Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10841.80ON49549520730.0
SAKL0C02574g1.80ON47346713560.0
Kwal_33.133861.80ON46942212671e-171
KLTH0F02332g1.80ON46942112061e-162
KLLA0C02277g1.80ON46541011781e-158
AFR671W1.80ON48836111471e-153
TDEL0C062101.80ON47947610861e-144
Suva_5.31.80ON48342910271e-135
NCAS0J018401.80ON44542310171e-134
ZYRO0F16720g1.80ON49242010201e-134
Skud_5.251.80ON48342910061e-132
YEL064C (AVT2)1.80ON4804299861e-128
Smik_5.231.80ON4834299451e-122
NDAI0I001301.80ON4444259351e-121
KNAG0C007801.80ON5134587672e-95
Kpol_1045.207.420ON4662071633e-11
NDAI0B035102.295ON4961341615e-11
NCAS0B062102.295ON4811431553e-10
CAGL0M06611g2.295ON4851301544e-10
ZYRO0B04026g7.420ON4362751518e-10
TPHA0C034602.295ON4731381464e-09
KLTH0C06006g7.420ON4452841446e-09
Kwal_27.107027.420ON4673331437e-09
KLLA0E06931g7.420ON4562151421e-08
Suva_9.1122.295ON4911301402e-08
CAGL0H04587g7.420ON4452691392e-08
TDEL0G022502.295ON4671271374e-08
Kpol_1003.442.295ON4701331349e-08
KNAG0B021907.420ON4611361331e-07
ZYRO0A02112g2.295ON4671331322e-07
KAFR0J013202.295ON4791281312e-07
KAFR0L019107.420ON4452871303e-07
KNAG0A053802.295ON4741321303e-07
Smik_9.972.295ON4901241251e-06
TPHA0K006707.420ON4642081222e-06
Skud_9.862.295ON4901441222e-06
SAKL0E07392g2.295ON4721171213e-06
YIL088C (AVT7)2.295ON4901131213e-06
TBLA0F01390singletonON4281891205e-06
Kwal_27.114852.295ON4711561196e-06
CAGL0G03619g7.420ON4601871196e-06
Smik_5.2647.420ON4482181188e-06
YER119C (AVT6)7.420ON4482201171e-05
KLTH0G10604g2.295ON4681261171e-05
KLLA0E08559g2.295ON460951152e-05
TDEL0C028207.420ON4542081115e-05
Suva_5.2407.420ON4482101062e-04
Suva_2.287.420ON4591911045e-04
Skud_5.2607.420ON4482041035e-04
SAKL0F13134g7.420ON5102001027e-04
TBLA0F014007.420ON45377970.003
Ecym_71337.420ON457109970.003
NDAI0E040107.420ON471208960.004
TBLA0F03230singletonON561101960.004
Kpol_505.52.177ON68786960.005
YBL089W (AVT5)7.420ON459106950.005
AGL285C7.420ON440104940.007
NCAS0E024407.420ON495110930.008
ADL205C2.295ON468109930.009
Smik_2.317.420ON459214920.011
TBLA0B072102.295ON497116910.018
Ecym_33352.295ON474111900.022
Skud_2.197.420ON459104900.022
NDAI0C037905.252ON721121840.13
TPHA0F017002.177ON44464830.14
Kwal_26.84012.177ON72075820.18
KLLA0E13795g5.252ON573117820.20
KNAG0C033807.420ON545102810.24
TBLA0C030305.252ON523133800.33
ZYRO0B09548g2.177ON71875761.2
KLTH0D09042g2.177ON71875751.3
Kwal_23.28395.252ON614138751.5
Smik_11.905.252ON680139741.8
NCAS0F023105.252ON668127742.0
YCR068W (ATG15)6.335ON52029732.6
Skud_11.815.252ON712139722.9
KLLA0C13277g2.177ON72145723.2
YKL146W (AVT3)5.252ON692133723.5
AER380C2.177ON71697723.6
NCAS0G026302.177ON70586713.8
KAFR0D020002.177ON71458714.2
TPHA0B029802.177ON74996714.5
CAGL0L01991g2.541ON105394698.0
TDEL0F013202.177ON71545689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1084
         (495 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   803   0.0  
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   526   0.0  
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   492   e-171
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   469   e-162
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   458   e-158
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   446   e-153
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   422   e-144
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   400   e-135
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   396   e-134
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   397   e-134
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   392   e-132
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   384   e-128
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   368   e-122
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   364   e-121
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   300   2e-95
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    67   3e-11
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     67   5e-11
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    64   3e-10
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    64   4e-10
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    63   8e-10
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    61   4e-09
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    60   6e-09
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    60   7e-09
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    59   1e-08
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    59   2e-08
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    58   2e-08
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    57   4e-08
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    56   9e-08
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    56   1e-07
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    55   2e-07
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    55   2e-07
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    55   3e-07
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    55   3e-07
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    53   1e-06
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    52   2e-06
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    52   2e-06
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    51   3e-06
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    51   3e-06
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    51   5e-06
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    50   6e-06
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    50   6e-06
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    50   8e-06
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    50   1e-05
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    50   1e-05
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    49   2e-05
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    47   5e-05
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    45   2e-04
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    45   5e-04
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    44   5e-04
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    44   7e-04
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    42   0.003
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    42   0.003
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     42   0.004
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               42   0.004
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    42   0.005
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    41   0.005
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    41   0.007
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     40   0.008
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    40   0.009
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    40   0.011
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    40   0.018
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    39   0.022
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    39   0.022
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    37   0.13 
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    37   0.14 
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    36   0.18 
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    36   0.20 
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    36   0.24 
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    35   0.33 
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    34   1.2  
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    33   1.3  
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    33   1.5  
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    33   1.8  
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    33   2.0  
YCR068W Chr3 (237214..238776) [1563 bp, 520 aa] {ON}  ATG15Lipas...    33   2.6  
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    32   2.9  
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    32   3.2  
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    32   3.5  
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    32   3.6  
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     32   3.8  
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    32   4.2  
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    32   4.5  
CAGL0L01991g Chr12 (231837..234998) [3162 bp, 1053 aa] {ON} simi...    31   8.0  
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    31   9.5  

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/495 (82%), Positives = 406/495 (82%)

Query: 1   MKGTSKQPYKKLDSSEPEPAACTSKSTRHSSPIPVSSDLQFELSTFHDYELLPTTSGARX 60
           MKGTSKQPYKKLDSSEPEPAACTSKSTRHSSPIPVSSDLQFELSTFHDYELLPTTSGAR 
Sbjct: 1   MKGTSKQPYKKLDSSEPEPAACTSKSTRHSSPIPVSSDLQFELSTFHDYELLPTTSGARN 60

Query: 61  XXXXXXXXXXXXXFEDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXX 120
                        FEDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKN   
Sbjct: 61  NKNVQNNVELNLQFEDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNCGL 120

Query: 121 XXXXXXXXXXXXXXDWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXX 180
                         DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFA   
Sbjct: 121 IGGVCLIVLLTIIVDWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAFGG 180

Query: 181 XXXXXXXXXDSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXX 240
                    DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRN           
Sbjct: 181 CVGFCIIIGDSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNISKLSKASMLA 240

Query: 241 XXXXXXXXXXXXXRAPKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFS 300
                        RAPKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFS
Sbjct: 241 LVSLLLIVALVIIRAPKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFS 300

Query: 301 LKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFC 360
           LKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFC
Sbjct: 301 LKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFC 360

Query: 361 FGFNMLTTFPLEIFVLRDVVRDLLYFQSADSESIILTTKEHFIVTSVLVFISMSISLTTC 420
           FGFNMLTTFPLEIFVLRDVVRDLLYFQSADSESIILTTKEHFIVTSVLVFISMSISLTTC
Sbjct: 361 FGFNMLTTFPLEIFVLRDVVRDLLYFQSADSESIILTTKEHFIVTSVLVFISMSISLTTC 420

Query: 421 NLGALLELVGSTTASXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQT 480
           NLGALLELVGSTTAS                      ERTPYYACIMFGFSIMIVSSTQT
Sbjct: 421 NLGALLELVGSTTASLTAYILPPATTLALTGKTKTLKERTPYYACIMFGFSIMIVSSTQT 480

Query: 481 ILSAIYGTEIKHCEA 495
           ILSAIYGTEIKHCEA
Sbjct: 481 ILSAIYGTEIKHCEA 495

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/467 (56%), Positives = 314/467 (67%), Gaps = 2/467 (0%)

Query: 30  SSPIPVSSDLQFELSTFHDYELLPTTSG-ARXXXXXXXXXXXXXXFEDPNVSQLTNPNRG 88
           S P    +DLQFELS+F  +      SG A                EDP VS +   N+ 
Sbjct: 6   SQPYAPVADLQFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQT 65

Query: 89  KSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXXDWTIRLIVINLKLT 148
           KSN+YMAFMNMANSILGAG+IGQPFAI N                 DWTIRLIV+NLKLT
Sbjct: 66  KSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLT 125

Query: 149 GKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPHVLKAFFPSHSELFR 208
           GKTTYQDSVEFAMG +GKLLIL  NGLFA            D+IPHVL+AFFP+H+ LF 
Sbjct: 126 GKTTYQDSVEFAMGRRGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHTALFH 185

Query: 209 RNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRAPKVEDEYKGQFTW 268
           RN +I  VTLF+SYPLSLNR+                        + P ++  YKG  T 
Sbjct: 186 RNAIIFFVTLFVSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKGSLTA 245

Query: 269 EEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAG 328
            + FITPR+FQGIS+ISFALVCHHNTSFI+FSLKNPSLKRF  LTH+SC++SM+VC + G
Sbjct: 246 SKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMG 305

Query: 329 YVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYFQS 388
           Y GFL FKDKTKGNILNNFPS+DN IN ARFCFGFNMLTTFPLEIFVLRDVVRDL +F S
Sbjct: 306 YSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHS 365

Query: 389 ADSESII-LTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTASXXXXXXXXXXXX 447
            ++ +   L+TK+H  VTS LVF++M++SLTTCNLGAL EL+G+TTAS            
Sbjct: 366 GEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNL 425

Query: 448 XXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHCE 494
                     ++ PYY CI+FGF++M++SSTQTIL+AI G E KHCE
Sbjct: 426 LLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  492 bits (1267), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 288/422 (68%), Gaps = 1/422 (0%)

Query: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           ED + +     NR KSN++MAFMNMANSILGAGVIGQPFAIKN                 
Sbjct: 48  EDESTTAFLRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLV 107

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWTIRLIV+N+K+TGKTTYQDSVEFAMG KGKLLIL  NGLFA            D+IPH
Sbjct: 108 DWTIRLIVVNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPH 167

Query: 195 VLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXR 254
           VL+AFFP H  LF RN++I +VT FIS+PLSLNRN                        +
Sbjct: 168 VLRAFFPGHENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVK 227

