Sbjct: 363  ASILSSATPSLRHPSRRKQQYTLTNKQHTVYPANGTAERHASSSSTLASDKTNRLPIHYV 422

Query: 297  RKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXX 356
            +KII+D+++  ELNDLWV+LRTE +DWV  F+D QG +A+AN L+K   +          
Sbjct: 423  KKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVLMKSLYKTSPNVSLSGP 482

Query: 357  XXXKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTD 416
               KE +Y+KC +VL+ L +G++     +L+   +  GL S RL TR++ATE  + ML  
Sbjct: 483  LLDKEQSYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFSSRLPTRKMATEIFVCML-- 540

Query: 417  DELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTG--RADLHVIAKK 474
             E K   T FDA   V+ +LDQ  +  S+ H+       N  + +P      +L    K 
Sbjct: 541  -ETKN-QTRFDA---VITSLDQNFQIGSNAHM------VNNLQKMPDYFIHLNLQSTLKV 589

Query: 475  IEQWLYVLEYTLDGRGRMGSLVGASEDYK--NGENTVLEYLLYSMILINLLCSSHPDLHQ 532
            ++ WL+ ++ TLDGRG+MGSLVGAS+++K  +GEN+VLEY  ++++ +N  C S  +L+Q
Sbjct: 590  VQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNNLNQ 649

Query: 533  RNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKD 592
            R LLR++L++ G  R++ KM+LL Y  + +++  +E   LDD+NSL+ S    +++DM++
Sbjct: 650  RMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANIDMQN 709

Query: 593  PESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNV- 651
            P SL  N W   +GT+SE  L+SL+QHLFL S++    + DP + +KQLKL+D+LV+NV 
Sbjct: 710  PLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDSLVTNVG 769

Query: 652  -TFSSI-DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQ 709
             + S++ D E+  +  IQRL+D+MQTDEVARRAI+ESR LTKK EE++AE+D L  KL++
Sbjct: 770  SSVSAVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDKLSK 829

Query: 710  AXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILN 769
            A                 IL K+ RV  Q                         MLTI+N
Sbjct: 830  AEGGLVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLTIIN 889

Query: 770  SK--PNDASNDAVSP-DGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTV 826
            SK  PN A N + S     + K    L  E++  IQK LQD L +T+KD T D+++FG  
Sbjct: 890  SKASPNLAQNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDAKKFGMT 949

Query: 827  PAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQS------------PP 874
              PN+RL++LR K++DIE EA  LEMTNFA+ +K      L +               P 
Sbjct: 950  VQPNKRLQLLRMKVEDIENEARQLEMTNFADIEKNATPVILTKGTKKKKSKKKLKTAQPD 1009

Query: 875  KIER-NVRSE--KVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRD 931
            K +R N R+E  K++ L  LR  L  IQ ESN+ISKFNVEE VNELF E+K KAL RLRD
Sbjct: 1010 KKQRANQRNENQKIEALNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKALQRLRD 1069

Query: 932  LEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEE 991
            LE K+     +FN++           D  AS  +A  +T     D   LDP R D K++E
Sbjct: 1070 LESKFNGLNTNFNID-----------DIIASTEKALTATD----DGYSLDPRRADNKLDE 1114

Query: 992  MTKILEELNRL 1002
            + ++  +L++L
Sbjct: 1115 IERLTNDLSKL 1125

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/631 (58%), Positives = 450/631 (71%), Gaps = 45/631 (7%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FEKYPR +K+LKQLHWEK+DD DNSIW N +AE+FADDL+E+GVL  LE AFAAREIKSL
Sbjct: 1436 FEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSL 1495

Query: 1460 ISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             S+KK D  K+T+LSRDISQQFGINLHM+S+LTVDQ++ KI++CD+  LNT S I+FLSK
Sbjct: 1496 ASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSK 1555

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             EIVEVS+N+AR +APY+TDWEGV  V++AK PEKDPNELQRADQ+YL L+VNLQSYW S
Sbjct: 1556 QEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQLMVNLQSYWGS 1615

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RM ALK++T+YEKD+++LI KLR +D AVG+IQKSENL+NVF+VILAVGN+MND+SKQAQ
Sbjct: 1616 RMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMNDASKQAQ 1675

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKL+TLQRLTFIKD  N+MTFLNYVE I+R NYP F+ FL EL+PVL VVK+SIEQL  
Sbjct: 1676 GFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVSIEQLVR 1735

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC EF   + NV RS+EIG LSDSSKFHP D+VL KVLPVLPEA K+A+LL+DEV+LS+M
Sbjct: 1736 DCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDEVKLSIM 1795

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EFE+LM++FGEDS DKFAKNSFF+KFADFI EYKRAQE N K+EEEER YE  K  IEEQ
Sbjct: 1796 EFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHKKRIEEQ 1855

Query: 1819 QKR----ARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSA 1874
            QKR     +K+   DT                      VMD+LLE+LKN GP K DP+SA
Sbjct: 1856 QKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRD------VMDKLLEQLKNVGPVKTDPTSA 1909

Query: 1875 RKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATAD 1934
            RKRA+ RKKL + K++ S IL   +  E                 +I+ SPT +      
Sbjct: 1910 RKRAMVRKKLQNEKETASQILKEFETGE----------------DSIVYSPTDSKITPKK 1953

Query: 1935 VEGLNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILD------------EDAVTHRAR 1982
            V      ++   +P   EK                   D            +  +  RA+
Sbjct: 1954 VS-----NEYLQSPTPGEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAK 2008

Query: 1983 NLLQELRSSDDHTEDRKSLLDEHKEKVRQRR 2013
            +LL ELR S   T  + S+L+E KEK+R RR
Sbjct: 2009 SLLFELRGSQTPTR-KNSVLEERKEKLRARR 2038

 Score =  492 bits (1266), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 354/992 (35%), Positives = 522/992 (52%), Gaps = 158/992 (15%)

Query: 252  NSVHLKSPRGSFSSSNMSARSIS----------QNSA----KQLAVSYDPSHLSPDHYVR 297
            N+ ++ +P  S SS N++ +  S          +NS     K  A+S D ++  P+ Y++
Sbjct: 368  NTSNMLTPSNSISSRNLNQQDASPIISKPKTKLKNSNNINNKASALSPDRTNRLPNDYIK 427

Query: 298  KIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXX 357
            +I++DR++  E+NDLWV+LRTE + WV  F++ QG +A+AN L+K   R           
Sbjct: 428  EILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQNSLSTY 487

Query: 358  -XXKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYML-- 414
               KE  ++KC RVL+ L +G+   +  KL+   +V+GL S RL TR+IATE  + ML  
Sbjct: 488  LIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQGLFSTRLATRKIATEIFVLMLQK 547

Query: 415  -TDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAK 473
              DD L    T FD  F +   L+      +       L+ TN  +             K
Sbjct: 548  INDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKYHYLNSTNTTQ------------IK 595

Query: 474  KIEQWLYVLEYTLDGRGRMGSLVGASEDYK--NGENTVLEYLLYSMILINLLCSSHPDLH 531
             +  WLY +E TLDGRG+MGSLVGAS+D+K   GEN +LEY  ++M+LIN LC++   ++
Sbjct: 596  VLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINRLCNASTIIN 655

Query: 532  QRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMK 591
            QR LLR++L++ G  R++ K++ L Y  +  ++  +E++ LDD N+L+   T  SSVD+ 
Sbjct: 656  QRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQDT-KSSVDLD 714

Query: 592  DPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNV 651
            +P SL ++     K TE E  L S++QHL+L SSK F +  DP + SKQLKL+D+L+++ 
Sbjct: 715  NPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQLKLMDSLMTDA 774

Query: 652  TFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAX 711
            T S++D ES  N AIQ LYD+M TD+VARRAILESR LTKK EE++AERD L  +L++A 
Sbjct: 775  TLSTVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDFLSNRLSEAE 834

Query: 712  XXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSK 771
                            IL K+ RVT Q                         MLTILNS+
Sbjct: 835  NGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELRKMLTILNSR 894

Query: 772  PNDASNDAVSPDGINNKTPSPLKP----EKKMAIQKALQDRLRQTEKDLTRDSRRFGTVP 827
            P    ++ +S      +    ++     ++K  I+KALQD L++T+KDL+ DS+RFG   
Sbjct: 895  PETELDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDLSLDSKRFGITV 954

Query: 828  APNRRLKMLRSKMDDIEKEALMLEMTNFAE----FKKETKVED----LPRLQ-SPPKIER 878
             PN+RL+ LR +M+DIE EA  LEMTNF +     KK  +  D     P L+   P  ++
Sbjct: 955  QPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNKHPSLKPGIPIAKK 1014

Query: 879  NV-RSE----KVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLE 933
            N  RSE    K ++LA LR+ LA IQQE+N+IS+FNVEE VNELF  KK +A++RL++LE
Sbjct: 1015 NKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKKIQAMERLKELE 1074

Query: 934  EKYRSFGIDFNMESELLIETD---REGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIE 990
              Y++FG+DFNME E L + +   +E D D+   E              LDP     K++
Sbjct: 1075 TMYQNFGVDFNME-EFLEKNNTSTKELDPDSPAYE-------------TLDPNLFIDKMD 1120

Query: 991  EMTKILEELNRLKCQVDPTTANSGADISTSISTD----------DFNID----NTSLPST 1036
            E+ K   +L++L   ++ T +     +ST+ S            DF  D    NT+L   
Sbjct: 1121 ELDKFSMKLDQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTAL--- 1177

Query: 1037 VVEGSPSSYFKKASLXXXXXXXXXXXXXXXLSAETAEDSNKNNEDSVVGEHGVSPSGSVA 1096
                                                  SN  N++S    H  + SG   
Sbjct: 1178 --------------------------------------SNNVNDNSSTFSHQSTTSGG-- 1197

Query: 1097 MERSDSILTTSNTSFLESLSQKYGTGTNLQ-PAEDGAKRLXXXXXXXXXXXXQRNSGYH- 1154
                        +SFLESLSQKYGTG N   P       +               S Y+ 
Sbjct: 1198 ------------SSFLESLSQKYGTGQNASGPMSSNTPNV---------------SHYNP 1230

Query: 1155 RKSFVNRMKK-NSTPKSSSFVDEVSQKMTPVH 1185
             + F++RMKK ++TP   +++ E++QK++  H
Sbjct: 1231 ERKFMSRMKKQHATP---NYIRELNQKVSVTH 1259

 Score = 71.6 bits (174), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 49/88 (55%), Gaps = 7/88 (7%)

Query: 168 LQKITDSDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVK 227
           L K    DG ++LE P  P            KRNIL ++     RELM YD+ KKWL+VK
Sbjct: 195 LMKFMTPDGKVNLEMPNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVK 254

Query: 228 QDLQAELKRMKNNVPQSTVADPLSNSVH 255
           QDLQ+ELK+M++        +PL NS H
Sbjct: 255 QDLQSELKKMRS-------KNPLQNSNH 275

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/640 (56%), Positives = 460/640 (71%), Gaps = 14/640 (2%)

Query: 1378 LGRTKKYKGXXXXXXXXXXXXXFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADD 1437
            +G  K Y+              + KYPRP+K+LKQLHW+K+DD + SIW +A AE+FADD
Sbjct: 1238 MGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADD 1297

Query: 1438 LYERGVLTELEKAFAAREIKSLISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIV 1496
            LYE+GVL  LEKAFAAREIKSL ++KK D +K++FLSRDISQQFGINLHM+ SLTVD++V
Sbjct: 1298 LYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELV 1357

Query: 1497 TKILKCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPN 1556
             KILKC++D +NT S IEFLSK EI +VSIN+AR +APY TDWEGV  VE+AK PEK  +
Sbjct: 1358 IKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVD 1417

Query: 1557 ELQRADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENL 1616
             LQRADQ+Y+ L+VNLQSYW SRMRA+K+IT+YEK+Y +L+ KLR +D AV AIQKS+NL
Sbjct: 1418 GLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNL 1477

Query: 1617 RNVFDVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFD 1676
             N+F+VILAVGNYMNDSSKQAQGFKL+TLQRLTFIKD  NSMTFLNYVEKI+R NYP F+
Sbjct: 1478 TNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFN 1537

Query: 1677 VFLQELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVL 1736
             F++ELEPVL VVKIS+EQL NDC EF  ++ NVERSLEIGNLSDSSKFHP D+V+ KVL
Sbjct: 1538 GFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVL 1597

Query: 1737 PVLPEARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQE 1796
            PVLPEA K+++LL DEV+L+ MEFE+LM+ FGEDS DKFA+NSFF+KFADFI EYK+A+ 
Sbjct: 1598 PVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARA 1657