Query: 255 APKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTH 314
            P ++D YKG F   E F TPR+FQGIS+ISFALVCHHNTSFI+FSLK PSLKRF  LTH
Sbjct: 228 GPMIDDAYKGSFNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTH 287

Query: 315 ISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
            SC ++M+ C + GY GFL FKD+TKGNILNNFP +DN +N ARFCFGFNMLTTFPLEIF
Sbjct: 288 FSCFVAMIFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIF 347

Query: 375 VLRDVVRDLLYFQSADS-ESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTT 433
           VLRDV+RD ++F S D+ +S  L+ K H I+T++LV  +M ISLTTCNLGAL EL G+TT
Sbjct: 348 VLRDVIRDFMFFNSKDTNQSQELSLKLHVILTTILVMTTMLISLTTCNLGALFELTGATT 407

Query: 434 ASXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHC 493
           AS                      E+ P+YACI+FGF+IM+VSS+QTI++ I G + KHC
Sbjct: 408 ASLMAYILPPSVNLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHC 467

Query: 494 EA 495
           E 
Sbjct: 468 EV 469

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  469 bits (1206), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 235/421 (55%), Positives = 280/421 (66%), Gaps = 1/421 (0%)

Query: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           ED   S   +  R KSN+ MAFMNMANSILGAG+IGQPFA+KN                 
Sbjct: 48  EDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLSLLV 107

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWTIRLIV+NL+++GKTTYQDSVE AMG KGKLLIL  NGLFA            D+IPH
Sbjct: 108 DWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGDTIPH 167

Query: 195 VLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXR 254
           VL+AFF  H  LF RN+VI VVT  IS+PLSLNR+                        +
Sbjct: 168 VLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVIVVIVVIK 227

Query: 255 APKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTH 314
            P  +  YKG F      ITPR+FQG+S+ISFALVCHHNTSFI+FSLK PSLKRF  LTH
Sbjct: 228 GPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTH 287

Query: 315 ISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
            SC I+M+ C + G+ GFL FKDKTKGNILNNFP NDN +N ARFCFGFNMLTTFPLEIF
Sbjct: 288 FSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIF 347

Query: 375 VLRDVVRDLLYFQSA-DSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTT 433
           VLRDV++DL++F S   S+  +L+ K H I+++ LVF +M+ISLTTCNLGAL EL+G+TT
Sbjct: 348 VLRDVIKDLMFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATT 407

Query: 434 ASXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHC 493
           AS                      +R P+Y CI FGF+IM++SSTQTI+S I G + KHC
Sbjct: 408 ASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHC 467

Query: 494 E 494
           E
Sbjct: 468 E 468

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  458 bits (1178), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 236/410 (57%), Positives = 273/410 (66%)

Query: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           EDP    +   N  KSN YMAFMNMANSILG+GVIGQPFA+KN                 
Sbjct: 54  EDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILV 113

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWTIRLIVINLKLTGK+TYQ SVE AMG  G LLIL  NGLFA            DSIPH
Sbjct: 114 DWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAFGGCVGFCIIIGDSIPH 173

Query: 195 VLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXR 254
           VL AFFPSH++LF RNV+I++VTLFIS+PLSLNR+                        +
Sbjct: 174 VLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVK 233

Query: 255 APKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTH 314
           AP V  EYKG F   + FITPR+FQGIS+ISFALVCHHNTSFIFFSL+NPSLKRF  LTH
Sbjct: 234 APLVSGEYKGTFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTH 293

Query: 315 ISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
           +S I+S +VCL   Y GFL FKDKT GNILNNFPS+DN INFAR   GFNMLTTFPLEIF
Sbjct: 294 VSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIF 353

Query: 375 VLRDVVRDLLYFQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTA 434
           VLRDV+RD++Y+   D E + LTTK H ++TS LV I M I+L+T NLGALLE++G+T+A
Sbjct: 354 VLRDVIRDIIYYNKDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSA 413

Query: 435 SXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSA 484
           S                      E+ PY  CI+FG  +M VS+ QTIL A
Sbjct: 414 SLMAYILPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEA 463

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  446 bits (1147), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 217/361 (60%), Positives = 262/361 (72%)

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWTIRLI+INLKLTGKTTYQD+VEFAMG  GK  +LF NG+FA            DSIPH
Sbjct: 128 DWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAFGGCVGFCIIIGDSIPH 187

Query: 195 VLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXR 254
           VL+AFFP++ E F RN++I++VT+F+SYPLSLNRN                        R
Sbjct: 188 VLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNISKLSKASMLALVSLLLIVVIIVVR 247

Query: 255 APKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTH 314
            P V ++Y+G F  EE F+ PR+FQGIS+ISFALVC HNTSFI+FSL+ PSL+RF +LTH
Sbjct: 248 GPTVGNDYRGSFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTH 307

Query: 315 ISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
           ISC ISM+VCLIAGY GFLTFK KTKGNILNNFPS+DN+INFARFCFGFNMLTTFPLEIF
Sbjct: 308 ISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIF 367

Query: 375 VLRDVVRDLLYFQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTA 434
           VLRDV+RDL+  ++   E + L+TK HFI+T+ LV  +M ISLTTCNLGALLELVGSTTA
Sbjct: 368 VLRDVIRDLISTETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGALLELVGSTTA 427

Query: 435 SXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHCE 494
           S                      E+ P+YACI+FGFSIM++SSTQ I++AI+  +   C+
Sbjct: 428 SLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAIHSDKSSQCD 487

Query: 495 A 495
           A
Sbjct: 488 A 488

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  422 bits (1086), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 228/476 (47%), Positives = 291/476 (61%), Gaps = 10/476 (2%)

Query: 24  SKSTRHSSPIPVSSDLQFELSTFHDYELLPTTSGA--RXXXXXXXXXXXXXXFEDPNVSQ 81
           S+    S  IP+  +L+FEL    D++  P  S                    ++  V  
Sbjct: 8   SRLEEQSERIPL--ELEFELV---DFDAKPGASDETEENDSNEAKASSSNSAIDESMVIN 62

Query: 82  LTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXXDWTIRLI 141
           L   N  KS M  AFMNMANSILGAGV+GQPFAI+N                 DWT+RLI
Sbjct: 63  LLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRLI 122

Query: 142 VINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPHVLKAFFP 201
           VINL L GK TYQD+VEFA+G KG++L+L  NGLFA            D+IPH L++ F 
Sbjct: 123 VINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIFH 182

Query: 202 SHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRAPKVEDE 261
           S +  FRRNVVI++VTLFISYPLSL RN                        + P+V+  
Sbjct: 183 SSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGPRVDMS 242

Query: 262 YKG-QFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIIS 320
            KG +++  + FI+  +F+GIS+ISFALVCHHNTSFIFFS+KN SL++F  LTHIS  IS
Sbjct: 243 LKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFIS 302

Query: 321 MLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVV 380
           M+ C++ GY G+  F+DKTKGNILNNFP +D  IN AR CFGFNMLTTFPLEIFVLRDV+
Sbjct: 303 MIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVI 362

Query: 381 RDLLYFQSADSESII--LTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTASXXX 438
              LY +  + E+    L+T++ FI+T+V V  +MSISLTTCNLGAL EL+G+TTAS   
Sbjct: 363 AAFLYGKKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMA 422

Query: 439 XXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHCE 494
                              ++ P+Y CI FGF +MIVSSTQTI+  + G++ +HCE
Sbjct: 423 YILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCE 478

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  400 bits (1027), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 215/429 (50%), Positives = 268/429 (62%), Gaps = 10/429 (2%)

Query: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           +D  V+ +   N  KS+M MAFMN+ANSILGAG+I QPFAIKN                 
Sbjct: 55  DDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIV 114

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWT+RLIVINL L GK TYQ +VE+ MG KGKLLILF NGLFA            D+IPH
Sbjct: 115 DWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPH 174

Query: 195 VLKAFFPSHSE----LFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXX 250
           VL+A F  +        RRNV+I +VT+FIS+PLSL RN                     
Sbjct: 175 VLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLT 234

Query: 251 XXXRAPKVEDEYKGQ-FTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRF 309
              R P +  +++G      + FI   +F+ +S+ISFALVCHHNTSFIFFS++N S+ +F
Sbjct: 235 VVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294

Query: 310 GNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTF 369
             LTHIS +IS++ C + GY GF  FK+KTKGN+LN+FP  D  IN AR CFGFNMLTTF
Sbjct: 295 TKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTF 354

Query: 370 PLEIFVLRDVVRDLLY----FQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGAL 425
           P+EIFVLRDVV +LL+     ++ D E   L+ K+H I+TS+LVFI+M ISLTTCNLGAL
Sbjct: 355 PMEIFVLRDVVGNLLHECHLIKNYD-EHTQLSNKQHTIITSMLVFITMGISLTTCNLGAL 413

Query: 426 LELVGSTTASXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAI 485
            EL+G+TTAS                       + PYY CI FGF IMIVSSTQTIL A+
Sbjct: 414 FELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAV 473

Query: 486 YGTEIKHCE 494
            G + +HC+
Sbjct: 474 NGPDGQHCQ 482

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  396 bits (1017), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 262/423 (61%), Gaps = 11/423 (2%)

Query: 81  QLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXXDWTIRL 140
           +L   N  KSN+YMAFMNMANSILGAG+I QP A+KN                 DWT+RL
Sbjct: 24  ELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGILGSIICYILLGFIVDWTLRL 83

Query: 141 IVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPHVLKAFF 200
           +VIN+ L+ K TYQD+VE  MG KGK LIL  NGLFA            D+IPHVL+ FF
Sbjct: 84  LVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFALGGCIGFSIIIGDTIPHVLRIFF 143

Query: 201 PSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRAPKVED 260
             +SE   RN+VI + TLFISYPLSL RN                        R P +  
Sbjct: 144 --NSEKITRNMVIFLTTLFISYPLSLLRNIAALSKASFLALVSMVVIVFTVVIRGPALPS 201

Query: 261 EYKGQ-FTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCII 319
           E KG+  +    F +P +F+ +SIISFALVCHHNTSFIF S++N SL +F  LTHIS  I
Sbjct: 202 ELKGEPLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIFHSIRNKSLTKFTKLTHISVFI 261

Query: 320 SMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDV 379
           S+  C++ GY GF  F DKTKGNILNNFP+ DN IN AR CFGFNMLTTFPLEIFVLRDV
Sbjct: 262 SVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIARICFGFNMLTTFPLEIFVLRDV 321

Query: 380 VRDLL----YFQSADSESII--LTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTT 433
           V  +L       S ++  ++  L+ K HF +T+ LVF+SM ISL TCNLGAL EL+GSTT
Sbjct: 322 VAVILLECHLVPSEENNPLLPYLSRKWHFCITTGLVFLSMGISLMTCNLGALFELIGSTT 381

Query: 434 ASXXXXXX--XXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIK 491
           AS                         + P+Y CI FGF++MI+SST+TIL A++GTE K
Sbjct: 382 ASVMAYILPPYVNLLLRQQRNELSFTTKLPHYFCIFFGFTVMIISSTETILDAVFGTEQK 441

Query: 492 HCE 494
           HCE
Sbjct: 442 HCE 444

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  397 bits (1020), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 201/420 (47%), Positives = 262/420 (62%), Gaps = 2/420 (0%)

Query: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           +D  V+ +   N  KS M  AFMNMANSILGAGVIGQP AIKN                 
Sbjct: 74  DDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIVGAIIAYLVLFVLV 133

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWT+RLIVINL L GK TYQD+V FAMG +G++ +L  NGLFA            D++PH
Sbjct: 134 DWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIGDTLPH 193

Query: 195 VLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXR 254
           V +AF   +S    R ++I++VT+ ISYPL+L RN                        R
Sbjct: 194 VFRAFIHQNSVFLSRRLIITIVTICISYPLALQRNIAALSKASFLALISMVIIVFTVIIR 253

Query: 255 APKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTH 314
            P++  + +   TWE+  +TPR+F+GIS+ISFALVCHHNTSFI+FS+KN SL++F  LTH
Sbjct: 254 GPEIHAK-RDPLTWEDILVTPRIFRGISVISFALVCHHNTSFIYFSIKNRSLRKFNRLTH 312

Query: 315 ISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
           IS  IS++ C+I G+ GF  F   TKGN+LNNF ++D  +N AR CFGFNMLTTFPLEIF
Sbjct: 313 ISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLCFGFNMLTTFPLEIF 372

Query: 375 VLRDVVRDLLYFQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTA 434
           VLRDV+   +     + +  +L+   HFI+T++LVF +MSISL TCNLGA+ EL+G+TTA
Sbjct: 373 VLRDVIASFIGGHQPNGDPNVLSKSNHFIITTILVFGTMSISLLTCNLGAIFELIGATTA 432

Query: 435 SXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHCE 494
           S                      ++ P++ACI FGFSIM++SS QTIL  + GT+ K CE
Sbjct: 433 S-MMAYILPPWVNLLLTSDKTFRQKLPHFACIAFGFSIMLISSIQTILDTMNGTDEKQCE 491

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  392 bits (1006), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 220/429 (51%), Positives = 267/429 (62%), Gaps = 10/429 (2%)

Query: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           +DP V+ +   N  KS+M MAFMN+ANSILGAG+I QP AIKN                 
Sbjct: 55  DDPLVNSVLRENDKKSSMRMAFMNLANSILGAGIITQPVAIKNAGILGGLIAYIALGFIV 114

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWT+RLIVINL L GK TYQ +VE  MG KGKLLILF NGLFA            D+IPH
Sbjct: 115 DWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPH 174

Query: 195 VLKAFFPSHSE----LFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXX 250
           VL+A F  +        RRNV+I +VT+FIS+PLSL RN                     
Sbjct: 175 VLRAVFSQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIVLT 234

Query: 251 XXXRAPKVEDEYKGQ-FTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRF 309
              R P +  ++KG    W +  +   +F+ +S+ISFALVCHHNTSFIFFS++N S+ +F
Sbjct: 235 VVIRGPMLPYDWKGHSLKWPDFLVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294

Query: 310 GNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTF 369
             LTHIS IIS++ C + G+ GF  FK+KTKGN+LNNFP  D  IN AR CFGFNMLTTF
Sbjct: 295 TRLTHISIIISVICCGLMGFSGFAAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLTTF 354

Query: 370 PLEIFVLRDVVRDLLY----FQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGAL 425
           P+EIFVLRDVV + L+     +S D E   L+ K+H I+TS+LVFI+MSISLTTCNLGAL
Sbjct: 355 PMEIFVLRDVVGNSLHECHLIKSYD-EHTQLSDKQHTIITSLLVFITMSISLTTCNLGAL 413

Query: 426 LELVGSTTASXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAI 485
            EL+GSTTAS                       + PYY CI FGF IMIVSSTQTIL AI
Sbjct: 414 FELIGSTTASTMAYILPPYTNLLLTSKKKNWKAKLPYYLCICFGFMIMIVSSTQTILDAI 473

Query: 486 YGTEIKHCE 494
            G + +HCE
Sbjct: 474 NGADEQHCE 482

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  384 bits (986), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 213/429 (49%), Positives = 267/429 (62%), Gaps = 10/429 (2%)

Query: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           +D  V+ +   N  KS+M MAFMN+ANSILGAG+I QPFAIKN                 
Sbjct: 52  DDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIV 111

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWT+RLIVINL L GK TYQ +VE  MG KGKLLILF NGLFA            D+IPH
Sbjct: 112 DWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPH 171

Query: 195 VLKAFFPSHSE----LFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXX 250
           VL+A F  +        RRNV+I +VT FIS+PLS+ RN                     
Sbjct: 172 VLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLT 231

Query: 251 XXXRAPKVEDEYKGQ-FTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRF 309
              R P +  ++KG      + F+   +F+ +S+ISFALVCHHNTSFIFFS++N S+ +F
Sbjct: 232 VVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 291

Query: 310 GNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTF 369
             LTHIS IIS++ C + GY GF  FK+KTKGN+LN+FP  D  IN AR CFGFNMLTTF
Sbjct: 292 TRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351

Query: 370 PLEIFVLRDVVRDLLY----FQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGAL 425
           P+EIFVLRDVV +LL+     ++ D E   L+ K+H ++TS LVFI+M ISLTTCNLGAL
Sbjct: 352 PMEIFVLRDVVGNLLHECNLIKNYD-EHTQLSGKQHVVITSSLVFITMGISLTTCNLGAL 410

Query: 426 LELVGSTTASXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAI 485
            EL+G+TTAS                      ER P+Y CI FGF IMI+SSTQTI+ A+
Sbjct: 411 FELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTIIDAV 470

Query: 486 YGTEIKHCE 494
            G++ +HC+
Sbjct: 471 NGSDGQHCQ 479

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  368 bits (945), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 214/429 (49%), Positives = 268/429 (62%), Gaps = 10/429 (2%)

Query: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           +D  V+++   N  KS+M MAFMN+ANSILGAG+I QPFAIKN                 
Sbjct: 55  DDTLVNKVLLENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLISYIALGFIV 114

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPH 194
           DWT+RLIVINL L GK TYQ +VE  MG KGKLLILF NGLFA            D+IPH
Sbjct: 115 DWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPH 174

Query: 195 VLKAFFPSHSE----LFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXX 250
           VL+A F           RRNV+I +VT+FIS+PLSL RN                     
Sbjct: 175 VLRAIFSQKDGDIHFWLRRNVIIIIVTIFISFPLSLKRNIEALSKASFLAVISMIIIVVT 234

Query: 251 XXXRAPKVEDEYKGQ-FTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRF 309
              R P +  ++KG      + F+   +F+ +S+ISFALVCHHNTSFIFFS++N S+ +F
Sbjct: 235 VVIRGPMLPYDWKGHSLQLRDFFVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294

Query: 310 GNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTF 369
             LTHIS IIS++ C + GY GF  FK+KTKGNILN+FP  D  IN AR CFGFNMLTTF
Sbjct: 295 TRLTHISIIISVICCGLMGYSGFAAFKEKTKGNILNSFPGTDTAINIARLCFGFNMLTTF 354

Query: 370 PLEIFVLRDVVRDLLY----FQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGAL 425
           P+EIFVLRDVV +LL+     ++ D E   L+ K+H ++TS+LVFI+M ISLTTCNLGAL
Sbjct: 355 PMEIFVLRDVVGNLLHECKIIKNYD-EHTQLSGKQHIVITSLLVFITMGISLTTCNLGAL 413

Query: 426 LELVGSTTASXXXXXXXXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAI 485
            EL+G+TTAS                       + P+Y CI FGF IMI+SSTQTIL A+
Sbjct: 414 FELIGATTASTMAYILPPYTNLLLTSKKKSWSAKLPFYLCICFGFMIMIISSTQTILDAV 473

Query: 486 YGTEIKHCE 494
            G++ +HC+
Sbjct: 474 NGSDGQHCQ 482

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 202/425 (47%), Positives = 255/425 (60%), Gaps = 11/425 (2%)

Query: 79  VSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXXDWTI 138
           V ++ + N  KSN+YMAF+NMANSILGAG+I QP A+KN                 DWT+
Sbjct: 21  VKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTL 80

Query: 139 RLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIPHVLKA 198
           RL++ N+ L+ K TY D+VE+ MG KGK LIL  NGLFA            D+IPHVL+ 
Sbjct: 81  RLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALGGCIGFCIIIGDTIPHVLRI 140

Query: 199 FFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRAPKV 258
           F   HS    RN VI   TLFISYPLSL R+                          P +
Sbjct: 141 FI--HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALISMTVIVMTVVVFGPSL 198

Query: 259 EDEYKGQFTWEEAFI-TPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISC 317
             E KG      +++ +P +F+ +SI+SFALVCHHNTSFIF S++N SL +F  LTH+S 
Sbjct: 199 PAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSV 258

Query: 318 IISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLR 377
            IS++ C+I GY GF  F  KTKGNILNNFP N   IN AR CFGFNMLTT PLE+FVLR
Sbjct: 259 FISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318

Query: 378 DVVRDLL----YFQSADSES--IILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGS 431
           DV+  +L    +  S + +    ILT K HFIVT+++VF++MS+SL TCNLGAL ELVG+
Sbjct: 319 DVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGA 378

Query: 432 TTASXXXXXX--XXXXXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTILSAIYGTE 489
           TTAS                         + P+Y CI+FGF++MIVSS QTI+ A+   E
Sbjct: 379 TTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIVEALADNE 438

Query: 490 IKHCE 494
            KHCE
Sbjct: 439 QKHCE 443

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  300 bits (767), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 184/458 (40%), Positives = 242/458 (52%), Gaps = 54/458 (11%)

Query: 74  FEDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXX 133
            E+P ++ +   N  KS ++MAFMNMANSILGAG+I QPFA++                 
Sbjct: 22  LENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGFL 81

Query: 134 XDWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAXXXXXXXXXXXXDSIP 193
            DWT+RLIV NL +TG  TYQ+SV  A+G  G+L IL  NGLFA            D+IP
Sbjct: 82  VDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTIP 141

Query: 194 HVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXX 253
           HVL+   P   +   RN VI VVTL IS PLSL++                         
Sbjct: 142 HVLRTVCPP--QYIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAVIVVTVAV 199

Query: 254 RAPKVEDEYKGQFTW--EEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGN 311
           R P +  E K Q +    + +    +F+ +SI+SFALVCHHNTSFIF SL+N S+ +F  
Sbjct: 200 RGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNR 259