Query: 1797 FNKKMEEEERAYERRKIMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDR 1856
             N K EEE R YER K M+EEQQ++A++                       GD+R  MD+
Sbjct: 1658 QNLKAEEEVRKYERHKQMVEEQQRKAKEQ----EKNYMETGVSDSESAEAKGDNRGHMDK 1713

Query: 1857 LLEKLKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSD 1916
            LL +LKNAGP+++DPSSARKRA+ RKKL+  K S S+ILD L+  + + I S   D   D
Sbjct: 1714 LLAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVD 1773

Query: 1917 S----NPAILGSPTSTVGATADVEGLNPD---HDLPSAPISAEKGXXXXXXXXXXXXXXK 1969
            +    +  IL SPT       + +  N D   +D  +     +                 
Sbjct: 1774 TSLGEDEMILKSPTPKSKDNLETDN-NSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSN 1832

Query: 1970 KILDEDAVTHRARNLLQELRSSDDHTEDRKSLLDEHKEKV 2009
               +++ +T RA+ LL ELR S   ++ + S LD+ +EK+
Sbjct: 1833 GDGEDEVITDRAKALLMELRGSQTPSK-KNSHLDDQREKL 1871

 Score =  522 bits (1345), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 352/991 (35%), Positives = 525/991 (52%), Gaps = 116/991 (11%)

Query: 36  LFSNLMKLTGSSSALSQQR-IATXXXXXXXXXXXXXXLDLSTAKPLSKHSTLNTSSLSQY 94
           L  NL KLT SSS  SQ   I                L +   KPL+K ++LN  +LSQY
Sbjct: 26  LLHNLKKLTNSSSTTSQNNAINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQY 85

Query: 95  AD-EIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGG---NSNKXXXXXXXXX--------- 141
            + ++ +S++ S    LG                G   N N+                  
Sbjct: 86  INGKLPKSQSDSS--HLGNVKSNHKYEINENIQDGSSPNHNRSASVQSSAKYSYSRRSSN 143

Query: 142 -XXXXTLSRQPTXXXXXXXXXXXXVTL--LQKITDSDGNLSLEKPKYPXXXXXXXXXXXX 198
                 LSRQ T             +   L K  DS+G L+L+ P               
Sbjct: 144 STAATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMY 203

Query: 199 KRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMK-------------------- 238
           KRNIL ++S    R++M YD  KKW++VKQDLQ ELKR+K                    
Sbjct: 204 KRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKLKNNNINNSDTTIIPSSMPS 263

Query: 239 NNVPQSTVADPLSNS------------VHLKSPRGSFSSSNMSARSISQNSA-----KQL 281
           +N+ + +  + + N+            +H K  +   S SN +  + S  +A     + +
Sbjct: 264 SNISERSSVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSI 323

Query: 282 AVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLI 341
           + S D ++++P HYVRKI+SD ++  ELNDLWV+LRTE +DWV  F++ QG +AIAN LI
Sbjct: 324 SESSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLI 383

Query: 342 KFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLT 401
           +   +             KE  ++KC RVL  L +G+      KL++  +  GL S R++
Sbjct: 384 RCIYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVS 443

Query: 402 TRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSL 461
           TR++A E L+Y++     K     F++   V+ +LD+  + S ++++   + +     S 
Sbjct: 444 TRKMALEILVYIIN----KKNTQRFES---VIMSLDRFFRLSENLNMLKIITQFGGAFS- 495

Query: 462 PTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYK--NGENTVLEYLLYSMIL 519
              R       K  + ++  LE TL+GRG+MGS VGAS+D+K   GEN +LEY L+++I 
Sbjct: 496 ---RTSPDTQFKIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIF 552

Query: 520 INLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLM 579
           IN LC+   +L+QR +LR++ ++ G  RV+ K++L+ Y  +  +V  +ED  LDD+NSL+
Sbjct: 553 INKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLL 612

Query: 580 ASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSK 639
              +  + ++M+DP SL  + W   KGTE+E  LLSLMQHLFL SSK   +  +PA+ SK
Sbjct: 613 EMKSSSAQINMQDPTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSK 672

Query: 640 QLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAE 699
           QLKL+D+L++N+T S +D ++  N AIQRLYD+MQTD+VARRAILE+R L+KK EE+ AE
Sbjct: 673 QLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAE 732

Query: 700 RDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXX 759
           +++L+ KL++A                 IL KS RVT Q                     
Sbjct: 733 KEYLKEKLSKAENGLVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEV 792

Query: 760 XXXXMLTILNSKPN-DASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTR 818
               +LTI+N+  + DAS        +NN +      +KK  IQKAL+  L +T+KDL  
Sbjct: 793 ELRKILTIVNTNTDADAS--------LNNSS------DKKHNIQKALETELSRTKKDLNN 838

Query: 819 DSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKI-- 876
           D ++FG    PN+RL+MLR +M+DIEKEA  LEMTNF+E +K +       L+SP  +  
Sbjct: 839 DVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLS-------LESPAVLNK 891

Query: 877 -----------------------ERNVRSEKVKELAALRQRLAVIQQESNEISKFNVEER 913
                                   +   + K ++L  LR+ LA+IQ E+N++SKFNV++R
Sbjct: 892 TKKETKKKSKKKSKSSKSKEENNRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKR 951

Query: 914 VNELFYEKKTKALDRLRDLEEKYRSFGIDFN 944
           VNELF EKK +AL+RL+ LE+KY+SF IDF+
Sbjct: 952 VNELFKEKKHEALNRLQMLEKKYKSFEIDFD 982

 Score = 40.4 bits (93), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 23/78 (29%)

Query: 1109 TSFLESLSQKYGT-----GTNLQPAEDGAKRLXXXXXXXXXXXXQRNSGYHRKSFVNRMK 1163
            +SFLESLS+KYGT     GT+L P                     R +    KSF+NR K
Sbjct: 1061 SSFLESLSEKYGTAQNTEGTSLSPL----------------SPQNRIASLGEKSFMNRFK 1104

Query: 1164 KNSTPKSSSFVDEVSQKM 1181
            +   P S  F++E+SQK+
Sbjct: 1105 RK--PSSMQFLEELSQKV 1120

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/597 (60%), Positives = 448/597 (75%), Gaps = 51/597 (8%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459
            FE+YPRPKK+LKQLHWEKID+  +SIW+NA+AEK ADDL+ERGVL++LEKAFAARE KSL
Sbjct: 1226 FERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAFAARETKSL 1285

Query: 1460 ISRKKDEN-KVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
              + K+ N K+TFLSRD+SQQFGINLHM+S+L V  +V K++KCD++FL+T S IEFLSK
Sbjct: 1286 KGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTPSVIEFLSK 1345

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
              I+EV+ N+AR F PY+TDWEGV+SV++AK PEKDPNELQRADQLY++ ++NLQ YW S
Sbjct: 1346 PTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQLYVEFMINLQPYWGS 1405

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            RMRA+ +ITTYEKDY+DL+ KLR +D+AV  I++SE+LR+VFDVILAVGNYMNDSSKQAQ
Sbjct: 1406 RMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGNYMNDSSKQAQ 1465

Query: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
            GFKLSTLQRLTFIKDEKNSMTFLNYVEKI+R NYP +  F++ELEP+  V KISIEQL  
Sbjct: 1466 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSVTKISIEQLVT 1525

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            DC EF  +V NVERS+EIGNLSD SKFHP DRVL KV+PVLPEARK+A+LL+DE++LSL+
Sbjct: 1526 DCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADLLSDEIKLSLL 1585

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EFE+LM+ FGED++DKF+KNSFFQKFADFI E+K+A+  N K+EEEERAYERRK MIE+Q
Sbjct: 1586 EFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQ 1645

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878
            Q   RK  + D+                  DDRD +++LL+KLKNA PSK DPSS RKRA
Sbjct: 1646 Q---RKQQEADS----KATAKNLSTSQEPSDDRDDIEKLLDKLKNAAPSKGDPSSTRKRA 1698

Query: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDG-LDDQSDSNPAILGSPTSTVGAT-ADVE 1936
            LARKKL+DG KSG+ I D        NI +D  ++   + N  +  SPT+   A+  + E
Sbjct: 1699 LARKKLLDG-KSGASIFD--------NITADSTIEAFVEQNRTLTESPTAKKSASLPETE 1749

Query: 1937 GLNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDD 1993
             L+     P+                                 RARNLL ELR  D+
Sbjct: 1750 SLSSSKQDPA--------------------------------DRARNLLLELRGPDE 1774

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1016 (39%), Positives = 580/1016 (57%), Gaps = 77/1016 (7%)

Query: 1    MKRSTHSNKSSKGQHSHFSXXXXXXXXXXXXXXXXLFSNLMKL-TGSSSALSQ-----QR 54
            M+RS  S   +  ++SH                  LFSNL KL TG +   SQ     + 
Sbjct: 1    MQRSQSSRGPTGNENSH-------SRSLSNSQGSSLFSNLKKLATGGNHGSSQPSQTRKE 53

Query: 55   IATXXXXXXXXXXXXXXLDLSTAKPLSKHSTLNTSSLSQYA-DEIAQSRTPSGPVSLGXX 113
            + +                +  +KPL+K S+LNT +LS Y  D  A SR+ S  + L   
Sbjct: 54   LISSPKRVFTTASLESATPIGGSKPLNKISSLNTHNLSHYTMDPEANSRSQSASL-LTSP 112

Query: 114  XXXXXXXXXXXXXGGNSNKXXXXXXXXXXXXXTLSRQPTXXXXXXXXXXXXVTLLQKITD 173
                           ++NK             + S                   L +   
Sbjct: 113  TKYSYSRRSSQLTRSSTNKSIISSSAVSVSSNSTSI------------------LNRFLT 154

Query: 174  SDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAE 233
            +DG L L++P+ P            KRN+ +SVS    ++++ Y ++KKWLMVKQDLQ+E
Sbjct: 155  NDGTLKLDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQSE 214

Query: 234  LKRMKNNVPQSTVADPLSNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPD 293
             KR+K+  P+ +  D    + ++   + S S  N     +   +  Q ++   PSH  P+
Sbjct: 215  FKRLKSTKPRFSAND----TQNMLKRKTSTSKLNTQYEGMLHTNESQGSL-LSPSHFPPE 269

Query: 294  HYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXX 353
            +YVR+IIS +I   ELNDLWVSLRTE +DWVI F++AQGQVAIAN +I    +       
Sbjct: 270  YYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTDNQN 329

Query: 354  XXXXXX---KETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETL 410
                     +ETA +KCLRVL N+RE ++ A++S LV +A+VEGLLS ++ TRR+ATETL
Sbjct: 330  AVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLATETL 389

Query: 411  LYMLTDDE-LKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLH 469
            +Y++T DE  K+     D    V+ +L+ E+    +IH++ +    +   + P     L+
Sbjct: 390  IYLVTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFSTNDS--TDPESNPQLY 447

Query: 470  VIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLLCSSH 527
             + K ++QWLYV+E TLDGRG+MGSLVGAS++Y+N  GEN++ EYL+ S++LI+ LC ++
Sbjct: 448  QVCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLNN 507

Query: 528  PDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSS 587
             D+ +R+++R++LKS+GL+R+++KM+LL YP L   + +FED  +DDYNSL+ S     +
Sbjct: 508  EDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTEN 567

Query: 588  VDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDAL 647
            VDM DP S+     +  KGTE+E++LLS++Q+LFL S+K   ES DP +  +QLKL+D+L
Sbjct: 568  VDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLIDSL 627

Query: 648  VSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKL 707
            +SNV  +++D+ES FN AIQRLYD+MQTDE+ARRAILESRELTKK EE+KAERD+L  K+
Sbjct: 628  ISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDKI 687

Query: 708  AQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXXXXXXXXXXXXXXXXXXXXXMLTI 767
            ++A                 IL+K+ RVT+Q                         MLTI
Sbjct: 688  SKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLTI 747

Query: 768  LNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVP 827
            +NSK    S+D  S   + N  P PL PE+K AIQ  LQ  L++TE+DL  +SRR GT  
Sbjct: 748  VNSK---TSDDLESGSTVQND-PKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLGTAV 803

Query: 828  APNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKIERNVRSEKVKE 887
                RLK+LRSKM+DIE +A  LEMTNFA+ K        P+     K +  V+ ++  +
Sbjct: 804  GSKSRLKLLRSKMEDIENQARELEMTNFADVK--------PKQNQ--KFKEQVKGQQATK 853

Query: 888  LAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMES 947
            LA LR++LA+IQ ESN+I+KFN+E RVNELF +KK  ALDRL+DLE KY  F IDF  + 
Sbjct: 854  LAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHIDFADDP 913