Query: 312 LTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPL 371
           LTH SC +S+ VC++ GY GF TFK+KTKGN+LNNF  +D +IN AR  FGFNMLTTFPL
Sbjct: 260 LTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPL 319

Query: 372 EIFVLRDVVRDLL------YFQ-------------------------------------- 387
           EIFVLR+VV D+       ++Q                                      
Sbjct: 320 EIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGPAGPHPGL 379

Query: 388 SADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTASXXXXX---XXXX 444
             D E    + + H  VT VLV  +M ++L TCNLGALLE++GSTT +            
Sbjct: 380 PPDPEP---SEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPPLTHV 436

Query: 445 XXXXXXXXXXXXXERTPYYACIMFGFSIMIVSSTQTIL 482
                        ER  +  C++FG ++M+VS+TQT+L
Sbjct: 437 LLTRRRPQPHTARERLGHCCCVVFGCTVMLVSTTQTLL 474

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 81/207 (39%), Gaps = 6/207 (2%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXX 249
           D +P VL  F  +H  L  RNV I++V LFI  PL   +N                    
Sbjct: 104 DVLPQVLSTF-TNHEWLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCA 162

Query: 250 XXXXRAPKVEDE---YKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSL 306
                     DE   +KG  +W            + I  FA  CHHN   +     +P+ 
Sbjct: 163 LVLIHFIMPNDETHNFKGDVSWGLPKNGLNPLTTLPIYVFAYTCHHNMFSVINEQMDPTY 222

Query: 307 KRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNML 366
                +  IS I++  + ++ G  G+LTF D   GNI+  +P N +     R    F + 
Sbjct: 223 NSVKKIAIISMILAGFLYILIGGAGYLTFGDHITGNIITLYPQNIS-TTIGRIAIIFLVT 281

Query: 367 TTFPLEIFVLRDVVRDLL-YFQSADSE 392
             FPL+    R  +  ++ YF+ A   
Sbjct: 282 LAFPLQCHPARASINHIIHYFKPAQDN 308

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 66/134 (49%)

Query: 254 RAPKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLT 313
           + P   D  +G+  W   +    +    SII FA     N   +   L++ S++   N+ 
Sbjct: 169 KLPNEGDSTRGEVYWFHVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNIKNVI 228

Query: 314 HISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEI 373
           + S IIS  + L+ G  G+LTF    +GNI+ N+  N N+I   +FC G  ++ +FPL  
Sbjct: 229 NGSIIISTGLFLLVGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSFPLLF 288

Query: 374 FVLRDVVRDLLYFQ 387
             LR  V +L+ + 
Sbjct: 289 HPLRIAVNNLVVWM 302

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 71/143 (49%), Gaps = 5/143 (3%)

Query: 263 KGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISML 322
           +G+ +W   +    +    SII FA V   N   I   L+N S++    + + S  IS +
Sbjct: 175 RGEISWIRIYDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSIGISSI 234

Query: 323 VCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRD 382
             L+ G  G+LTF    +GNI+ N+  N  +I   +FC  F +L +FPL    LR  V +
Sbjct: 235 FFLLVGISGYLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLRIAVNN 294

Query: 383 L-----LYFQSADSESIILTTKE 400
           L     + F + D+ ++  TT+E
Sbjct: 295 LVVWFGMTFGADDTCAVPSTTQE 317

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 65/130 (50%), Gaps = 1/130 (0%)

Query: 255 APKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTH 314
           AP++  E +G+ +W + +    +    SII FA V   N   I   L++ S+     +  
Sbjct: 171 APEISFE-RGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVD 229

Query: 315 ISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
            S +IS ++ L  G  G+LTF   T GNIL N+ S+   I   +FC    ++ TFPL   
Sbjct: 230 SSILISTILFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFPLLFH 289

Query: 375 VLRDVVRDLL 384
            LR  + +++
Sbjct: 290 PLRTAINNIV 299

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 110/275 (40%), Gaps = 31/275 (11%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXX 249
           D IP +   F  S+  L  RN  I++V LF+  PL   +                     
Sbjct: 104 DLIPQIFTTF-TSNKILLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYLCC 162

Query: 250 XXXXR--APKVE-DEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSL 306
                   P  E D+ KG+ +       P     + I  FA  CHHN   ++   K+ S 
Sbjct: 163 LVVVHFIWPSNEIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTST 222

Query: 307 KRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNML 366
           ++   +      I+ ++  I G  G+LTF D   GNI+  +P + +     R      ++
Sbjct: 223 RQLNKIGRYGMSIAFVLYTIIGGAGYLTFGDHIAGNIITLYPPSLS-TTIGRVAIVLLVM 281

Query: 367 TTFPLEIFVLRDVVRDLLY-FQS---------------ADSESI----------ILTTKE 400
             FPL+    R  + ++LY FQS               ++ ES+           L  K 
Sbjct: 282 LAFPLQCHPARSSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPVPPLQGKR 341

Query: 401 HFIVTSVLVFISMSISLTTCNLGALLELVGSTTAS 435
             ++T V++  S  ++++  +L  LL +VGST ++
Sbjct: 342 FTVITLVILIASYLLAISVTSLARLLAIVGSTGST 376

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 9/138 (6%)

Query: 261 EYKGQFTWEEAFITPRVFQGI----SIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHIS 316
           +++G   W    I  R ++G     +II FA     N   I   L+  S+K   ++ + S
Sbjct: 174 QHRGDVNW----IKIRDYKGFVTTFNIIIFAFTGAMNLFSIINELEENSMKNISHVINYS 229

Query: 317 CIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVL 376
             IS ++ L  G  G+LTF   T GNI+ N+  N  + N   FC G  ++ +FPL    L
Sbjct: 230 IGISTILFLSVGITGYLTFGSNTVGNIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPL 289

Query: 377 RDVVRDLL-YFQSADSES 393
           RD V +++ Y+Q   S +
Sbjct: 290 RDAVNNIIVYYQYYKSNN 307

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 111/284 (39%), Gaps = 40/284 (14%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXX 249
           D +P +  A F SH  L  RN+ I++V LF+  PL   +                     
Sbjct: 104 DLMPRIF-ATFTSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCV 162

Query: 250 XXXXRAPKVEDE---YKGQFTWEEAFIT-PRVFQGISIISFALVCHHNTSFIFFSLKNPS 305
                     DE    +G  +  +   +   +     I  FA  CHHN   I   L++ S
Sbjct: 163 LVLVHYVWPSDEIRELRGHVSLGKPVGSFAALLSCFPIFVFAYTCHHNMFSIVNELRDNS 222

Query: 306 LKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNM 365
           LK    ++ IS  ++M + L+ G  G+ TF D   GNI+  +P +       R      +
Sbjct: 223 LKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYPQSAA-TTVGRVAIALLV 281

Query: 366 LTTFPLEIFVLRDVVRDLLYF---------------------QSADSESII--------- 395
           +  FPL+    R  V  +L++                      S+D+E I+         
Sbjct: 282 MLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVVEEGGPRQL 341

Query: 396 ----LTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTAS 435
               L  K    +T+ ++ +S  ++++  +L  +L +VG+T ++
Sbjct: 342 AVMPLEGKRFIAITTSILLLSYLLAISVTSLARVLAVVGATGST 385

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 123/333 (36%), Gaps = 14/333 (4%)

Query: 80  SQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXXDWTIR 139
           S + NPN   S++    + + ++  GAG++  P+A K                     + 
Sbjct: 16  SSIYNPNAMSSSVGSGVLTLLHTACGAGILAMPYAFKPFGLVLGFCMIVFCGACSATGLM 75

Query: 140 LIVINLKLTGKTTYQDSVEFAMG--TKGKLLILF--VNGLFAXXXXXXXXXXXXDSIPHV 195
           L     +++     +++  FA+   T  +L ++F     +              D +P +
Sbjct: 76  L---QARVSKYAKERNASFFALSQITYPQLSVVFDLAIAVKCFGVGVSYLVVVGDLMPRI 132

Query: 196 LKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRA 255
             A F SHS L  RN  I++V   I  PL   R                           
Sbjct: 133 F-ATFTSHSLLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLCVLVVVHF 191

Query: 256 --PKVE-DEYKGQFTWEE-AFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGN 311
             P  E  E KG  + ++ A     +     I  FA  CHHN   I   L++ SLK    
Sbjct: 192 LFPSEELRELKGYVSIQKPAGSFSALLSCFPIFVFAYTCHHNMFSIINELRDNSLKGIYK 251

Query: 312 LTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPL 371
           +  IS  +SM + L+ G  G+ TF D   GNI+  +P +       R      ++  FPL
Sbjct: 252 VCAISVALSMTLYLLIGGSGYATFGDNVPGNIITLYPQSTT-TTIGRVAIALLVMLAFPL 310

Query: 372 EIFVLRDVVRDLL-YFQSADSESIILTTKEHFI 403
           +    R  +  ++ YF  A    +  +   H I
Sbjct: 311 QCHPARASIDHIIQYFSKASDNPLQNSEASHLI 343

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 81/215 (37%), Gaps = 7/215 (3%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXX 249
           D +P ++  F  +H  L  R   I+ VTL I  PL   +                     
Sbjct: 104 DLLPQIMSTF-TTHGWLLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCV 162

Query: 250 XXXXR--APKVE-DEYKGQFT-WEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPS 305
                   P  E D  +G  + W+ + +   +     I  FA  CHHN   I     + S
Sbjct: 163 LVVFHFAVPNSEIDHLRGHVSIWKPSDVDSSMLSSFPIFVFAYTCHHNMFSIINEQSDKS 222

Query: 306 LKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNM 365
           L     L  I+  ++M + +  G +G+ TF D   GNI+  +P N       R      +
Sbjct: 223 LDSITKLIRIAITLAMSLYISIGALGYCTFGDHITGNIITLYP-NSISSTIGRIAIALLV 281

Query: 366 LTTFPLEIFVLRDVVRDLL-YFQSADSESIILTTK 399
           +  FPL+    R  V  +L YF   ++   + TT 
Sbjct: 282 ILAFPLQCHPARASVNHILHYFSKGNTHPPMTTTS 316

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%)

Query: 257 KVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHIS 316
           K+ D  +    W +      +    SII FA     N   +   LK+ S++    + + S
Sbjct: 170 KLTDVLENDICWWKIHDVKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMENITLVINNS 229

Query: 317 CIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVL 376
             +S ++ LI G  G+LTF +KT GN++ N+  N  +I   +FC G  ++ +FPL    L
Sbjct: 230 ITLSTILFLIVGLSGYLTFGNKTSGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPL 289

Query: 377 RDVVRDLLYF 386
           R  V +++ +
Sbjct: 290 RVAVNNVIIW 299

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/269 (20%), Positives = 103/269 (38%), Gaps = 36/269 (13%)