Query: 948  ELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEELNRLK 1003
            EL     +  +G  S                 LDP  +  K+EEM  I++ELN LK
Sbjct: 914  ELKELLTQSSNGGPS-----------------LDPTIVQRKVEEMNSIIDELNALK 952

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 14/84 (16%)

Query: 1104 LTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQRNSGYHRKSFVNRMK 1163
            + ++ +SFLESLSQKY TG     + +G +                 SGYHRKSF+NR+K
Sbjct: 993  IVSNGSSFLESLSQKYSTGQQTATSTNGGR--------VGRETRYPGSGYHRKSFLNRLK 1044

Query: 1164 KNST-PKSSS-----FVDEVSQKM 1181
              +  P ++S     F+ E+  K+
Sbjct: 1045 NTTVNPTATSEHLPPFLTELKSKV 1068

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/624 (57%), Positives = 447/624 (71%), Gaps = 47/624 (7%)

Query: 1401 EKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSLI 1460
            ++ PRP+K+LKQLHW+K+D  D+SIW    AE+FADDLYE+GVL  LEKAFAAREIKS+ 
Sbjct: 1269 DRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIG 1328

Query: 1461 SRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKH 1519
            +RKK D +K++FLS DISQQFGINLHMY SL V +++ K+LKCD++ +NT S IEFL+K 
Sbjct: 1329 TRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKS 1388

Query: 1520 EIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQL-YLDLI------VNL 1572
            EIVEVS+N+AR +APYTTDWEGV S++  K         QR  Q+ Y +LI      VNL
Sbjct: 1389 EIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELIKFIYNMVNL 1440

Query: 1573 QSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMND 1632
            QSYW SRMRALK+IT+YE++YN+L+ KLR +DKAVGA+Q+SENL+NVF+VILAVGNYMND
Sbjct: 1441 QSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMND 1500

Query: 1633 SSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKIS 1692
            +SKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKIVR NYP F+ F+ +LEPVL VVK+S
Sbjct: 1501 TSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLS 1560

Query: 1693 IEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADE 1752
            +EQL +DC EF  ++ NVERSLEIGNLSDSSKFHP+D+VL KVLPVLPEA K+++LL DE
Sbjct: 1561 VEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDE 1620

Query: 1753 VQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRK 1812
            V+L++MEFE+LM+ +GED+ DKFAKNSFF+KFADFI EYK+AQ  N K EEEERAYE+ K
Sbjct: 1621 VKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQSQNLKQEEEERAYEKHK 1680

Query: 1813 IMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPS 1872
             MIEEQQ +                           D R +MD+LLEKLKNAGP KADPS
Sbjct: 1681 RMIEEQQHK-------QDLEEERSREVEGEPGEEQSDRRAMMDKLLEKLKNAGPGKADPS 1733

Query: 1873 SARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGAT 1932
            SARKRAL RKKL+  K+  + IL  +D  + + + S     Q   N   L SPT +  + 
Sbjct: 1734 SARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPNDIHLASPTPSGKS- 1792

Query: 1933 ADVEGLNPDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSD 1992
                      DL  A +S  K                 I +++ ++ RA+ LL ELR S+
Sbjct: 1793 ----------DLVLASVSPTK-----------ESTADGIAEDEFISDRAKALLLELRGSE 1831

Query: 1993 DHTEDRKSLLDEHKEKVRQRRNKK 2016
            +    R S L+E KEK++ RR+++
Sbjct: 1832 NMK--RNSQLEEQKEKLKARRSRR 1853

 Score =  542 bits (1396), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 361/1004 (35%), Positives = 519/1004 (51%), Gaps = 108/1004 (10%)

Query: 78   KPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGXXXXXXXXXXXXXXXGGNSNKXXXXX 137
            +PL+K STLNT +LSQY       +    P+                     S +     
Sbjct: 63   RPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRSSTAT 122

Query: 138  XXXXXXXXTLSRQPTXXX--XXXXXXXXXVTLLQKITDSDGNLSLEKPKYPXXXXXXXXX 195
                     LSRQ T               T L K  DSDG ++LE P+ P         
Sbjct: 123  GPIK-----LSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEALFED 177

Query: 196  XXXKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRM------------------ 237
               KRNI  ++     +ELM YD+ KKW +VKQDLQ E+K++                  
Sbjct: 178  LMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSYHPTEGSYSSAS 237

Query: 238  --------------------KNNVPQSTVADPLSNSVHLKS---------------PRGS 262
                                 +N PQ+ +    S ++   +               P GS
Sbjct: 238  NSNGNLNSYSSSLRSSATSQDSNSPQTAIFTSNSGTMQNNTINLNNGNIPVGGKSRPVGS 297

Query: 263  FSSSNMSARSISQNSAKQLAVS---YDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTE 319
             S+++ +   I Q+S    +VS    D  +  P HYV+KII+DR+T+ E+NDLWV+LRTE
Sbjct: 298  SSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTE 357

Query: 320  SIDWVIGFIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQ 379
             +DWV  F++ QG +A+AN L+    +             KE +++KC RVL+ L +G+ 
Sbjct: 358  QLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLY 417

Query: 380  AALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQE 439
                 KL+   +  GL S RL TR++ATE L+ M+     K  +  F+ +   L    ++
Sbjct: 418  EFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIE----KRNNMRFEVVLASLDRYFRQ 473

Query: 440  SKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGAS 499
             +  + +HL   L      +S P  +       K I+ WL  L+ TL+GRG+MGSLVGAS
Sbjct: 474  EENLNMVHLSKTL-PGEYPQSTPNTKY------KIIQAWLIALDETLNGRGKMGSLVGAS 526

Query: 500  EDYKN-GENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYP 558
            +DY++ GEN +LEY L++M+ IN LCS+   L+QR LLR++L++ G  R++ K++ L Y 
Sbjct: 527  DDYRSAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYE 586

Query: 559  ALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQ 618
             L  ++  +++  LDD+N+++ + + +S V+M++P SL  N W   KG+++E  LLSL+Q
Sbjct: 587  KLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKLLLSLIQ 646

Query: 619  HLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEV 678
            HL+L SSK   E  DP + SKQLKL+D+L++NV  S  D ES  N AIQRLYD+MQTDEV
Sbjct: 647  HLYLSSSKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEV 706

Query: 679  ARRAILESRELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQ 738
            ARRAILESR LTKK EE  AERD+L  KL+ A                 ILEK+ RV  Q
Sbjct: 707  ARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMKQ 766

Query: 739  XXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKK 798
                                     MLTILNS+     N   +PD +++ T + L P KK
Sbjct: 767  LESELEDLKKKHLLEKHEHEVELRKMLTILNSR-----NGTQNPD-VDDVTIT-LDPNKK 819

Query: 799  MAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEF 858
            + IQKAL+  L +T+KDL+ DS+RFG    PN+RLKMLR +M+DIE EA  LEMTNFA+ 
Sbjct: 820  LDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADH 879

Query: 859  KKET-KVEDLPRLQSPPKIERNVRSE--------KVKELAALRQRLAVIQQESNEISKFN 909
            K+   K   + + +   + ++ + +E        K K+L  LR+ LA IQ E+N+ISKFN
Sbjct: 880  KRTNLKKPVIVKKEKKLRKKKKINTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFN 939

Query: 910  VEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNS 969
            VE RVNE+F +KK KAL RL+ LE KY+ F I F+                  + +  + 
Sbjct: 940  VEGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPFD-----------------ELQDLDDR 982

Query: 970  TAPNSLDSCVLDPARLDAKIEEMTKILEELNRLKCQVDPTTANS 1013
               +      LDP  L  KI E+ +I +EL  +    D    N+
Sbjct: 983  ELDDEQQHSTLDPTYLQKKINELDEISDELYLMNYDSDANNGNT 1026

 Score = 39.7 bits (91), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 13/72 (18%)

Query: 1110 SFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQRNSGYHRKSFVNRMKKNSTPK 1169
            SFLESLSQKYGTG N                       +R +    KSF+NR+K+ +   
Sbjct: 1059 SFLESLSQKYGTGQN-----------AISSPTSITSPNERIASQGEKSFMNRLKRQTM-- 1105

Query: 1170 SSSFVDEVSQKM 1181
            ++ F++E++QK+
Sbjct: 1106 AAPFLEELTQKV 1117

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/608 (58%), Positives = 446/608 (73%), Gaps = 20/608 (3%)

Query: 1401 EKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSLI 1460
            + YP+P K+LKQLHWEK+D  ++SIW +  AEKFA DLYE+GVL  LEKAFAAREIK+L 
Sbjct: 1257 DNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLA 1316

Query: 1461 SRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKH 1519
            ++KK D  K+TFLS D SQQFGINLHMYS ++V+ +V KILKCD+DF+ T S IEFLSK 
Sbjct: 1317 TKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKS 1376

Query: 1520 EIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSR 1579
            EI EVS+N+AR F+PY+TDW+G+ S+E+AK PEKDPN+LQRADQ+YL LI NLQ+YW SR
Sbjct: 1377 EITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSR 1436

Query: 1580 MRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQG 1639
            MRA+K+IT+Y+K+Y +L+ KLR +DKAVGAI KSENL N+F+VILAVGN+MND++K+AQG
Sbjct: 1437 MRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQG 1496

Query: 1640 FKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAND 1699
            FKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP F+ FL+ELEPVL V KISI+QL ND
Sbjct: 1497 FKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVND 1556

Query: 1700 CGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLME 1759
            C E+C  VTNVERS+EIGNLSDSSKFHP DRVL KVLPVLPEARK+ +LL DEV+LS+ME
Sbjct: 1557 CNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIME 1616

Query: 1760 FESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQ 1819
            FE+LM+ +GED+ DKFAKNSFF+KFADF+ EYK+AQ  N K+EEEER YER K M+EEQQ
Sbjct: 1617 FENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQ 1676

Query: 1820 KRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRAL 1879
            +R +   +                     D R +MD+LL++LKNAGP+ +DPSSARKRAL
Sbjct: 1677 RREQTPSK---NRDYVVNEDEDIADDDDQDRRAMMDKLLDQLKNAGPTTSDPSSARKRAL 1733

Query: 1880 ARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGLN 1939
             R+KL   K + + ++  LD  E + + S        +N A   SPT   G+  + + + 
Sbjct: 1734 MRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSAN-AEEASPTVHKGSNKNNKPVL 1792

Query: 1940 PDHDLPSAPISAEKGXXXXXXXXXXXXXXKKILDEDAVTHRARNLLQELRSSDDHTEDRK 1999
             D +   +PI A +                       ++ +A+NLL EL  +   T  R+
Sbjct: 1793 SDLE---SPIKASRNADRNNENEEE-----------EISDKAKNLLMELSGNGAPTR-RE 1837

Query: 2000 SLLDEHKE 2007
             LL+ HKE
Sbjct: 1838 ELLNGHKE 1845

 Score =  522 bits (1345), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 323/863 (37%), Positives = 490/863 (56%), Gaps = 56/863 (6%)

Query: 165  VTLLQKITDSDGNLSLEKPKYPXXXXXXXXXXXXKRNILNSVSVHSHRELMGYDLDKKWL 224
            +T L +    DG + L+ P+              KRNI+ ++     +EL  YD+DKKWL
Sbjct: 166  LTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKKWL 225

Query: 225  MVKQDLQAELKRM-----------KNNVPQSTVADPLSNSVHLKSPRGSFSSSNMSARSI 273
            +V+QDL ++LK+M             N    ++ + +S+  +  +       +N S++S+
Sbjct: 226  IVRQDLSSDLKKMMAKSSSSATQASANTTDLSLTNTISSHDYSDATSIRHMKTNASSKSL 285

Query: 274  SQN-------SAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIG 326
            + N       ++    V+ +  +  P +YV+KII+D +T  ELNDLWV+LRTE +DWV  
Sbjct: 286  NSNLYSNANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDA 345

Query: 327  FIDAQGQVAIANRLIKFAQRXXXXXXXXXXXXXKETAYYKCLRVLTNLREGMQAALSSKL 386
            F++ QG +A+AN L+K   +             +E +Y+KC RVL  L +G+       +
Sbjct: 346  FLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAI 405

Query: 387  VISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSI 446
            +   V   L SIRL TR++ATE  + ML     K   + FD I   L ALD++     ++
Sbjct: 406  MAETVAYALFSIRLPTRKMATEIFVCMLE----KKNKSRFDVI---LTALDKKFMIGENL 458

Query: 447  HLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYK--N 504
            H+   +   N  +     + D     K ++ WL  LE  L GRG+MGSLVGASE+ +   
Sbjct: 459  HMMQFVK--NSPQQFIHLKRDSQF--KIVQAWLTGLETALQGRGKMGSLVGASEEVRAAG 514

Query: 505  GENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEV 564
            GEN++LEY  ++M+ IN LC     ++QR LLR+RL++ G  R++ + +LL Y  +  ++
Sbjct: 515  GENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQI 574

Query: 565  SKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWS 624
              +E+  LDD N+L+ S   ++ V+M+DP  +    W   KGTE+E   +SL++HLFL S
Sbjct: 575  EYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSS 634

Query: 625  SKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAIL 684
            SK   +  DP++ +KQLKL+D+LV+NV+ S++D ES  N AIQRLYDAMQTDEVARRAIL
Sbjct: 635  SKVADDRGDPSKLAKQLKLMDSLVANVSVSAVDEESSVNVAIQRLYDAMQTDEVARRAIL 694

Query: 685  ESRELTKKCEEMKAERDHLQTKLAQAXXXXXXXXXXXXXXXXRILEKSNRVTDQXXXXXX 744
            ESR+LTK+ EE++AERD L+ KL                    IL K+ RV         
Sbjct: 695  ESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAELE 754

Query: 745  XXXXXXXXXXXXXXXXXXXMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKA 804
                               MLTILN++P+D   + ++      K+ + L P+++ +IQKA
Sbjct: 755  ELKKKHLLEKHEHEVELRKMLTILNARPDD---ENLAKSTKVTKSVNGLDPDRQTSIQKA 811

Query: 805  LQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKV 864
            LQD L++T KDL+ DS+RFG    PN+RL+MLR KM+ IE+EA  LEMTNFAE  +E ++
Sbjct: 812  LQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEH-EEKQL 870

Query: 865  EDLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTK 924
            E+       P      +   V++L+ LR++L+ IQ+E+NE++KFNVEERV ELF +K+ K
Sbjct: 871  EE-------PVGTGTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLK 923

Query: 925  ALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPAR 984
            AL RL++LE  Y+ FGIDFN  +  L+E+     GD    +       + +D   L  A+
Sbjct: 924  ALKRLKELETTYKGFGIDFNANA--LLESK---GGDIHWND-------DEIDGQDLQGAQ 971

Query: 985  LDAKIEEMTKILEELNRLKCQVD 1007
               K++EM +I  EL  +K +V+
Sbjct: 972  --EKMDEMDRIANELTAMKMKVE 992

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 50/121 (41%), Gaps = 26/121 (21%)

Query: 1095 VAMERSDSILTTSNTSFLESLSQKYGTGTNLQPAEDGAKRLXXXXXXXXXXXXQRNSGYH 1154
             A E S     +   SFLE+LSQKYG G N                        R S  H
Sbjct: 1022 TASEFSQKSFGSGAGSFLEALSQKYGAGQN------------TTISNSPFPGVDRKSSNH 1069

Query: 1155 RKSFVNRMKK-NSTPKSSSFVDEVSQKMTPVHVAQSPDSLQNT---------ATSSSTPQ 1204
            R SF NRMKK N+TP    + DE+++K+        P S  +          ATS + PQ
Sbjct: 1070 RTSFANRMKKSNATP----YFDELTRKVAKAPSLNDPSSPGSNEPGDDDTLPATSPTVPQ 1125

Query: 1205 S 1205
            S
Sbjct: 1126 S 1126

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  335 bits (860), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 167/428 (39%), Positives = 270/428 (63%), Gaps = 17/428 (3%)

Query: 1404 PRPK----KRLKQLHWEKIDDLDNSIWENARA-EKFADDLYERGVLTELEKAFAAREIKS 1458
            P PK    K++KQ+HWEKI+D++N+ W+N +  E+   +L   G+  ++E  F  + +  
Sbjct: 810  PVPKLSETKKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSV 869

Query: 1459 LISRKK----DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIE 1514
            ++ +KK        ++FLSRD++QQFGINLH++  L+ D++V+K+L+CD D L   S +E
Sbjct: 870  IMKKKKVVSSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLE 929

Query: 1515 FLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQS 1574
            F  K E+  ++ ++ R   PY+TD+    SV     P K+P+ELQRAD+++L L  NL+S
Sbjct: 930  FFCKEEMTHINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRS 984

Query: 1575 YWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSS 1634
            YWN R + L L+ TYEKDY DL+ KL+ +D A+  I  SE  +N+  +I+ +GN+MN  +
Sbjct: 985  YWNERSQCLLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--T 1042

Query: 1635 KQAQGFKLSTLQRLTFIK-DEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISI 1693
            +   G +LS L +L FIK +  N+++FL+Y+E+++R +Y     F+ +L  V ++ KIS+
Sbjct: 1043 RPVSGIRLSALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISM 1102

Query: 1694 EQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEV 1753
            +Q+A  C EFCS +  +  ++  G LSD  K HP+D++L KV   +  AR +  LL D  
Sbjct: 1103 DQVALQCEEFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHF 1162

Query: 1754 QLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKI 1813
            +LS  +FE +MR +GED  D  +K+ FFQ F +F   +K+  + N + EE ER Y +RK 
Sbjct: 1163 KLSNNDFEKVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKK 1222

Query: 1814 MIEEQQKR 1821
            ++E   ++
Sbjct: 1223 IMEASTRK 1230

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  334 bits (857), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 164/423 (38%), Positives = 269/423 (63%), Gaps = 18/423 (4%)

Query: 1404 PRPKKRLKQLHWEKIDDLDNSIW--ENARAEKFADDLYERGVLTELEKAFAAREIKSLIS 1461
            P  + +LKQ+HW+KI+++  ++W  E  R  K + +L   G+  E+E+ F  +   + ++
Sbjct: 1160 PSTRIKLKQIHWDKIENIKETVWCDEQQRVSK-SSELESLGIFKEIEELFEIKPASTNLA 1218

Query: 1462 R------KKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEF 1515
                   K   ++++ LSR+++Q+FGINLH++S  TV+++V K+L CD + +  Q  +EF
Sbjct: 1219 NATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSEVMKNQGVLEF 1278

Query: 1516 LSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSY 1575
              K E   V  ++ R F PY T++         ++PEKDP EL+RAD++YL+L  NL+SY
Sbjct: 1279 FCKEEANNVPQSIQRLFGPYETNYL------TGERPEKDPAELERADRIYLELFYNLRSY 1332

Query: 1576 WNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSK 1635
            W +R   L +I+T+E+DY D++ KL+ +D A  AIQ S  L+ +F +I+ +GNYMN   K
Sbjct: 1333 WAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVEIGNYMNQ--K 1390

Query: 1636 QAQGFKLSTLQRLTFIKDEK-NSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIE 1694
              QG +LS+L +L F K  K N+++F++ +E+IVRT YP    F++ +  +  V  I ++
Sbjct: 1391 PVQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVEGINSITGVANIIVQ 1450

Query: 1695 QLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQ 1754
             +  +  EFC  + N++RSL  G LSD SKFHP DR L +    L +A+K+A LL D+  
Sbjct: 1451 HVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKKKARLLRDQCS 1510

Query: 1755 LSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIM 1814
            L++ +FE LM  +GE+  +  +KN+FFQKF DFIL +++A + N + EE +R YE+R+ +
Sbjct: 1511 LTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTEREELDRTYEKRRRL 1570

Query: 1815 IEE 1817
            +E+
Sbjct: 1571 LEQ 1573

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 104/244 (42%), Gaps = 32/244 (13%)

Query: 471 IAKKIEQ----WLYVLEYTL--DGRGRMGSLVGASEDYKNGENTVLEYLLYSMILINLLC 524
           +++++EQ    WL  +E T+  + + R       S      +  +++Y + +M LIN L 
Sbjct: 272 VSQELEQHYSRWLAAVETTITDEAQWRRSPFRAQSP-----QQFMIDYCVSTMFLINALI 326

Query: 525 SSHPDLHQRNLLRSRLKSYGLSRVIKKM----ELLKYPALENEVSKFEDRTLDDYNSLMA 580
              P    +      L+  G+ R+  ++    E      L +E+SK++ R          
Sbjct: 327 QGMPSYQAKGKTIRLLRDAGIHRIFHRIVSSGEKFDSEILLDEISKYQTR---------- 376

Query: 581 SSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSL--MQHLFLWSSKAFSESTDPAEGS 638
            + +++    + P S + +F  + K   S     SL     L L S +    S   AE +
Sbjct: 377 ETEINAKFVPETPPSRYVSFAAQIKTIVSLTQGTSLESSMALVLDSIRQIITSRTSAEAA 436

Query: 639 KQLKLLDALVSNVTFSSID-----TESGFNGAIQRLYDAMQTDEVARRAILESRELTKKC 693
           K L+L  ++   +   S D     TES    A+ +L D +Q+ +V +RA+ E      + 
Sbjct: 437 KLLQLFHSIFKYLIAHSYDREELGTESVLRAALNKLMDDLQSTQVNQRAVQELEAAHAQI 496

Query: 694 EEMK 697
           E++K
Sbjct: 497 EDLK 500

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  326 bits (836), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 298/499 (59%), Gaps = 38/499 (7%)

Query: 1404 PRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFA----AREIKSL 1459
            P+   RLKQ+HWEK+DD+  ++WE+       D L + GV +++EK F      ++ K L
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1460 ISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKH 1519
               +    K++FL+RDI+QQFGINLHMYS L+V++ VTK+LKC+ D +   S + F +K 
Sbjct: 875  AENENKPTKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTKE 934

Query: 1520 EIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSR 1579
            ++ ++   + R FAPY+T++    S      PEKDP EL+RAD +YL+L  NL+SYW++R
Sbjct: 935  DLTQIPSGLERKFAPYSTNYLTDDS------PEKDPRELERADHIYLELFYNLRSYWSAR 988

Query: 1580 MRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQG 1639
               L ++TTYE+DY DL+ KL  +D+A+  +  S  ++ +  +I  +GNYMN  S    G
Sbjct: 989  SHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VTG 1046

Query: 1640 FKLSTLQRLTFIKD--EKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLA 1697
             KL++L +L+F+K   EKN ++FL++VE++VR ++P    F +++  V  + K+++E + 
Sbjct: 1047 IKLNSLPKLSFVKSSSEKN-ISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVE 1105

Query: 1698 NDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSL 1757
             +C EF   V +V  SL  G LSD +K HP D +  K+   +  A+ ++ LL ++ +L+ 
Sbjct: 1106 LECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTK 1165

Query: 1758 MEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEE 1817
                 LM+ +GE+  DK +KN+FF  F +F + +K+  + N + EE  R YE+RK ++E+
Sbjct: 1166 RSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ 1225

Query: 1818 QQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKR 1877
            + K+  +    D                   D+ + +D L+ KL++A   K  P+  R+R
Sbjct: 1226 RNKKIEEQEHSD-------------------DEINAVDDLITKLRDA--KKQHPAPLRRR 1264

Query: 1878 ALARKKLMDGKKSGSIILD 1896
              + K +++ K++G  +L+
Sbjct: 1265 R-STKAVLNEKRAGEPLLE 1282

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  325 bits (834), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 162/420 (38%), Positives = 265/420 (63%), Gaps = 18/420 (4%)

Query: 1406 PKKRLKQLHWEKIDDLDNSIW--ENARAEKFADDLYERGVLTELEKAFAAREIKSLISR- 1462
            PK +LKQ+HW+KIDD+  ++W  ++ R  K + +L   G+  E+++ F        I+  
Sbjct: 958  PKLKLKQIHWDKIDDIKETVWCDQSQRVSK-STELASFGIFQEIDELFQLNPTSPAIANA 1016

Query: 1463 -----KKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLS 1517
                 K    KV+ LSR+++Q+FGINLH++S  TV+++ +K+L CD + L  QS IEF  
Sbjct: 1017 TANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIEFFC 1076

Query: 1518 KHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWN 1577
            K EI  +  ++ + FAPY+ ++         +QP++DPNEL RAD++YL+L  NL+SYW 
Sbjct: 1077 KEEINNIPKSVQQLFAPYSANYIT------GEQPDRDPNELDRADRIYLELFYNLRSYWG 1130

Query: 1578 SRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQA 1637
            +R + L +I T++KDY D++ KL  +D A  A+Q S  L+ +F +I+ +GNYMN   +  
Sbjct: 1131 ARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ--RPV 1188

Query: 1638 QGFKLSTLQRLTFIKDEK-NSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQL 1696
             G +LS+L +L F K    N+M+F++ +E+IVR  YP    F++ L+ +L+V  I ++ +
Sbjct: 1189 AGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIVQHV 1248

Query: 1697 ANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLS 1756
              +  EFC  + ++ER   IG LSD S+FHP D+ + K    +  A+K+A+LL D+  L+
Sbjct: 1249 QQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQCTLT 1308

Query: 1757 LMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIE 1816
            + +FE LM  +GE+ ++  +KNSFF+KF DFI  +++A + N + EE  R YE+R+  +E
Sbjct: 1309 MSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRRALE 1368