Query: 202 SHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXR-APKVED 260
           S   L  RNV I++V LFI  PL   R                           A +  +
Sbjct: 114 SSGLLLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCILVIVHFAHQTTE 173

Query: 261 --EYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCI 318
             E KG+ +       P     + I  FA  CHHN   +    KN        +  +S +
Sbjct: 174 LRELKGEVSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGFTYVRYIAIVSIL 233

Query: 319 ISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRD 378
           ++ ++ ++ G  G+LTF D   GNI+  +P   +     R      ++  FPL+    R+
Sbjct: 234 VAFVLYVVIGSTGYLTFGDNITGNIIALYPDTLS-TTIGRIAIVLLVMLAFPLQCHPARE 292

Query: 379 VVRDLLYF--------------------------------QSADSESIILTTKEHFIVTS 406
            + +++ +                                ++ D E   + TK   I+T+
Sbjct: 293 SINNMIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRANDKEEECMDTKRFMIITA 352

Query: 407 VLVFISMSISLTTCNLGALLELVGSTTAS 435
            ++F S  ++++  +L  +L +VG+T ++
Sbjct: 353 CILFCSYLLAISVTSLARVLAIVGATGST 381

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%)

Query: 261 EYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIIS 320
            Y+G+  W + +    +    SII FA     N   I   LK  S+    ++ + S  IS
Sbjct: 174 SYRGEVCWFKVYDFKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITIS 233

Query: 321 MLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVV 380
             V L  G  G+LTF   T GNI+ N+  +  ++   + C G  ++ +FPL     R  +
Sbjct: 234 TAVFLAVGICGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPLLFHPCRIAI 293

Query: 381 RDLLYFQ 387
            +L+ + 
Sbjct: 294 NNLVVWS 300

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 61/133 (45%)

Query: 261 EYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIIS 320
           E +G   W   +    +    SII FA     N   I   L+N S++    + + S  IS
Sbjct: 177 ETRGDVNWFSVYDWTGLCSTFSIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGIS 236

Query: 321 MLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVV 380
             + L+ G  G+LTF   T GNI+ N+  +  +    +FC G  ++ +FPL    LR  V
Sbjct: 237 TFLFLLVGISGYLTFGSNTLGNIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAV 296

Query: 381 RDLLYFQSADSES 393
            +++ F   +  S
Sbjct: 297 NNMVIFYQINYGS 309

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 66/136 (48%), Gaps = 9/136 (6%)

Query: 260 DEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSL-KRFGNLTHI--- 315
            + KG+ +       P +   + I  FA  CHHN     FS+ N  + ++F  +T I   
Sbjct: 179 QDLKGRISIGLPRDEPPILTTLPIFVFAYTCHHN----MFSVINEQVDQKFNVITKIAKY 234

Query: 316 SCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFV 375
           S  ++ L+ ++ GY G+LTF DK  GNI+  +P+N +     R      +  TFPL+   
Sbjct: 235 SMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLYPNNASS-TIGRIAIAILVTLTFPLQCHP 293

Query: 376 LRDVVRDLLYFQSADS 391
            R  +  +++F  A S
Sbjct: 294 ARASIHHIIHFFQARS 309

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 58/133 (43%)

Query: 260 DEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCII 319
           +E +G  +W   +    +    SII FA     N   I   L+N ++     + + S  I
Sbjct: 172 EEVRGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNRSIAI 231

Query: 320 SMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDV 379
           + +  +     G+LTF   T GNI+ N+     +++  +FC G  ++ TFPL     R  
Sbjct: 232 ATVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPLLFHPCRIA 291

Query: 380 VRDLLYFQSADSE 392
           V +L  +     E
Sbjct: 292 VNNLCVWAQLQRE 304

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 3/128 (2%)

Query: 260 DEY---KGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHIS 316
           D Y   +GQ  W   +    +    SII FA     N   I   LKN S++   ++ + S
Sbjct: 170 DNYMIVRGQVNWFTVYDFKGLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHS 229

Query: 317 CIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVL 376
             IS ++ L  G  G+LTF   T GNIL N+ ++  +++ A+FC    ++ +FPL    L
Sbjct: 230 ISISTILFLTVGIAGYLTFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPL 289

Query: 377 RDVVRDLL 384
           R  V +L+
Sbjct: 290 RIAVNNLV 297

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 108/287 (37%), Gaps = 48/287 (16%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPL----SLNRNXXXXXXXXXXXXXXXX 245
           D +P +   F  SH  L  R+  IS++ LFI  PL     LN                  
Sbjct: 104 DLMPQIFAVFTTSHI-LLNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCV 162

Query: 246 XXXXXXXXRAPKVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSL---- 301
                   +   V D  KG  +       P     + I  FA  CHHN    FFS+    
Sbjct: 163 LVVAHFIFQTEDVHD-LKGVVSIGLPKHEPSPLTTLPIFVFAYTCHHN----FFSVINEQ 217

Query: 302 KNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCF 361
            N +      +  I+ I++ L+ ++ G+ G+LTF D   GNI+  +P   +     R   
Sbjct: 218 SNIAFTHIKKIPIIAMILAYLLYILIGFSGYLTFGDNIVGNIITLYPRTASS-TIGRLAI 276

Query: 362 GFNMLTTFPLEIFVLRDVVRDLL-YFQSADS----------------------------- 391
            F ++  FPL+    R  +  +  Y Q  +S                             
Sbjct: 277 VFLVMLAFPLQCHPCRASIHHIWHYIQEKNSNEIATQPINVPPDEEDTLLAVELIEEDSP 336

Query: 392 ---ESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTAS 435
              E I L  K   I+T  ++  S +++++  +L  +L +VG+T ++
Sbjct: 337 KQPEEIPLRGKRFNIITVCILLFSYTLAISVNSLAKVLAIVGATGST 383

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 3/132 (2%)

Query: 258 VEDEYK---GQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTH 314
           + D YK   G   W E +    +    SII FA V   N   I   L + ++     + +
Sbjct: 170 LTDNYKVVRGTILWFEIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIIN 229

Query: 315 ISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
            S  IS +  L  G  G+LTF   T GNI+ N+  N  ++N  +F     +L +FPL   
Sbjct: 230 RSIAISTVAFLSVGITGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFH 289

Query: 375 VLRDVVRDLLYF 386
            LR    +L+ +
Sbjct: 290 PLRIACNNLVVW 301

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 60/124 (48%)

Query: 263 KGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISML 322
           +    W +      +    SII FA     N   +   LK+ S++   ++ + S  +S  
Sbjct: 176 RNDICWWKIHDLKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTA 235

Query: 323 VCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRD 382
           + LI G  G+LTF +KT GN++ N+     +I   +FC G  ++ +FPL    LR  V +
Sbjct: 236 LFLIVGLSGYLTFGNKTLGNLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLRIAVNN 295

Query: 383 LLYF 386
           ++ +
Sbjct: 296 VIIW 299

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 82/208 (39%), Gaps = 18/208 (8%)

Query: 190 DSIPHVLKAFFPSHSELF-RRNVVISVVTLFISYPLSL--NRNXXXXXXXXXXXXXXXXX 246
           D +P +L  F  + +E F  RNV I++V LFI  PL    N N                 
Sbjct: 104 DVMPQILGTF--TDTEFFLNRNVNITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLC 161

Query: 247 XXXXXXXRAPKVE-DEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPS 305
                    P  E  + +G  +W            + I  FA  CHHN     FS+ N  
Sbjct: 162 FLVMFHFFIPNEEIRDTRGPVSWGFPKDGLNPLNTLPIFVFAYTCHHN----MFSVINEQ 217

Query: 306 LK-RFGNLTHISCIISMLVC----LIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFC 360
               F  L  I CI +ML+     +I G  G+LTF +   GNI+  + SN       R  
Sbjct: 218 QDIHFNKLKQI-CIFAMLLACTLYIIIGGSGYLTFGNAITGNIITLY-SNSAATTVGRIA 275

Query: 361 FGFNMLTTFPLEIFVLRDVVRDLL-YFQ 387
               ++  FPL+    R  +  +L YFQ
Sbjct: 276 IVILVMLAFPLQCHPARASINHILHYFQ 303

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 69/144 (47%), Gaps = 11/144 (7%)

Query: 257 KVEDEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHI- 315
           ++ +  K   +W +      +    SII FA     N   +   LK+ S+   GN+T + 
Sbjct: 170 ELTEVLKNDVSWWKIHDFKGLLSTFSIIIFAYTGSMNLFPMINELKDNSM---GNITLVI 226

Query: 316 --SCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEI 373
             S  +S  + LI G  G+LTF + T GN++ N+  N  +I   +FC G  ++ +FPL  
Sbjct: 227 NNSISLSTALFLIVGLSGYLTFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLILSFPLLF 286

Query: 374 FVLRDVVRDLLY-----FQSADSE 392
             LR  V +++      F +AD E
Sbjct: 287 QPLRVAVNNVIIWIEITFGNADPE 310

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 258 VEDEYK---GQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTH 314
           + D+YK   G   W + +    +    SII FA  C  N   I   L + S+     + +
Sbjct: 169 LHDDYKYTRGDVFWVKVYDYNGLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKVAN 228

Query: 315 ISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPL 371
            S  I+  + L  G  G+LTF     GNI+ N+  +  +    +FC G  ++ +FPL
Sbjct: 229 SSIGIATFLILSVGITGYLTFGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPL 285

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 60/113 (53%), Gaps = 4/113 (3%)

Query: 278 FQGI----SIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFL 333
           F+G+    SII FA     N   +   LK+ S++    + + S  +S  + LI G  G+L
Sbjct: 187 FKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYL 246

Query: 334 TFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYF 386
           TF ++T GN++ N+  N  +I   +FC G  ++ +FPL    LR  V +++ +
Sbjct: 247 TFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVIIW 299

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 81/189 (42%), Gaps = 31/189 (16%)

Query: 278 FQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKD 337
           F+ + I  FA  CHHN   +    K+   KR   +  I+  I+ ++ LI G +G+ TF  
Sbjct: 187 FKTLPIFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLIAISIACILYLIVGCLGYATFGA 246

Query: 338 KTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYF----------- 386
               NI+  +P+N       +      +   +PL+    R  + ++LY            
Sbjct: 247 NITSNIVAKYPTNSVLTVLGQTAMLTVVTLAYPLQCQPARASILNILYALFPKLKNNKSD 306

Query: 387 ------------------QSADSESIIL--TTKEHFIVTSVLVFISMSISLTTCNLGALL 426
                             Q ++ E II   +   H IVTS+++F S  I+++  +L  +L
Sbjct: 307 VEEASMNDGYQVDLEENKQQSEPERIISEPSIILHSIVTSLILFGSWCIAVSVNSLAQVL 366

Query: 427 ELVGSTTAS 435
            +VG+T ++
Sbjct: 367 AIVGATGST 375

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 66/156 (42%), Gaps = 12/156 (7%)

Query: 260 DEY---KGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHIS 316
           D Y   +G  +W   +    +    +I+ FA     N   I   LK+ S+     +   +
Sbjct: 173 DNYTAIRGDVSWIRVYDFKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNINKVVSTT 232

Query: 317 CIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVL 376
             IS  + L  G  G+LTF   T GNI+ N+  N  +    + C G  ++ +FPL +   
Sbjct: 233 ITISSFLFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSFPLLLHPC 292

Query: 377 RDVVRDLL------YFQSADSESIILTTKEHFIVTS 406
           R    +++      Y + AD +   +   +H  VTS
Sbjct: 293 RIAANNMVHWTIINYGKCADHQ---IARNQHTHVTS 325

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 71/187 (37%), Gaps = 10/187 (5%)

Query: 206 LFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRAPKVE---DEY 262
           L  R+  I++V +F+  PL L +                              +   ++ 
Sbjct: 120 LLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIHLVSSDGDIEQM 179

Query: 263 KGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISML 322
           KG  +       P     + I  FA  CHHN   +F  +      RF    +I  I + L
Sbjct: 180 KGHVSIGLPHHGPSPLTTLPIFVFAYTCHHN---MFSVINEQKDNRFKTTKYIPLISTSL 236

Query: 323 VC---LIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDV 379
            C   ++ G  G++TF DK  GNI+  +P + + I   R      +   FPL+    R  
Sbjct: 237 ACILYILIGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAFPLQCHPARSS 295

Query: 380 VRDLLYF 386
           + ++L F
Sbjct: 296 IHNILAF 302

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 89/218 (40%), Gaps = 17/218 (7%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNR--NXXXXXXXXXXXXXXXXXX 247
           D +P ++  +  +++ L  RNV IS++ LF   PL   +  N                  
Sbjct: 104 DLMPQIMSVW-TNNAWLLSRNVQISLIMLFFVTPLCFLKKLNSLRYASMIAISSVAYLCA 162

Query: 248 XXXXXXRAPKVED--EYKGQFTWEEAFITPR-----VFQGISIISFALVCHHNTSFIFFS 300
                  AP  ED    +GQ ++   F  P+     V   + I  FA  CHHN   I   
Sbjct: 163 LVLVHYIAPS-EDILRLRGQISY---FFPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINE 218

Query: 301 LKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFC 360
            ++   +    +  I+  +++++ +  G  G+LTF D   GNI+  +P   +     R  
Sbjct: 219 QRSSRFEHIMKIPLIAVSLALILYIAIGCTGYLTFGDNIIGNIIMLYPQTVSS-TVGRIA 277

Query: 361 FGFNMLTTFPLEIFVLRDVVRDLLYFQSADSESIILTT 398
               ++  FPL+    R  +  +L  Q  + E+I  +T
Sbjct: 278 IVLLVMLAFPLQCHPARASIHQIL--QHLERENITTST 313

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 88/220 (40%), Gaps = 13/220 (5%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXX 249
           D +P ++ + +  ++ L  RNV IS++ LF   PLS  +                     
Sbjct: 104 DLMPQIM-SVWTRNAWLLNRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCV 162

Query: 250 XXXXRAPKVEDE---YKGQFTWEEAFITPR-----VFQGISIISFALVCHHNTSFIFFSL 301
                     DE    KG+ ++    + P+     V   + I  FA  CHHN   I    
Sbjct: 163 LVLLHYVAPSDEILRLKGRISY---LLPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQ 219

Query: 302 KNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCF 361
           ++   +    +  I+  +++++ +  G  G+LTF D   GNI+  +P   +     R   
Sbjct: 220 RSSRFEHVMKIPLIAISLALILYIAIGCAGYLTFGDNIIGNIIMLYPQAVSS-TIGRIAI 278

Query: 362 GFNMLTTFPLEIFVLRDVVRDLLYFQSADSESIILTTKEH 401
              ++  FPL+    R  +  +L   + ++ SI  T+ + 
Sbjct: 279 VLLVMLAFPLQCHPARASIHQILQHFAEENVSISATSADE 318

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 55/126 (43%)

Query: 261 EYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIIS 320
           E++G  +W   +    +    +II FA     N   I   LK+ S++    +   S   S
Sbjct: 174 EFRGDVSWIGVYDKKGLVSTFTIIVFAFTASMNLFSIINELKDNSMQNINKVITSSISTS 233

Query: 321 MLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVV 380
             + L  G  G+LTF     GNI+ N+     +    + C G  ++ +FPL +   R   
Sbjct: 234 AALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPLLLHPCRIAA 293

Query: 381 RDLLYF 386
            +++++
Sbjct: 294 NNMMHW 299

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 48/95 (50%)

Query: 277 VFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFK 336
           V    SII FA     N   I   LK  S+     + + S ++S    +I G  G+LTF 
Sbjct: 183 VLTTFSIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACFIILGLFGYLTFG 242

Query: 337 DKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPL 371
            +T GN++ N+ ++   + FARF  G  ++ +FPL
Sbjct: 243 KETLGNVILNYDADKLSVRFARFNLGLMVVLSFPL 277

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 78/208 (37%), Gaps = 6/208 (2%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXX 249
           D  P +   F  +H  L  RNV I+++ LFI  PL   +                     
Sbjct: 104 DLTPQIASVFTSNH-LLLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCV 162

Query: 250 XXXXR--APKVE-DEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSL 306
                   P  E  + KG  +             + I  FA  CHHN   +    K+ S 
Sbjct: 163 LIFIHFVWPSEEIHDLKGHVSLWIPHDETNPLTTLPIFVFAYTCHHNMFSVINEQKDTSF 222

Query: 307 KRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNML 366
           +    +   +  +++ + L+ G +G+LTF D   GNI+  +P   +     R      ++
Sbjct: 223 RHIKKVAIYAMFLALSLYLLIGGMGYLTFGDHIIGNIIKLYPQFAS-TTVGRIAIVLLVM 281

Query: 367 TTFPLEIFVLRDVVRDLL-YFQSADSES 393
             FPL+    R  +  +L Y Q   S+S
Sbjct: 282 LAFPLQCHPARASINHILFYLQEHLSQS 309

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 81/210 (38%), Gaps = 8/210 (3%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXX 249
           D +P ++ ++   ++ L  RNV IS++ LF   PLS  +                     
Sbjct: 104 DLMPQIMSSW-TGNAWLLSRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCV 162

Query: 250 XXXXRAPKVEDE---YKGQFTW--EEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNP 304
                     DE    KG+ ++   +          + I  FA  CHHN   I    K+ 
Sbjct: 163 LVLVHYVVPSDEILRLKGRVSYLFPQQSHDLNFLNTLPIFVFAYTCHHNMFSIINEQKSV 222

Query: 305 SLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFN 364
             +    +  IS  +++ + +  G  G+LTF D   GNI+  +P   +     R      
Sbjct: 223 RFEHVMKIPLISISLALALYIAIGCAGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLL 281

Query: 365 MLTTFPLEIFVLRDVVRDLL-YFQSADSES 393
           ++  FPL+    R  +  +L YF   ++ +
Sbjct: 282 VMLAFPLQCHPARASIHQILQYFTEENATT 311

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 71/191 (37%), Gaps = 12/191 (6%)

Query: 203 HSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXXXXXXRAPKVEDEY 262
           H     R + IS+V +F+  PL   ++                              +  
Sbjct: 128 HHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMIAIVSVAYLCGLIIFHFLYRSELE 187

Query: 263 KGQFTWEEAFITPRV-------FQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHI 315
           +GQ      F+TP            + I  FA  CHHN   +     + S K    +  +
Sbjct: 188 RGQVY----FMTPHQDAQSHSPLTTLPIFVFAYTCHHNMFSVINEQADKSFKILRRIPIL 243

Query: 316 SCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFV 375
           +  ++ ++ ++ G  G++TF D   GNI+  +P N  +    R      +   FPL+   
Sbjct: 244 AISLAYVLYVVIGGTGYMTFGDNIVGNIITLYP-NSIYTTIGRLAMLLLVTLAFPLQCHP 302

Query: 376 LRDVVRDLLYF 386
            R  +++++ F
Sbjct: 303 CRSSIKNMIVF 313

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 85/204 (41%), Gaps = 15/204 (7%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNR--NXXXXXXXXXXXXXXXXXX 247
           D +P ++ + +  ++ L  RNV IS++ +F+  PLS  +  N                  
Sbjct: 104 DLMPQIM-SVWTRNAWLLSRNVQISLIMVFLVAPLSFLKKLNSLRYASMIAISSVAYLCV 162

Query: 248 XXXXXXRAPKVEDEY-KGQFTWEEAFITPRVFQGISIIS------FALVCHHNTSFIFFS 300
                  AP  E  + KG+ ++      P+    ++I++      FA  CHHN   I   
Sbjct: 163 LVLVHYIAPSEEILHMKGRISY----FFPKQSHDLNILNTFPIFVFAYTCHHNMFSIINE 218

Query: 301 LKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFC 360
            ++   +    +  I+  +++++ +  G  G+LTF D   GNI+  +P   +     R  
Sbjct: 219 QRSSRFEHVMKIPLIAISLALILYVAIGCAGYLTFGDNIIGNIIMLYPQTTSS-TVGRVA 277

Query: 361 FGFNMLTTFPLEIFVLRDVVRDLL 384
               ++  FPL+    R  +  +L
Sbjct: 278 IVLLVMLAFPLQCHPARASIHQIL 301

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 77/200 (38%), Gaps = 6/200 (3%)

Query: 190 DSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXXXXXX 249
           D +P +   F  SH  L  RN  I+VV +FI  PL   +                     
Sbjct: 146 DLLPQIFSNF-TSHEILLERNFHITVVMIFIVAPLCFMKRLDSLRYASMIAISAVGYLCV 204

Query: 250 XXXXRA--PKVE-DEYKGQFT-WEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPS 305
                   P  E  + KG  + +    +   +     I  FA  CHHNT  I   LK+ S
Sbjct: 205 LVVAHFLFPSQEIKDLKGTVSLFRPKGLHTSMLSSFPIFVFAYTCHHNTFSIVNELKDNS 264

Query: 306 LKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNM 365
           ++    +   +  +++ + +  G  G+ TF D   GNI+  +P + +     R      +
Sbjct: 265 VENVRKVVIGAMGLAVCLYIAIGGSGYGTFGDNIGGNIIMLYPHSTS-TTVGRIAIVLLV 323

Query: 366 LTTFPLEIFVLRDVVRDLLY 385
           +  FPL+    R  +  +++
Sbjct: 324 MLAFPLQCHPARASINHIIH 343

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 278 FQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVC---LIAGYVGFLT 334
           F+ + I  FA  CHHN   +F  L   S   F  L +I      + C   LI G  G++T
Sbjct: 190 FKTLPIFVFAYTCHHN---MFAVLNEQSTNEFSKLKYIPLTAISIACIMYLIVGTFGYVT 246