 Score = 55.8 bits (133), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 103/230 (44%), Gaps = 20/230 (8%)

Query: 477 QWLYVLEYTLDGRGRMGSLVGASEDYKNGENTVLEYLLYSMILINLLCSSHPDLHQRNLL 536
           QWL  +E T+    +    V +++     +  +++Y + +M LIN L    P    ++ L
Sbjct: 288 QWLEAVETTIKDETQWHDDVPSNQ---KPQQLMIDYCVSTMFLINSLIQGIPTYRGKSRL 344

Query: 537 RSRLKSYGLSRVIKKM----ELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKD 592
              LK  G+ R+  ++    E      L +E+SK++ R  +  +  +  +    +V  K 
Sbjct: 345 IRLLKDAGIHRIFHRIVSSGEKFDSEILLDEISKYQSREGEINSKFVIDTPTHLNVSFK- 403

Query: 593 PESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVT 652
             S      T  +GT  E+++      L L S +    S   AE +K L+L  ++   + 
Sbjct: 404 --SQIKTIVTLTQGTSLESYMT-----LVLDSIRQIVTSRTSAEATKLLQLFQSIFKYLI 456

Query: 653 FSS-----IDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMK 697
             S     + TE     ++ +L D +Q+ +V +RA+ E  E+  K EEMK
Sbjct: 457 EHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQELEEMKVKMEEMK 506

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  324 bits (830), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 164/421 (38%), Positives = 271/421 (64%), Gaps = 20/421 (4%)

Query: 1409 RLKQLHWEKIDDLDNSIWENARAEKFADD-LYERGVLTELEKAFAAREIKSLISRK---- 1463
            +L+Q+HW+ I+D+  + W      K     L E GV  E+E+ F    IK  + +K    
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELF---RIKQPVPKKPNVA 915

Query: 1464 ---KDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKHE 1520
               ++  KV+FLSRD++QQFGINLHM+S+ TV ++V K+L C+ + +  QS +EF +K +
Sbjct: 916  KTSQNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKED 975

Query: 1521 IVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSRM 1580
            +  +S ++ + F PY+T+      V   + P KD +EL+RAD+++L+L  NL+SYW +RM
Sbjct: 976  LTNISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARM 1029

Query: 1581 RALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQGF 1640
            R L ++ TYEKDY D++ KL+ +D A  AI+ S+ L+ +  +I+ +GNYMN+  +QA+G 
Sbjct: 1030 RCLLILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGI 1087

Query: 1641 KLSTLQRLTFIK-DEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAND 1699
            KLS+L +L F+K    N+M+FL+Y+E+I+RT Y      + +L  +  + K++++Q+  D
Sbjct: 1088 KLSSLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELD 1147

Query: 1700 CGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLME 1759
            C EF   + N+ERS + G+LS +  FHP D +++K    +P A+++ +LL D+ +L++ +
Sbjct: 1148 CREFNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHD 1207

Query: 1760 FESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQ 1819
             E LM   GE+  D  AKN+FFQ F DF+  +K+A   N + EE ER YE+RK ++E ++
Sbjct: 1208 LEKLMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKE 1267

Query: 1820 K 1820
            +
Sbjct: 1268 R 1268

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 95/200 (47%), Gaps = 14/200 (7%)

Query: 511 EYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDR 570
           +Y L ++ LIN +        ++ LL  + K  G+ R+  K +      L++E+ K+++ 
Sbjct: 319 DYCLSTLFLINSIIQVTTSYREKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYKE- 377

Query: 571 TLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSE 630
            +++     +S  + + +D+    S+        + T  E  L  L++ +        S 
Sbjct: 378 -VEEEVITRSSPELPTFLDI-SYGSILKTLILETRSTPLEHPLYQLLEGVL-----QISV 430

Query: 631 STDPAEGSKQLKLLDALVSNVTFSSIDTESG------FNGAIQRLYDAMQTDEVARRAIL 684
           +   +E  K  KL  +++  +   + D++SG         ++ ++ D++Q+DE+ARRA+ 
Sbjct: 431 TRTSSESIKLFKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQMMDSLQSDEIARRAMK 490

Query: 685 ESRELTKKCEEMKAERDHLQ 704
           E   L +  +++ AE + L+
Sbjct: 491 ELNSLQETVDQLTAEVESLK 510

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  322 bits (825), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 176/466 (37%), Positives = 280/466 (60%), Gaps = 25/466 (5%)

Query: 1407 KKRLKQLHWEKIDDLDNSIWENARAE-KFADDLYERGVLTELEKAF-----AAREIKSLI 1460
            K +LKQ+HW+KIDD+  ++W + +     + +L   GV  E+E+ F     A +   ++ 
Sbjct: 813  KVKLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMF 872

Query: 1461 SRKKDEN-KVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKH 1519
            + +   N KVT LS D++QQFGINL+++S+ +V+++V K+L CD + +  QS IEF SK 
Sbjct: 873  TAQNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKD 932

Query: 1520 EIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSR 1579
            +I  +  ++ R FAPY T++          +PEKD   L RAD++YL+L  NL+SYW  R
Sbjct: 933  DINHIPQSIQRMFAPYETNYL------TGDKPEKDSRSLDRADRIYLELFYNLRSYWAPR 986

Query: 1580 MRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQG 1639
             + L  + TYEKDY D++ KL+ +D    AI+ S+ L+ +  +I+ VGNYMN+  KQA G
Sbjct: 987  AKYLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALG 1044

Query: 1640 FKLSTLQRLTFIKDEK-NSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698
             +LS+L +L F K  K N+++F++ +E IVR NYP    F+ +LE +L V  I ++ +  
Sbjct: 1045 IQLSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQ 1104

Query: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758
            +  EF   ++ +ERSL +G LSDSSKFHP D+ L      +  A K+A+LL  +  L++ 
Sbjct: 1105 EAQEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMG 1164

Query: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818
            EF+ LM  +GED ++ F+KN+FFQKF DF L +K+A + N +  E  R  E R+ ++E  
Sbjct: 1165 EFDKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENIE-REVRRVCESRRYLLE-- 1221

Query: 1819 QKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNA 1864
             K    +I++D                   DD+  ++ L+++L+N 
Sbjct: 1222 -KTGNSHIRVD-----RSERCTLPSLPADSDDQQAVEILIKRLRNV 1261

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  321 bits (823), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 170/485 (35%), Positives = 287/485 (59%), Gaps = 38/485 (7%)

Query: 1405 RPKKRLKQLHWEKIDDLDNSIW--ENARAEKFADDLYERGVLTELEKAFAAREIKSLISR 1462
            +PK+ LKQ+HWEK++D++ ++W  +N + E   + L   G+ +++E++F  +E     ++
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKE-LKRGGIFSQIEESFKVKERTIKQTK 856

Query: 1463 KKDENKVT----FLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
             KD+ + T    FL RD++QQFGINLHM+S  + +Q V K+L+CD + +   +A+EF ++
Sbjct: 857  NKDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTR 916

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             ++V V+ ++ R F PY+TD+           P KDP EL R D+++L+L  NLQ YW  
Sbjct: 917  EDLVNVTQSLRRAFDPYSTDYLSEDG------PSKDPAELDRPDRIFLELCYNLQYYWYE 970

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            R   L  +TTYE+DY D I +L+ +D  +  ++     +++  +I+ +GNYMN   + A+
Sbjct: 971  RSFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAE 1028

Query: 1639 GFKLSTLQRLTFIKD--EKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQL 1696
            G KLS+L +L F+K   +KN+ +FL+++E+I+R  YP    F  +L  V  + KIS++ L
Sbjct: 1029 GIKLSSLNKLAFVKSSVDKNT-SFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHL 1087

Query: 1697 ANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLS 1756
              +C EF S +  V  +L+ G LSD S+ HP D ++ K+   +  A+ +++LL D+ +L 
Sbjct: 1088 EQECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLI 1147

Query: 1757 LMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIE 1816
             ++ + LM  FGED +D  AKNSFFQ F +F + +K+  + N + E+ +R YE+RK M+E
Sbjct: 1148 NIDLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLE 1207

Query: 1817 EQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARK 1876
             +Q+ A  +                      G+D D +D LL KL+    ++  P   R+
Sbjct: 1208 SRQRTASNH-----------------NSDLQGEDEDAVDVLLAKLRG---TEEKPGLVRR 1247

Query: 1877 RALAR 1881
            R + R
Sbjct: 1248 RKITR 1252

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  318 bits (816), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 160/419 (38%), Positives = 259/419 (61%), Gaps = 15/419 (3%)

Query: 1405 RPKKRLKQLHWEKIDDLDNSIWE-NARAEKFADDLYERGVLTELEKAF-----AAREIKS 1458
            +PK+ LKQ+HWEKIDD++ ++WE N + E+   +L   G+  +++  F       +++K+
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1459 LISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518
              S KK     +FLSRD++QQFGINLHMYS   V++ V K+L+CD D L   S +EF + 
Sbjct: 908  DNSTKKTTQLKSFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFNN 967

Query: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578
             E+  +  +++R FAPY+ D++      E K P  DPNEL+R D+++L+L  NL+SYW  
Sbjct: 968  EELTNIPASLSRSFAPYSADFQ------ENKSPTVDPNELERPDRIFLELCYNLRSYWRE 1021

Query: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638
            R + L +  TYE+DY DL+ KL+++D A+  I+ +  L+ +  +I+ +GNYMN   K   
Sbjct: 1022 RSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNVS 1079

Query: 1639 GFKLSTLQRLTFIKDE-KNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLA 1697
            G +L++L +L+F+K    N+++FL+++EK+VR  YP    F  +L     +  IS + + 
Sbjct: 1080 GIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHIQ 1139

Query: 1698 NDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSL 1757
            ++C E+CS V +V R    G LS  S  HP D ++ KV   +  A+ ++ LL D+ +L  
Sbjct: 1140 SECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLIS 1199

Query: 1758 MEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIE 1816
             + + LM+ FGE+  DK AKNSFF  F +F + +K+  + N + EE  R YE+RK +++
Sbjct: 1200 ADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLLD 1258

 Score = 38.1 bits (87), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 89/219 (40%), Gaps = 35/219 (15%)

Query: 502 YKNGENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALE 561
           + N E   +++   ++ LIN +  +  D  ++  L  RLK  G+ R    M+      L+
Sbjct: 379 FTNTEQLRIDFASTTLFLINSILQALTDKQRKLQLVKRLKENGIHRCFYLMK----DNLK 434

Query: 562 NEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFW--------TRHKGTESEAHL 613
           NE+       +D+   +  ++         D  SL + F+           K T  E   
Sbjct: 435 NEI-------IDEQIEIYINTEHVLIAQFADKPSLADLFYGNALESIVANTKNTSLEQPF 487

Query: 614 LSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTF--------SSIDTESGFNGA 665
            +L+Q        + SE       S+ +K+L AL+    F           D ES F  +
Sbjct: 488 GTLIQ--------SISEMLKSKTTSESVKVLKALIIMFQFLESNLYNNMEFDPESVFQDS 539

Query: 666 IQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQ 704
           I  L D +++DE+A+RA+ E   L      ++ E+  L+
Sbjct: 540 INTLVDNLESDEIAKRAMGEINFLQDAVRSLQEEKGQLE 578

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  310 bits (794), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 164/431 (38%), Positives = 262/431 (60%), Gaps = 13/431 (3%)

Query: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIW-ENARAEKFADDLYERGVLTELEKAFA---ARE 1455
             E+  +  +RLKQ+HW+KI+D+  +IW E       A  L E G+L E+   F    +  
Sbjct: 911  MERKEQDSQRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAP 970

Query: 1456 IKSLISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEF 1515
             K+   R  +E  +  L RD++QQFGINLHM+S+L+V+  V K+L CD+  +  QS +EF
Sbjct: 971  TKANTGRLNEEGPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEF 1030

Query: 1516 LSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSY 1575
             ++ ++V +  +++  F PY++D+         K P KD ++L+RAD+++L L  NL+SY
Sbjct: 1031 FARDDLVNIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRSY 1084

Query: 1576 WNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSK 1635
            W  R   L  + TYEKDY D++ KL+ +D A+  I+ S  L++   +I+ +GNYMN   K
Sbjct: 1085 WRQRSICLLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RK 1142

Query: 1636 QAQGFKLSTLQRLTFIKDEKN-SMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIE 1694
            QA G KLS+LQ+L F+K  K+ +++FL+ VE+ +R        F+ EL  VL +  + + 
Sbjct: 1143 QAPGIKLSSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVG 1202

Query: 1695 QLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQ 1754
            Q+  D  E+   +  V++SL+ G LSDS  FHP DR+L KV P +  A ++A LL ++ +
Sbjct: 1203 QVEQDFQEYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFK 1262

Query: 1755 LSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIM 1814
            L++   E+LMRL+GED      +N FF  F  FI+++K+A + N + EE ER Y  RK +
Sbjct: 1263 LTMRALENLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKEL 1322

Query: 1815 IEEQQKRARKN 1825
            ++++ K + KN
Sbjct: 1323 LQQKTKASSKN 1333

 Score = 42.0 bits (97), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 85/200 (42%), Gaps = 25/200 (12%)

Query: 511 EYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDR 570
           +Y L S+ LIN +      + ++     RLK   + R+ + M  L++  ++ E+      
Sbjct: 348 DYCLTSLFLINSILQITSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEIDGEI------ 401

Query: 571 TLDDYNSLMASSTVDSSVDMKDPESL---WNNFWTRHKGTESEAHLLSLMQHLFLWSSKA 627
             D Y SL     V    + + P+ L   +  F T       +  L   M  LF   SK 
Sbjct: 402 --DKYKSL--EEEVIQKTNPEFPQLLNVSYGKFLTNIIHQTHQNPLEHCMHQLFETLSKT 457

Query: 628 FSESTDPAEGSKQLKLLDALVSNVTF--------SSIDTESGFNGAIQRLYDAMQTDEVA 679
               T     S  LK+L    S + +         +I+ +S  N ++  L D +Q+DE+A
Sbjct: 458 LVART----MSDNLKVLTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEIA 513

Query: 680 RRAILESRELTKKCEEMKAE 699
           +RA+ E     K+ E +++E
Sbjct: 514 KRAMSELELAQKEIENLESE 533

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  311 bits (796), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 157/426 (36%), Positives = 265/426 (62%), Gaps = 16/426 (3%)

Query: 1404 PRPK--KRLKQLHWEKIDDLDNSIWE-NARAEKFADDLYERGVLTELEKAFAAREI---K 1457
            P+P+  K LKQ+HW+K++++DN+IW+ N    +   +L    +  ++E +F  +E+   K
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1458 SLISRKKDENKV-TFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFL 1516
            S   + K+++ + +FLSRD++QQFGINLHMYS+ T  + +  +L C  + +   S +EF 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1517 SKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYW 1576
             K +++ +  +++R +APY+ D+         ++P KD +EL+RAD+L+L+L  NL+ YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1577 NSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQ 1636
              R + L L+ TYE+DY DL+ KL+ +D A+  +  S+  R+   ++L +GNYMN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1637 AQGFKLSTLQRLTFIKDE-KNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQ 1695
             +G K+S+L +L FIK    N+++FL+++EK++RT YP    F+ +L  V  + K+++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1696 LANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQL 1755
            +  +C EFC+ V +V  S+  G LS S K HPND +L KV   +  A+ ++ LL D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1756 SLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMI 1815
            +  +   L+  +GED  DK + +SFF    +F+  +K+  + N + EE ER YE+RK M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1816 EEQQKR 1821
            E Q K+
Sbjct: 1405 ESQSKK 1410

 Score = 39.3 bits (90), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 89/198 (44%), Gaps = 9/198 (4%)

Query: 511 EYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDR 570
           EYL   + LIN +    P+  ++  L   LK +G+  +   ++ L    ++ ++S +   
Sbjct: 357 EYLTTCLFLINSILQVVPNFERKYKLIENLKEFGIHHIFHLLKDLASTVIKEQISIYSKI 416

Query: 571 TLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESE---AHLLSLMQHLFLWSSKA 627
             D   S+  ++++   V   +   L     ++ + T  E     LL+ +  +    +++
Sbjct: 417 EQDIILSISNNNSMFIDVSYGNEIQL---LLSQSQKTPLEQPIGELLNFLNKILTSRTQS 473

Query: 628 FSESTDPAEGSKQLKLLDALVS-NVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILES 686
            S     + GS    LLD     N T   +  ES    +I  L D +Q+DE+ARRA+ E 
Sbjct: 474 ESMKLFKSFGSTLGYLLDHFYKDNDTL--LSPESTVQNSINELMDRLQSDEIARRAMNEM 531

Query: 687 RELTKKCEEMKAERDHLQ 704
           + L +  + +++E   L+
Sbjct: 532 KSLEQIIDNLQSEISSLK 549

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  306 bits (785), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 160/417 (38%), Positives = 258/417 (61%), Gaps = 24/417 (5%)

Query: 1409 RLKQLHWEKIDDLDNSIWENARAEKFADD--LYERGVLTELEKAF---------AAREIK 1457
            +LKQ+HW+KID++  ++W N   E+ +    L   GV  E+E  F         A+    
Sbjct: 771  KLKQIHWDKIDNIKETVW-NEHNERISTSTKLETFGVFKEIEDLFKVVPATPKTASSNSP 829

Query: 1458 SLISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLS 1517
            +  +R     K+  LS D++Q FGINLH++S  + ++++  +L C  + L  Q  IEF S
Sbjct: 830  TQTTRN---GKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIEFFS 886

Query: 1518 KHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWN 1577
            K +I  +  +  R FAPY T++         K P+KDP  L+RAD++YL+L  NL+SYW 
Sbjct: 887  KDDINHIPQSTQRMFAPYETNYLT------GKTPDKDPAVLERADRIYLELFYNLRSYWA 940

Query: 1578 SRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQA 1637
            +R + L ++ TYE+DY D++ KL+ +D A  AI+ S+ L+ +F +I+ +GNYMN+  KQA
Sbjct: 941  ARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN--KQA 998

Query: 1638 QGFKLSTLQRLTFIKDEK-NSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQL 1696
             G +LS++ +L F K  K N+++F++ +E+I+RT YP    F ++LE V  +  I ++ +
Sbjct: 999  LGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIVQHV 1058

Query: 1697 ANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLS 1756
              +  EF   ++N+ERSL +G LSDSS+FHP D+ L+K    +  ARK+A LL D+  L+
Sbjct: 1059 QQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQSTLT 1118

Query: 1757 LMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKI 1813
            + +FE L+  +GED+ D  ++N+FFQKF DF+  +K+A + N + EE  R+  +R I
Sbjct: 1119 MGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIEREEIRRSQVKRVI 1175

 Score = 37.7 bits (86), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 88/213 (41%), Gaps = 25/213 (11%)

Query: 506 ENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKM----ELLKYPALE 561
           +  +++Y + +M LIN +         +  +   L   G+  + + +    + L    L 
Sbjct: 308 QQLIIDYCVSTMFLINSIVQGQATYSDKRKILVLLNDAGIHTIFRIILRSGDRLSSEILL 367

Query: 562 NEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTE---SEAHLL-SLM 617
           ++VSK+  R  +  +       ++     K  E+      +  +GTE   S A L+ S+M
Sbjct: 368 DQVSKYRSREAEINSKCATEGQIEPE---KTFETQIKTIISLTQGTELGCSMAQLVDSVM 424

Query: 618 QHLFLWSSKAFSESTDPAEGSKQLKLL----DALVSNVTFSSI-DTESGFNGAIQRLYDA 672
           Q +   +S         AE  K L LL    D L+ N     +   E     +I RL D 
Sbjct: 425 QIITFRTS---------AEALKLLNLLQATFDHLLENYHKEQMPSVEEALRSSISRLMDD 475

Query: 673 MQTDEVARRAILESRELTKKCEEMKAERDHLQT 705
           +Q  +V RRA+ E  E+ +K  EMK     L T
Sbjct: 476 LQAQQVNRRAVQEMEEMKQKMIEMKETMRRLGT 508

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  301 bits (771), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 159/484 (32%), Positives = 284/484 (58%), Gaps = 37/484 (7%)

Query: 1400 FEKYPRPK-KRLKQLHWEKIDDLDNSIW-ENARAEKFADDLYERGVLTELEKAFAAREI- 1456
            F   P+P+ K LKQ+HW+KI+D+ +++W E        +DL E+GV  E+   F  + + 
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVR 851

Query: 1457 ---KSLISRKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAI 1513
               KS ++  K   KV+ LSRD++QQFGINLHM+SS +V+ ++ K+L+CD D +   S +
Sbjct: 852  MKKKSNVTASKKNEKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSVL 911

Query: 1514 EFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQ 1573
            EF +K +   +  ++ R F PY +DW+        K P++D ++L+RAD++YL++  N++
Sbjct: 912  EFFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFYNMR 965

Query: 1574 SYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDS 1633
             YW  R  +L +  TYEKDY D++ +L+ +D     I+ S  L+  F +++ +GN+MN+ 
Sbjct: 966  YYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN- 1024

Query: 1634 SKQAQGFKLSTLQRLTFIK-DEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKIS 1692
             K+ QG KLS+L +L+ +K +   +++FL+ +E+I+R  YP    F ++L  +  + KI+
Sbjct: 1025 -KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKIN 1083

Query: 1693 IEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADE 1752
            IE + ++  E+   +  ++ S E G LS + K HP+D+   K+   LP A ++A LL ++
Sbjct: 1084 IESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHNQ 1143

Query: 1753 VQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRK 1812
             +L++ +F S M+  GED  +  AKN+FF+ F++F+  + +  + NK+ E   R +E+R+
Sbjct: 1144 CKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQRQ 1203

Query: 1813 IMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDR--DVMDRLLEKLKNAGPSKAD 1870
             +++    +A    Q++                   DD   D +D L++KL++  P +  
Sbjct: 1204 QLLQ----KASTETQVE----------------KSADDEAADTIDILIKKLRSVDPQQTI 1243

Query: 1871 PSSA 1874
            P S+
Sbjct: 1244 PGSS 1247

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  298 bits (763), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 157/417 (37%), Positives = 259/417 (62%), Gaps = 13/417 (3%)

Query: 1409 RLKQLHWEKIDDLDNSIW-ENARAEKFADDLYERGVLTELEKAFAARE---IKSLISRKK 1464
            +LKQ+HW+K++D+  +IW +    +  A  L   G L E+ + F   +   IK+      
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELFRVNQSLPIKAKSETSS 979

Query: 1465 DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKHEIVEV 1524
             ++KV+ L RD++QQFGINLHM+S+L+VD+ V K+L CD+D +N QS +EF ++ ++  +
Sbjct: 980  GKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLSII 1039

Query: 1525 SINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSRMRALK 1584
              ++A    PY TD +        + P  D  +L+RAD+++L+L  NL+SYW  R   L 
Sbjct: 1040 PRSIASKLEPYATDHQ------PNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLCLL 1093

Query: 1585 LITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQGFKLST 1644
             ++TYEKDY DLI KL+ +D A+  I+ S  L++   +I+ +GNYMN   KQA G +LS+
Sbjct: 1094 TLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRLSS 1151

Query: 1645 LQRLTFIKDEKN-SMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLANDCGEF 1703
            LQ+LTF+K  K+ +M+ L+ VE+ +R        F+++L  VL +  + + Q+  D  E+
Sbjct: 1152 LQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFHEY 1211

Query: 1704 CSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLMEFESL 1763
               ++ V++SLE G LS    FHP DR+L KV P +  A ++A+LL ++  L++   E+L
Sbjct: 1212 TQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALENL 1271

Query: 1764 MRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQK 1820
            M+L+GED  +  +KN FFQ F +F+ ++K+  + N++ E  ER Y +RK +++ + K
Sbjct: 1272 MKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSK 1328

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  295 bits (756), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/423 (35%), Positives = 252/423 (59%), Gaps = 11/423 (2%)

Query: 1405 RPKKRLKQLHWEKIDDLDNSIWENARAEK-FADDLYERGVLTELEKAFAAREIKSLISRK 1463
            +P K+LKQ+HW+K++D++++IW N    +     L   GVL E+E  F  +E   +  + 
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1464 ------KDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLS 1517
                    +  V+FLSRD++Q FGINLHM+S+L+VD+ V K+L CD D +     +EF +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1518 KHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWN 1577
            + E+  +S +  R +APY   +            E  P  L+R D+++L L   L+ YW+
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLP-PLERGDEIFLKLCYVLRDYWS 1045

Query: 1578 SRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQA 1637
             R   L ++ TYEKDY D++ KL+ L+ A+  +++S  L+N   +I+ +GNYMN  +K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1638 QGFKLSTLQRLTFIKDEKN-SMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQL 1696
             G K+S+L +L FIK   N +++FL+Y+E+++RT YP    F+ +L+ V  + K++++QL
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQL 1163

Query: 1697 ANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLS 1756
              +C E+   +  +  +++ G LSD +K +P D VL K+      A  +A LL  +++LS
Sbjct: 1164 ELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLS 1223