Query: 335 FKDKTKGNILNNFPSND 351
           F      NI+  +P+N 
Sbjct: 247 FGSNITSNIVAQYPTNS 263

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 2/109 (1%)

Query: 283 IISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGN 342
           I  FA  CHHN   I   L++ SL     +  I+  +++ +  + G  G+LTF D   GN
Sbjct: 201 IFVFAYTCHHNMFSIVNELRDNSLTNCVRVVLIAMGLAVSLYTVIGGSGYLTFGDNITGN 260

Query: 343 ILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLL-YFQSAD 390
           I+  +P + +    AR      ++  FPL+    R  + ++  YF  + 
Sbjct: 261 IVTIYPRSVS-STLARIAIVLLVMLAFPLQCHPARASINNIWCYFSESK 308

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 77/208 (37%), Gaps = 16/208 (7%)

Query: 190 DSIPHVLKAFFPSHSELFR----RNVVISVVTLFISYPLSLNRNXXXXXXXXXXXXXXXX 245
           D +P +L    P           RN  I+++ L I  PL   +N                
Sbjct: 113 DLMPQILSHLIPESHSTSSLLLSRNFHITIMMLCIVSPLCFMKNLSSLRYASMVAISSVV 172

Query: 246 XXXXXXXXR--APKVE-DEYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLK 302
                      +P  E  + KG+ ++      P     + I  FA  CHHN     FS+ 
Sbjct: 173 YLCVLVVFHFLSPSQEIKDLKGELSYWLPNNEPSPLVTLPIFVFAYTCHHN----MFSVI 228

Query: 303 NPSLKR-FGNLTHISCIISML---VCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFAR 358
           N  +   F N+  ++ I   L   + +I G  G+ TF D   GNI+  +P + +     R
Sbjct: 229 NEQIDNSFHNIKKLAIIAMSLAFSLYIIIGGSGYYTFGDNIVGNIITLYPQSVSS-TIGR 287

Query: 359 FCFGFNMLTTFPLEIFVLRDVVRDLLYF 386
               F +   FPL+    R  +  ++ +
Sbjct: 288 MAIVFLVTLAFPLQCHPARASIHHIILY 315

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S++NP  ++F  +  +  ++   + ++ G +G+LTF       IL++F   + F++ A+ 
Sbjct: 343 SMRNP--EKFPLVLSLVLLVCTAIFMLIGTLGYLTFGKDITPVILSSFNQKNKFVSIAQL 400

Query: 360 CFGFNMLTTFPLEIFVLRDVVRDLLYFQSADSESIILTTKE 400
           C+   +L + P+++F +  +V + ++ ++ ++ +I  T+ E
Sbjct: 401 CYSIAILLSTPIQLFPVYKMVEEAIFKKNKNNTAISSTSSE 441

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+++PS  +F  +  +  I + ++ +I   +G+L++   T+  IL NFP  +  +N  + 
Sbjct: 482 SMRDPS--KFPLVLGLVMICTTVMFIIIATIGYLSYGSSTETIILQNFPQKNIVVNLIQL 539

Query: 360 CFGFNMLTTFPLEIFVLRDVVRDLLY 385
            +   +L + PL+IF   ++V D ++
Sbjct: 540 FYALAILLSTPLQIFPAIEIVEDKIF 565

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 1/106 (0%)

Query: 281 ISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTK 340
           + I  FA  CHHN   +     + S K    +   + +++  + +I G  G++TF +   
Sbjct: 209 LPIFVFAYTCHHNMFSVINEQVDKSFKVIRRIPIFAIVLAYFLYIIIGGTGYMTFGENIV 268

Query: 341 GNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYF 386
           GNIL  +P N       R      ++  FPL+    R  V++++ F
Sbjct: 269 GNILTLYP-NSISTTIGRLAMLLLVMLAFPLQCHPCRSSVKNIIIF 313

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 1/104 (0%)

Query: 283 IISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGN 342
           I  FA  CHHN   I   L++ SL     +   +  +++ +    G  G+LTF D   GN
Sbjct: 201 IFVFAYTCHHNMFSIVNELRDNSLGACLRVVVAAIALAVALYATIGGAGYLTFGDHITGN 260

Query: 343 ILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYF 386
           I+  +P         R      ++  FPL+    R  +  + ++
Sbjct: 261 IIAQYPPAPA-TTLGRAAIAVLVMLAFPLQCHPARASINHIWHY 303

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 9/110 (8%)

Query: 281 ISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLI----AGYVGFLTFK 336
           + I  FA  CHHN   +F  +      RF ++  I+ II+ML+ L+     G  G+ TF 
Sbjct: 201 LPIFVFAYTCHHN---VFAVINEQKKTRFAHVKVIA-IIAMLLALVLYVLIGGAGYFTFG 256

Query: 337 DKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYF 386
           +   GNI+  +P +       R    F +   FPL+    R  +  ++ +
Sbjct: 257 NHIVGNIITLYPHSITS-TIGRVAIVFLVTLAFPLQCHPARASIHHIICY 305

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 43/109 (39%)

Query: 263 KGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISML 322
           +G+  W        +    SII FA     N   I   L + S++    + + S   S  
Sbjct: 175 RGEVRWLRPASLREMVSTFSIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTA 234

Query: 323 VCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPL 371
           + ++ G  G+LTF      N++ NF  +           G  +L +FPL
Sbjct: 235 LFILVGMAGYLTFGSNVAQNVILNFDPDAVSTQVGSLALGLMVLLSFPL 283

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/214 (19%), Positives = 75/214 (35%), Gaps = 22/214 (10%)

Query: 190 DSIPHVLKAFF----------PSHSELFRRNVVISVVTLFISYPLSLNRNXXXXXXXXXX 239
           D +P ++++ F            H  L  R + I++V +F+  PL   R+          
Sbjct: 105 DLVPQIVQSIFYHNDDSTGGLQEHHRLLDRRLYITLVMMFVIAPLCFKRSLNSLRYASMI 164

Query: 240 XXXXXXXXXXXXXXRAPKVEDEYKGQFTWEEAFITPRV-------FQGISIISFALVCHH 292
                                  +GQ      F+ P            + I  FA  CHH
Sbjct: 165 AIISVAYLSGLIIYHFLNRHQLERGQV----YFMVPHRDSSSHSPLTTLPIFVFAYTCHH 220

Query: 293 NTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDN 352
           N   +     + + +    +   +   + ++ LI G  G++TF +   GNIL  +P N  
Sbjct: 221 NMFSVINEQTDKTFRILRRIPIFAISFAYILYLIIGGAGYMTFGENIVGNILTLYP-NSI 279

Query: 353 FINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYF 386
                R      ++  FPL+    R  ++++  F
Sbjct: 280 STTIGRLAMLLLVMLAFPLQCHPCRSSIKNIFIF 313

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 1/116 (0%)

Query: 263 KGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISML 322
           +G   W   +    +    +II FA     N   I   L    +     + + S  IS +
Sbjct: 180 RGSINWVSIYDFNGLLSTFTIIIFAYTGSMNLFTIINELNYNDIDSIKIVINHSIAISTI 239

Query: 323 VCLIAGYVGFLTFKDKTKGNILNNFP-SNDNFINFARFCFGFNMLTTFPLEIFVLR 377
           + LI    G+LTF   T GNI+ N+  SN  +I   +   G  ++ TFPL    LR
Sbjct: 240 IFLIISIFGYLTFGTLTLGNIMLNYNYSNSLYIILGKLALGIMVILTFPLLFHPLR 295

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 46/111 (41%)

Query: 261 EYKGQFTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIIS 320
           E++G  +W        +    SII  A     N   +   LK+ S      + + S  IS
Sbjct: 174 EHRGDVSWLHIHSVGELVSTFSIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSVGIS 233

Query: 321 MLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPL 371
            L+ L  G  G+LTF +    N++ N+  +        F  G  ++ +FPL
Sbjct: 234 TLIFLSVGLGGYLTFGNNVLTNVILNYDESAITTRIGTFSLGTMVILSFPL 284

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 46/104 (44%), Gaps = 1/104 (0%)

Query: 283 IISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGN 342
           I  FA  CHHN   +     +   +    +  I+  ++ ++ +I G  G++TF     GN
Sbjct: 211 IFVFAYTCHHNMFSVINEQADKGFRILKRIPIIAISLAFVLYVIIGGAGYMTFGKNIVGN 270

Query: 343 ILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYF 386
           IL  +P N       R      ++  FPL+    R  +++++ F
Sbjct: 271 ILTLYP-NSVSTTIGRLAMLLLVMLAFPLQCHPCRSSIKNIIIF 313

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/121 (19%), Positives = 60/121 (49%), Gaps = 2/121 (1%)

Query: 312 LTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPL 371
           L+ + CI++ ++ +  G + +  F +K +  +L NFP +  F    +  +   +L + PL
Sbjct: 544 LSLVMCIVT-IIFISCGLICYSAFGEKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPL 602

Query: 372 EIFVLRDVVRDLLY-FQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVG 430
           ++F    ++ +  +   ++   +  +  K+++    +++F +M   +   +L   + LVG
Sbjct: 603 QLFPAIKILENWTFPIHASGKHNSRIKWKKNYFRCIMVIFTAMVAWVGANDLDKFVSLVG 662

Query: 431 S 431
           S
Sbjct: 663 S 663

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 322 LVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVR 381
           ++ ++ G  G+L++ +K K  IL +F     F+N    CF   +L + PL++F L  ++ 
Sbjct: 252 IIFILIGTCGYLSYGEKIKVIILQSFAPGI-FVNIIIVCFTIGILLSTPLQLFSLTSLLE 310

Query: 382 DLLY 385
           D L+
Sbjct: 311 DFLF 314

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+K+P  ++F  +  +  I + ++ +  G +G+L++  KT+  IL N P  +  +N  +F
Sbjct: 513 SMKHP--EKFPLVLALVIISATVLFVTVGTLGYLSYGAKTETVILLNLPQGNILVNLIQF 570

Query: 360 CFGFNMLTTFPLEIF 374
            +   +L + PL++F
Sbjct: 571 FYSSAILLSTPLQLF 585

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 318 IISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLR 377
           ++  ++ +  G + +  F  K +  IL NFPSN  F N  +  +   +L + PL++F   
Sbjct: 406 LVVTIIFISCGLICYSAFGAKVETVILLNFPSNSIFTNAVQLIYALAILLSTPLQLFPAI 465

Query: 378 DVVRDLLYFQSADS--ESIILTTKEHFIVTSVLVFISMSISLTTCN-LGALLELVGS 431
            ++ + ++ ++A    ++ +   K +F   + +V I++ I+    N L   + L+GS
Sbjct: 466 KILENKIFHKNASGKFDAKVKWRKNYF--RAFVVLIAVIIAWIGANDLDKFVSLIGS 520

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 8/102 (7%)

Query: 275 PRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGN--LTHISCIISMLVCLIAGYVGF 332
           PR+  G+ ++ F   CH N        +   LK      LT+++   +  VCLI G  G+
Sbjct: 188 PRLL-GLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAA--VCLICGITGY 244

Query: 333 LTFKDKTK---GNILNNFPSNDNFINFARFCFGFNMLTTFPL 371
           LTF   T+    N+L  +P         R     ++  +FPL
Sbjct: 245 LTFHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPL 286

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/133 (19%), Positives = 63/133 (47%), Gaps = 3/133 (2%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+K+P    F     +  +I  LV +  G +G+  F       +L NFP ++   +  + 
Sbjct: 336 SMKSP--HHFKKSLILVLVIITLVFITIGLLGYSAFGSNVDTVLLQNFPQDNPCTSLVQL 393

Query: 360 CFGFNMLTTFPLEIFVLRDVVRDLLYFQSADSE-SIILTTKEHFIVTSVLVFISMSISLT 418
            +   +L + PL++F    ++ + ++ + A  + +  +   +++  +++++  S+   L 
Sbjct: 394 LYSLAILLSTPLQLFPAIKILENWIFSKDASGKYNHSIKWAKNYFRSTIVILTSLISYLG 453

Query: 419 TCNLGALLELVGS 431
             +L   + LVGS
Sbjct: 454 ANDLNKFVALVGS 466

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+++P  ++F  +  +  I S ++ +  G +G+L +  K K  IL N P  +  +N  +F
Sbjct: 513 SMRHP--EKFPLVLGMVIITSTVLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQF 570

Query: 360 CFGFNMLTTFPLEIF 374
            +   ++ + PL++F
Sbjct: 571 FYSLAIMLSTPLQLF 585

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+K+P  ++F  +  +  I + ++ +    +G+L++  +T+  IL N P +   +N  +F
Sbjct: 511 SMKHP--EKFPLVMALVIITATVLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLIQF 568

Query: 360 CFGFNMLTTFPLEIF 374
            +   +L + PL++F
Sbjct: 569 FYSSAILLSTPLQLF 583

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 13/138 (9%)

Query: 300 SLKNP---SLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINF 356
           S+K+P   S   FG +  +S  ++ +VC   G + +  F D  K  IL NFP +      
Sbjct: 428 SMKHPEKFSKCLFGVMASVS--VAFIVC---GLLCYSAFGDSVKIVILLNFPRDSAMTAT 482

Query: 357 ARFCFGFNMLTTFPLEIFVLRDVVRDLLYFQSADSE--SIILTTKEHFIVTSVLVFISMS 414
            +  +   +L + PL++F +  ++   ++ + A  +    +   K +F V   +V ++M 
Sbjct: 483 VQLLYALAILLSTPLQLFPIIRILETSIFPKDASGKYNPRVKWMKNYFRVA--IVLLNML 540

Query: 415 ISLTTCN-LGALLELVGS 431
           I+    N L   + LVGS
Sbjct: 541 IAWLGANDLDKFVSLVGS 558

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 68/139 (48%), Gaps = 15/139 (10%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+K+P+  R  +L+ + CI+++ V +  G + +  F    K  +L NFP + ++    + 
Sbjct: 494 SMKHPNHFR-PSLSAVMCIVAV-VFISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTVQL 551

Query: 360 CFGFNMLTTFPLEIFVLRDVVRDLLYFQSADSES--IILTTKEHF-----IVTSVLVFIS 412
            +   +L + PL++F    ++ +  +  +A  +    +   K +F     ++TSVL ++ 
Sbjct: 552 LYALAILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVVLTSVLAWVG 611

Query: 413 MSISLTTCNLGALLELVGS 431
            +      +L   + LVGS
Sbjct: 612 AN------DLDKFVSLVGS 624

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 59/127 (46%), Gaps = 11/127 (8%)

Query: 314 HISCIISMLVCLI------AGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLT 367
           H S  +SM++C++       G + +  F  K +  +L NFP +  +    +  +   +L 
Sbjct: 489 HFSKCLSMVMCIVTVIFISCGLLCYSAFGSKVETVVLLNFPHDSPYTLMVQLLYALAILL 548

Query: 368 TFPLEIFVLRDVVRDLLYFQSADSES--IILTTKEHFIVTSVLVFISMSISLTTCN-LGA 424
           + PL++F    ++ +  +  SA  ++   +   K +F    ++V ++  I+    N L  
Sbjct: 549 STPLQLFPAIKILENWCFPISASGKNNPKVKWLKNYF--RCIIVLLTAFIAYVGANDLDK 606

Query: 425 LLELVGS 431
            + LVGS
Sbjct: 607 FVSLVGS 613

>YCR068W Chr3 (237214..238776) [1563 bp, 520 aa] {ON}  ATG15Lipase
           required for intravacuolar lysis of autophagic bodies
           and Cvt bodies; targeted to intravacuolar vesicles
           during autophagy via the multivesicular body (MVB)
           pathway
          Length = 520

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 302 KNPSLKRFGNLTHISCIISMLV-CLIAGY 329
           K+PS KRF +  H+ CI+++ V CLIA Y
Sbjct: 4   KSPSRKRFASPLHLGCILTLTVLCLIAYY 32

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 68/139 (48%), Gaps = 15/139 (10%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+++P+  R  +L+ + CI+++ V +  G + +  F    K  +L NFP N ++    + 
Sbjct: 526 SMRHPNHFR-PSLSAVMCIVAV-VFISCGLLCYAAFGADVKTVVLLNFPQNSSYTLTVQL 583

Query: 360 CFGFNMLTTFPLEIFVLRDVVRDLLYFQSADSES--IILTTKEHF-----IVTSVLVFIS 412
            +   +L + PL++F    ++ +  +  +A  +    +   K +F     ++TS+L ++ 
Sbjct: 584 LYALAILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVLLTSILAWVG 643

Query: 413 MSISLTTCNLGALLELVGS 431
            +      +L   + LVGS
Sbjct: 644 AN------DLDKFVSLVGS 656

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 330 VGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
           +G+L F    +  IL N P ++ F+N  +F +   +L + PL++F
Sbjct: 543 LGYLAFGRYIETVILLNLPQDNIFVNLVQFFYSLAILLSTPLQLF 587

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/133 (19%), Positives = 66/133 (49%), Gaps = 3/133 (2%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+K+P   R  +L+ + CI+++ + +  G + +  F    K  +L NFP + ++    + 
Sbjct: 506 SMKHPKHFR-PSLSAVMCIVAV-IFISCGLLCYAAFGSDVKTVVLLNFPQDTSYTLTVQL 563

Query: 360 CFGFNMLTTFPLEIFVLRDVVRDLLYFQSADSE-SIILTTKEHFIVTSVLVFISMSISLT 418
            +   +L + PL++F    ++ +  +  +A  + +  +   +++   +++V  S+   + 
Sbjct: 564 LYALAILLSTPLQLFPAIRILENWTFPSNASGKYNPKVKWLKNYFRCAIVVLTSILAWVG 623

Query: 419 TCNLGALLELVGS 431
             +L   + LVGS
Sbjct: 624 ANDLDKFVSLVGS 636

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 40/97 (41%), Gaps = 1/97 (1%)

Query: 76  DPNVSQLTNPN-RGKSNMYMAFMNMANSILGAGVIGQPFAIKNXXXXXXXXXXXXXXXXX 134
           DP   Q    + R K++ + AF+ M  S +G GV+  P A  N                 
Sbjct: 284 DPEQQQQVPAHLRVKTSTFKAFLLMIKSFIGTGVLFLPNAFSNGGLAFSISMLFFFSAYS 343

Query: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILF 171
            W   ++V +   TG +++ D      G+  K +ILF
Sbjct: 344 YWCYYILVRSKDATGVSSFGDIGGILFGSWMKFIILF 380

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+KNP  ++F  +  +  I + ++ +    +G+L++       IL N P ++ F+N  + 
Sbjct: 499 SMKNP--EKFPLVLGLVLITATILFISIATIGYLSYGSSIDVVILLNLPQSNIFVNLIQL 556

Query: 360 CFGFNMLTTFPLEIFVLRDVVRDLLY 385
            +   ++ + PL++F    ++   L+
Sbjct: 557 FYSLAIMLSTPLQMFPAIKIIESKLF 582

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/58 (20%), Positives = 32/58 (55%)

Query: 330 VGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYFQ 387
           VG+L +  + +  +L N P  + F+N  +F +   ++ + PL++F    ++   ++++
Sbjct: 537 VGYLAYGSEIQTVVLLNLPQGNLFVNLIQFLYSLAIMLSTPLQLFPAIKILEGKVFYR 594

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/96 (20%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 300 SLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARF 359
           S+K+P  + F  +  +  + + ++ ++ G +G+L +    +  IL N   ++ F+N  + 
Sbjct: 549 SMKHP--EHFPFVLFLVILTATVLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLVQL 606

Query: 360 CFGFNMLTTFPLEIFVLRDVVRDLLY--FQSADSES 393
            +   +L + PL++F    ++ + ++  F+S D+ S
Sbjct: 607 FYSVAILLSTPLQLFPAIKIIENRMFTSFRSTDNGS 642

>CAGL0L01991g Chr12 (231837..234998) [3162 bp, 1053 aa] {ON} similar
           to uniprot|P36097 Saccharomyces cerevisiae YKL033w
          Length = 1053

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 10/94 (10%)

Query: 276 RVFQGISIISFALVCHHN------TSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGY 329
           R F   S I  A + +HN      T    + +   S+K    +T    ++ M++C +AGY
Sbjct: 639 REFSKRSAIVLAKILYHNSISDMITQNTDYIIDAVSIKLASGMTQRVSVVLMVICKLAGY 698

Query: 330 VGFLTFKDKTKGNILNNFPSNDNFINFARFCFGF 363
               +FKD     I   F   D +  ++  C  F
Sbjct: 699 EAIRSFKDV----IETLFKMLDFYHGYSDLCIQF 728

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 25/45 (55%)

Query: 330 VGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIF 374
           +G+L +    +  IL N P  + F+N  +F +   ++ + PL++F
Sbjct: 537 IGYLAYGSAIETVILLNLPQKNVFVNLIQFFYSLAIMLSTPLQLF 581

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,191,191
Number of extensions: 1428157
Number of successful extensions: 5054
Number of sequences better than 10.0: 106
Number of HSP's gapped: 5044
Number of HSP's successfully gapped: 110
Length of query: 495
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 381
Effective length of database: 40,409,475
Effective search space: 15396009975
Effective search space used: 15396009975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)