Query: 1757 LMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIE 1816
              +   LM+ +GED  D   KN FF  FA+F+  +K+    N + EE +R YE+R+ ++E
Sbjct: 1224 SNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLE 1283

Query: 1817 EQQ 1819
            ++Q
Sbjct: 1284 DKQ 1286

 Score = 33.9 bits (76), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 92/207 (44%), Gaps = 30/207 (14%)

Query: 509 VLEYLLYSMILINLLCSSHPDLHQR-NLLRSRLKSYGLSRVIKKMELLKYPALENEVSKF 567
           V ++L   + L+N +  +   L+ + N+L+S LK  G+      ++ +  P + N+V  +
Sbjct: 322 VYDHLSTCLCLLNSILEASVALNVKYNILKS-LKDAGIHNFFYSLDAIDSPLVFNQVKIY 380

Query: 568 EDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLF-LWSSK 626
           +++       + A+       ++    +L      +  GT  E  +  L Q L  +  ++
Sbjct: 381 KEKEEQALTKINATKNGPFLPNLVYGTTLML-LIEKSTGTPLEVSMGQLFQCLLDILENR 439

Query: 627 AFSESTDPAEGSKQLKLLDALV--------------SNVTFSSIDTES---GFNGAIQRL 669
           A+SES         L+L +A++               N T   I  +S    FN + + L
Sbjct: 440 AYSES---------LRLFNAIIVLLTFFINKFTDSTRNATLPRITDDSLKPMFNESFENL 490

Query: 670 YDAMQTDEVARRAILESRELTKKCEEM 696
            D++Q+DEVA RA+ +  E  KK  ++
Sbjct: 491 MDSLQSDEVAARAMDQLEESEKKVSQL 517

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  292 bits (748), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 149/425 (35%), Positives = 261/425 (61%), Gaps = 13/425 (3%)

Query: 1407 KKRLKQLHWEKIDDLDNSIWENARAEK-FADDLYERGVLTELEKAFAAREI----KSLIS 1461
            KK+LKQ+HW+KI+++ N++W++A   +    +L   G+  +++  F+ +++    K  ++
Sbjct: 856  KKKLKQIHWDKIENVKNTLWDHADGRQDTILELEHAGIFEKVQGMFSVQDLVVKPKRAVN 915

Query: 1462 RKKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKHEI 1521
             ++    ++FLSRD SQQ  INLH+++ LT  +++ K+L CD D +   S +EF  K E+
Sbjct: 916  VRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKDEM 975

Query: 1522 VEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSRMR 1581
            V +     R F PY+ D+   S     +QP K+P+EL+RAD+L+L L  NL+ YW  R +
Sbjct: 976  VNIGSARIRHFTPYSADYLNAS-----EQPAKNPDELERADKLFLYLPFNLRRYWAERSQ 1030

Query: 1582 ALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQGFK 1641
             L +I+TYE++Y D++  L+ +D A+  I+ SE  +    +I+ +GNYMN  +K  +G +
Sbjct: 1031 CLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEGIR 1088

Query: 1642 LSTLQRLTFIKDEKN-SMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLANDC 1700
            L++L +L FIK   N + +FL++VEK++R +YP    F+ +L  V  + KI+I+Q+   C
Sbjct: 1089 LNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQLQC 1148

Query: 1701 GEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLMEF 1760
             E+C+ +  +  S+  G LSD ++ HP+D++L KV   +  A+ ++ LL  + +L+  +F
Sbjct: 1149 EEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNNDF 1208

Query: 1761 ESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQK 1820
               M  +GED DD   K +FF +F +F   +++    N + EE +RAYE+RK + E + K
Sbjct: 1209 RKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIAELRNK 1268

Query: 1821 RARKN 1825
            +  +N
Sbjct: 1269 KNERN 1273

 Score = 42.0 bits (97), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 93/203 (45%), Gaps = 15/203 (7%)

Query: 509 VLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFE 568
           + +Y   ++ LIN L    P +  +  +   ++   L ++I   E L   +++ ++ + +
Sbjct: 343 LCDYFCSNLFLINSLIQGFPTIPLKATILEEMRKCDLHQIIYLSEKLDSTSIQEQIKEIK 402

Query: 569 DRTLDDYNSLMASSTVDSSVDMKDPESLWNN----FWTRHKGTESEAHLLSLMQHLF-LW 623
            +    Y+    S+       M  PE  +        T+ K T  E  L  L+  L    
Sbjct: 403 TQEETIYSRGYGSN------HMNLPEVSYAPDIELLITKSKDTPVEDSLGKLLATLSKAL 456

Query: 624 SSKAFSESTDPAEGSKQL--KLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARR 681
           +SK +SE+    + +  L   L+D   +N    S+ +E+ F  A+ +L D++ ++E+ +R
Sbjct: 457 NSKTYSETIKIYKSTNSLVTYLMDNFQNNQ--KSVASETLFQEAVTKLMDSLHSNEITKR 514

Query: 682 AILESRELTKKCEEMKAERDHLQ 704
           A+ E +EL K  + +  E D L+
Sbjct: 515 AMSELKELEKTVQSLNEEIDRLR 537

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  291 bits (744), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 162/493 (32%), Positives = 280/493 (56%), Gaps = 48/493 (9%)

Query: 1404 PRP-KKRLKQLHWEKIDDLDNSIWENA-RAEKFADDLYERGVLTELEKAFAAREIKSLIS 1461
            P P +KRLKQ+HW+K++D+ +++WE+  + ++    L   G+ +++E  F  +    + +
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1462 RK-------------KDEN---KVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKD 1505
            +              K  N   K++FLSRD++QQFGINLHM+S L+  + V K+LKCD D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1506 FLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLY 1565
             +   + ++F  K E+V +  ++   + PY+    G           K  ++LQRAD+++
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIF 1038

Query: 1566 LDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILA 1625
            L+L +NL+ YWN R ++L  ++TYE+DY DLI KL+++D  +  + +S+  +N+  +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1626 VGNYMNDSSKQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVEKIVRTNYPGFDVFLQELEP 1684
            +GN+MN   +  +G KL +L +L F++   + +M+FL+++EKI+R  YP    F+ +L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1685 VLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARK 1744
            V  + KIS+E +  +C EF + + N+    + G LS+     P D+++ KV   +  AR 
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1745 RANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEE 1804
            ++ LL D+ +L+L++   LMR +GED +DK +KN FFQ F +F+  +K+  + N + EE 
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEM 1276

Query: 1805 ERAYERRKIMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNA 1864
            ER YE+RK ++E    R   N + D                    + D +D L+ KL+  
Sbjct: 1277 ERVYEQRKNLLE---MRTNGNKKCDGNDENEGEEV----------NTDAVDLLISKLREV 1323

Query: 1865 GPSKADPSSARKR 1877
               K DP   R+R
Sbjct: 1324 ---KKDPEPLRRR 1333

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 21/124 (16%)

Query: 595 SLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFS 654
           SLW    ++   +ES   LL LM  L  +   +F   T+P+         D  +     S
Sbjct: 454 SLWKILDSQRPYSES-IKLLKLMNSLLFYLIDSFQVPTNPS--------FDENIE----S 500

Query: 655 SIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEM--------KAERDHLQTK 706
           + + +S F  ++ +L D++Q+DE+ARRA+ E  +L KK   +           +DHL  K
Sbjct: 501 AENADSVFQDSVNKLLDSLQSDEIARRAVTEIDDLNKKISHLNEKLDLVENCSKDHLIKK 560

Query: 707 LAQA 710
           L ++
Sbjct: 561 LDES 564

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  288 bits (736), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 159/496 (32%), Positives = 276/496 (55%), Gaps = 47/496 (9%)

Query: 1404 PRPKKRLKQLHWEKIDDLDNSIWENA-RAEKFADDLYERGVLTELEKAFAAREIKSLISR 1462
            P P++RLKQ+HW++++D+ +++WE+A + ++   +L   GV +++E  F  R    + S+
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1463 KK----------------DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDF 1506
                              +  KV+FLSRD++QQFGINLHM+S L+  + V K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1507 LNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYL 1566
            +   + ++F  K E+  +  ++   + PY+   EG           K  ++LQRAD+++L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1567 DLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAV 1626
            +L +NL+SYWN R + L  ++TYE+DY DL+ KL+ +D  +  +  S   +N+  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1627 GNYMNDSSKQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVEKIVRTNYPGFDVFLQELEPV 1685
            GN+MN   K  +G KL +L +L F++   + +M+FL+++EKI+R  YP    F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1686 LQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKR 1745
              + KIS+E +  +C EF + + N+    + G LS      P D+++ KV   +  A+ +
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1746 ANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEE 1805
            + LL  + +L+L++   LM+ +GED  DK +KN FFQ F +F+  +K+  + N + EE E
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1806 RAYERRKIMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAG 1865
            R YE+RK ++E +    +K+   D                    + D +D L+ KL+   
Sbjct: 1278 RVYEQRKSLLEMRTNNNKKSNGNDENEGEEV-------------NTDAVDLLISKLREV- 1323

Query: 1866 PSKADPSSARKRALAR 1881
              K DP   R+R   R
Sbjct: 1324 --KKDPEPLRRRKSTR 1337

 Score = 37.4 bits (85), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 96/229 (41%), Gaps = 59/229 (25%)

Query: 535 LLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMA-----------SST 583
           L+ S L+ +     +K    LK   +   ++  E    DD N+++            SS 
Sbjct: 343 LINSILQGFNNKTALKIFSFLKKSNIHGIMATLESSYKDDSNNIVIMEQIKQFKTKESSI 402

Query: 584 VDSSV----DMKD-------------PESLWNNFWTRHKGTESEAHLLSLMQHLF--LWS 624
            DS +    DMK              P  + N    + K +  E  +  ++Q L+  L S
Sbjct: 403 FDSMIQTSRDMKATPSMKNVTEEEGAPVCIENCLLLKVKDSPIETPINEIIQSLWKILDS 462

Query: 625 SKAFSESTDPAEGSKQLKLLDALVSNVT-------FSSID--------TESGFNGAIQRL 669
            K +SES       K LKL+++L+  +         SS D         +S F  ++ +L
Sbjct: 463 KKPYSESI------KLLKLINSLLFYLIDSFQAPICSSFDENLDLAQNVDSVFQDSVNKL 516

Query: 670 YDAMQTDEVARRAILESRELTKKCEEMKAE--------RDHLQTKLAQA 710
            D++Q++E+ARRA+ E  +L  K  ++  +        +DHL  KL ++
Sbjct: 517 LDSLQSNEIARRAVTEIDDLNNKILDLNEKLNLVENYSKDHLIAKLDES 565

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  286 bits (731), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/494 (30%), Positives = 282/494 (57%), Gaps = 47/494 (9%)

Query: 1402 KYPRPKKRLKQLHWEKIDDLDNSIWENA-RAEKFADDLYERGVLTELEKAFAAREIKSLI 1460
            K P  +KRLKQ+HW+K++D+ +++WE+  + ++   +L   G+ +++E  F  +    + 
Sbjct: 870  KPPPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIA 929

Query: 1461 SRKKDEN----------------KVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDK 1504
            +++  E+                K++FLSRD++QQFGINLHM+S L+  + V K+L CD 
Sbjct: 930  NKRNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDN 989

Query: 1505 DFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQL 1564
            D +   + ++F  K E+V +  +M   + PY+   +G           K  ++LQRAD++
Sbjct: 990  DIVQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRI 1038

Query: 1565 YLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVIL 1624
            +L+L +NL+ YWN+R ++L  ++TYE+DY DLI KL+ +D A+  + +S   +++  +I 
Sbjct: 1039 FLELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIIT 1098

Query: 1625 AVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVEKIVRTNYPGFDVFLQELE 1683
             +GN+MN   +  +G KL +L +L F++   + +++FL+++EK++R  YP    F+ +L+
Sbjct: 1099 EIGNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLK 1156

Query: 1684 PVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEAR 1743
             +  + KIS+E + ++C EF   + ++    ++G LS      P D+++ KV   +  A+
Sbjct: 1157 NIEDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAK 1216

Query: 1744 KRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEE 1803
             ++ LL  + +L+L++   LM+ +GED  DK +KN FFQ F +F+  +K+  + N + EE
Sbjct: 1217 TKSELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEE 1276

Query: 1804 EERAYERRKIMIEEQQKRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKN 1863
             ER YE+RK +++ +    +K+   D                    +RD +D L+ KL+ 
Sbjct: 1277 MERVYEQRKSLLDMRTSSNKKSNGSDENDGEKV-------------NRDAVDLLISKLRE 1323

Query: 1864 AGPSKADPSSARKR 1877
                K DP   R+R
Sbjct: 1324 V---KKDPEPLRRR 1334

 Score = 44.3 bits (103), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 81/166 (48%), Gaps = 33/166 (19%)

Query: 570 RTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLF--LWSSKA 627
           +T +D NSL    T D +    +P  L N    + K +  EA +  ++Q L+  L S K 
Sbjct: 407 KTTNDTNSL--HPTKDIARIESEPLCLENCLLLKAKDSPVEAPINEIIQSLWKILDSQKP 464

Query: 628 FSESTDPAEGSKQLKLLDALV----------SNVTF-----SSIDTESGFNGAIQRLYDA 672
           +SES       K LKL+++L+          +N +F     S+ + +  F  ++ +L D+
Sbjct: 465 YSESI------KLLKLINSLLFYLIDSFQVSTNPSFDETLESAENVDYVFQDSVNKLLDS 518

Query: 673 MQTDEVARRAILESRELTKKCEEMKA--------ERDHLQTKLAQA 710
           +Q+DE+ARRA+ E  +L  K   +          ++DHL  KL ++
Sbjct: 519 LQSDEIARRAVTEIDDLNAKISHLNEKLNLVENHDKDHLIAKLDES 564

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  282 bits (722), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 145/416 (34%), Positives = 243/416 (58%), Gaps = 26/416 (6%)

Query: 1409 RLKQLHWEKIDDLDNSIW-ENARAEKFADDLYERGVLTELEKAFAAREIKSLISRKKDEN 1467
            RLKQ+HWEK++D+++++W ++AR E+ A +L   G+  ++   F  + IK    +K+D  
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKM---KKRDTT 908

Query: 1468 KV------TFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKHEI 1521
                    T L R+++QQFGINLHM+SSL  D+ V K+L+C+ D ++  S +EF +K E+
Sbjct: 909  TASKKQNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEEL 968

Query: 1522 VEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSRMR 1581
              +  ++ + F PY  +              K   EL+RAD+++ +L   L SYW  R  
Sbjct: 969  TSIPTSLIQKFTPYAENI-------------KSKFELERADRIFFELCFQLHSYWRERSN 1015

Query: 1582 ALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQGFK 1641
             L ++ TYEKDY DL+ KL+ +D  +  +  S   R+   +I+ +GNYMN   K   G +
Sbjct: 1016 CLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGIR 1073

Query: 1642 LSTLQRLTFIKDE-KNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLANDC 1700
            + +L +L F+K    N+++FL+++EKI+R  YP    F+ EL  +  + K+SI+QL  D 
Sbjct: 1074 IGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYDS 1133

Query: 1701 GEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLMEF 1760
             EFCS +  +   LE G LS + +  P D++L K    +  A+ ++ L+  +++L   ++
Sbjct: 1134 QEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHDY 1193

Query: 1761 ESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIE 1816
              +MR FGED+ D+ +KN+FF    +FI  +K+  + N + EE ER YE+R+ M +
Sbjct: 1194 AKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFD 1249

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  282 bits (721), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 147/429 (34%), Positives = 258/429 (60%), Gaps = 31/429 (7%)

Query: 1408 KRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELE------KAFAAREIKSLIS 1461
            K+LKQ+HW +++++  +IW+        D+  +RG+  ELE      +  ++ ++K +I 
Sbjct: 1141 KKLKQIHWIRVNEVAETIWK--------DNDRDRGIFMELECVGVFDRVKSSFKLKDVIK 1192

Query: 1462 RKK-DENKV-------TFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAI 1513
            +K  DE K        +FLSRD++QQFGINLH+++S  V +++ K+L+CD D     + +
Sbjct: 1193 KKNTDEAKTKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITIL 1252

Query: 1514 EFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQ 1573
            EF +K E   +S ++AR +APY  D++         +  KD +EL+RAD+++L+L  NL+
Sbjct: 1253 EFFNKEEFTHISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLR 1306

Query: 1574 SYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDS 1633
            +YW  R + L L+ TYEKDY DL+ KL+ +D AV  +  S   +    ++L +GN+MN  
Sbjct: 1307 AYWAERSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN-- 1364

Query: 1634 SKQAQGFKLSTLQRLTFIKD-EKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKIS 1692
             K A+G  +S+L +L FIK  E N+++FL+++EK +RT +P    F+ +L  V ++  +S
Sbjct: 1365 KKPAEGILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVS 1424

Query: 1693 IEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADE 1752
            ++ +  +C EFC+ V     ++  G LS     HP D++L KV   + +A+ ++N L D+
Sbjct: 1425 LDHITMECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQ 1484

Query: 1753 VQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRK 1812
              L+      +++ +GED +D+ +K+ FF+  A+F   +K+  + N   EE ER YE+RK
Sbjct: 1485 QILTNHSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRK 1544

Query: 1813 IMIEEQQKR 1821
             M++ + ++
Sbjct: 1545 YMLDNKLQK 1553

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  279 bits (714), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 141/432 (32%), Positives = 261/432 (60%), Gaps = 27/432 (6%)

Query: 1407 KKRLKQLHWEKIDDLDNSIWENA-RAEKFADDLYERGVLTELEKAFAAREIKSLISRKKD 1465
            K RLKQ+HW+K++++ +++WE+  + ++   +L   G+ +++E  F  ++   + S+K  
Sbjct: 879  KNRLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNG 938

Query: 1466 ------------ENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAI 1513
                         + V+FLSRD++QQFGINLHM+S ++  + V K+L CD + +   + +
Sbjct: 939  NSSTSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNIL 998

Query: 1514 EFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQ 1573
            +F  K E+V +  +M   + PY+    G           K  ++LQRAD+++L+L +NL+
Sbjct: 999  KFFCKEELVSIPKSMLSKYEPYSQGKGG-----------KSVSDLQRADRIFLELCINLR 1047

Query: 1574 SYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDS 1633
            SYWN+R ++L  ++TYE+DY DLI KL+ +D  +  + +S   +++  +I  +GN+MN  
Sbjct: 1048 SYWNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN-- 1105

Query: 1634 SKQAQGFKLSTLQRLTFIKDEKN-SMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKIS 1692
             K  +G KL +L +L F++   + +++FL+++EK++RT YP    F+ +L+ +  + K+S
Sbjct: 1106 KKMVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVS 1165

Query: 1693 IEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADE 1752
            +E +  +C EF + V       + G LS+     P D+++ KV   +  A+ +++LL D+
Sbjct: 1166 LEHVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQ 1225

Query: 1753 VQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRK 1812
             +L+L++   LM+ +GED +DK +KN FFQ F +F+  +K+  + N + EE ER YE+RK
Sbjct: 1226 CKLTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRK 1285

Query: 1813 IMIEEQQKRARK 1824
             ++E +    +K
Sbjct: 1286 NLLEMRTNNNKK 1297

 Score = 35.8 bits (81), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 8/62 (12%)

Query: 657 DTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAE--------RDHLQTKLA 708
           + +S F  +I +L D++Q+D++ARRA++E  +L  K   +           +D L TKL 
Sbjct: 508 NVDSVFQDSIDKLLDSLQSDDIARRAVIEIDDLNCKISTLNERISLVENYSKDQLLTKLD 567

Query: 709 QA 710
           ++
Sbjct: 568 ES 569

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  280 bits (715), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 162/485 (33%), Positives = 273/485 (56%), Gaps = 34/485 (7%)

Query: 1406 PKKRLKQLHWEKIDDLDNSIWENARAE-KFADDLYERGVLTELEKAFAARE--IKSLISR 1462
            P K +KQ+HWEK+     S+WE+         +L   G+ +E+E  F +++  IK    +
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1463 KKDENKV-TFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSKHEI 1521
             + +NKV T L R+++QQFGINLHM+S ++   +  K+L+CD       S IEF +  ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1522 VEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNSRMR 1581
              +  N+ R F PY+ D++   S     +P KD +EL R D ++L L  NL+SYW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKTPGS-----KPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1582 ALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQGFK 1641
             L ++ TYEKDY DL+ KL  LD+A+ AI+ S+ L++V  +I+A+GN+MN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1642 LSTLQRLTFIKDEKNS-MTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLANDC 1700
            LS+L +LT+IK    S  +FL+++E+++R  YP    F  +L  V  +  ++++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1701 GEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKV-LPVLPEARKRANLLADEVQLSLME 1759
             +  S +  V RS++ G LS+    HP D +L KV   V+  A KR  +L D+  L+ ++
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRT-ILQDKFTLTNID 1317

Query: 1760 FESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQQ 1819
             E L+  FGED DD   K +FF+  ++F+  +++  + N + EE +R YE+R+ +++   
Sbjct: 1318 LEKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLD--- 1374

Query: 1820 KRARKNIQIDTXXXXXXXXXXXXXXXXXGDDRDVMDRLLEKLKNAGPSKADPSSARKRAL 1879
              ++   Q D+                  D +D +D+LL+KL+        P++A +R  
Sbjct: 1375 --SKIQAQWDSSMDEIEE-----------DQQDAVDQLLKKLRGV----EQPTTAVRRRK 1417

Query: 1880 ARKKL 1884
            + K+L
Sbjct: 1418 SSKRL 1422

>SAKL0A03190g Chr1 complement(290009..294670) [4662 bp, 1553 aa] {ON}
            similar to uniprot|Q12280 Saccharomyces cerevisiae
            YPL242C IQG1 Essential protein required for determination
            of budding pattern promotes localization of axial markers
            Bud4p and Cdc12p
          Length = 1553

 Score = 38.5 bits (88), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 17/132 (12%)

Query: 584  VDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTD----PAEGSK 639
            +++ +D  +  + W     R+  T+   H+++L + +  +     SE  D    PA   K
Sbjct: 943  IENFLDSCEETTAWRQLMHRYLTTQKREHMITLFEPVLKY---VLSEEIDFESVPANIYK 999

Query: 640  QLK-LLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKA 698
            +L  L   L SN+     DT + F G +  L+ A++   +A         LT+  EE+  
Sbjct: 1000 KLHPLAPVLQSNLAIDDSDTSTRFIGNMTALWSAIEKVSIA---------LTENIEEIPV 1050

Query: 699  ERDHLQTKLAQA 710
            E  +L TK  Q 
Sbjct: 1051 EIRYLCTKAYQC 1062

>Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa] {ON}
            YLR106C (REAL)
          Length = 4909

 Score = 34.3 bits (77), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%)

Query: 802  QKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKE 861
            Q   +D   ++ KDL ++   + T PAP R + ++ S MD   K+    E  NFA+   E
Sbjct: 3571 QHIYEDSKLESSKDLVKNISSWSTRPAPLRNIDVVTSNMDSYLKKISSQEFPNFADLASE 3630

Query: 862  TKVE 865
               E
Sbjct: 3631 FYAE 3634

>Skud_4.20 Chr4 complement(31386..33626) [2241 bp, 746 aa] {ON}
           YDL234C (REAL)
          Length = 746

 Score = 33.9 bits (76), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 15/111 (13%)

Query: 522 LLCSSH-PDLHQRNLLRSRLKSYGLSRVIKKMEL--LKYPALENEVSKFEDRTLDDYNSL 578
             C SH  D+ +RN LR +   +   +++  MEL  L  P L   ++K +   L  +   
Sbjct: 552 FWCFSHFMDIMERNFLRDQSGIH--EQMLTLMELVQLMLPELSEHLNKCDSGNLF-FCFR 608

Query: 579 MASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLL---------SLMQHL 620
           M         DM+D   +W NFWT +  ++ +   +         +++QHL
Sbjct: 609 MLLVWFKREFDMEDIMHIWENFWTFYLSSQFQLFFMLAILQKNSQAILQHL 659

>TBLA0D03130 Chr4 complement(758404..760440) [2037 bp, 678 aa] {ON}
            Anc_5.222 YLR002C
          Length = 678

 Score = 33.1 bits (74), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 48/106 (45%), Gaps = 3/106 (2%)

Query: 920  EKKTKALDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSCV 979
            EK +K + +LR  E+   S  I +    +LL++  R  + D+ +  A  + A  + +   
Sbjct: 219  EKVSKEVAKLRHFEQ---SLIIHYKTYLDLLVKFSRVANNDSPIKVAIGNLAVQAANQIA 275

Query: 980  LDPARLDAKIEEMTKILEELNRLKCQVDPTTANSGADISTSISTDD 1025
             + +  + K E +T ++  + +     DPT A +   +   +  DD
Sbjct: 276  FNASHFNFKTEVLTLLIRRIAKPNLSADPTAAQTIKTLENLMVDDD 321

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 191,695,839
Number of extensions: 8037136
Number of successful extensions: 34760
Number of sequences better than 10.0: 263
Number of HSP's gapped: 35758
Number of HSP's successfully gapped: 351
Length of query: 2091
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1966
Effective length of database: 39,148,149
Effective search space: 76965260934
Effective search space used: 76965260934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 74 (33.1 bits)