Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10581.52ON116456229070.0
AFR696C1.52ON114256324910.0
KLLA0C01650g1.52ON111256721140.0
KLTH0F01672g1.52ON116457020690.0
SAKL0C01716g1.52ON121560120480.0
Kpol_2002.461.52ON112359419300.0
TDEL0C064901.52ON115358919140.0
KAFR0D041001.52ON111757119060.0
Suva_2.6871.52ON112857718900.0
NCAS0B086001.52ON111759218540.0
Smik_4.7891.52ON113658518520.0
TPHA0E036401.52ON113761218410.0
KNAG0F002901.52ON112558618380.0
Skud_4.7831.52ON113557718380.0
YDR507C (GIN4)1.52ON114258718360.0
ZYRO0F17402g1.52ON118959418350.0
CAGL0K05709g1.52ON110359418160.0
NDAI0A006601.52ON102258118000.0
TBLA0A071501.52ON139151516400.0
Skud_3.391.52ON101754515430.0
Smik_3.541.52ON103256815270.0
Suva_3.1901.52ON102435213741e-171
Kwal_33.132251.52ON96438011351e-137
Ecym_73922.479ON143443310601e-122
KLLA0F13552g2.479ON126741810331e-120
ABL034W2.479ON142543110371e-119
SAKL0E02860g2.479ON137741610331e-119
YKL101W (HSL1)2.479ON151838710301e-118
KLTH0D05566g2.479ON112835410121e-118
Skud_11.1262.479ON151838710221e-117
Smik_11.1392.479ON153438710211e-116
Suva_11.1232.479ON152638710211e-116
TDEL0A025502.479ON136939010101e-116
TBLA0I011502.479ON174538710151e-115
KAFR0D032002.479ON144838110011e-114
NCAS0A057702.479ON146141610011e-114
KNAG0A065402.479ON143237510001e-114
Kwal_26.77882.479ON12673569921e-114
ZYRO0G03366g2.479ON16163969741e-110
Kpol_431.92.479ON15524039701e-109
CAGL0K08514g2.479ON14893839671e-109
NDAI0D027502.479ON15152988481e-93
TPHA0G032002.479ON15343168172e-89
Kwal_33.13222singletonOFF1481206302e-75
CAGL0M08910g5.611ON6122916301e-69
Kpol_1018.655.611ON6012736246e-69
TPHA0D028405.611ON6342786205e-68
Kpol_495.145.611ON6242786195e-68
KLLA0A03806g5.611ON6022796132e-67
NCAS0A080805.611ON6232786143e-67
KAFR0C058605.611ON6442736153e-67
Suva_2.6515.611ON6332786125e-67
YDR477W (SNF1)5.611ON6332896126e-67
KNAG0B032305.611ON6412736118e-67
Smik_4.7545.611ON6322786118e-67
AEL230W5.611ON6082786098e-67
TDEL0A047805.611ON6213426091e-66
TPHA0C004705.611ON6312786082e-66
TBLA0E033605.611ON6542786082e-66
Skud_4.7515.611ON6342786072e-66
NDAI0H009405.611ON6852926103e-66
Ecym_55885.611ON6132786044e-66
Kwal_47.182335.611ON5982766034e-66
SAKL0G06952g5.611ON5992765991e-65
KLTH0G05698g5.611ON5972765973e-65
ZYRO0A05544g5.611ON6312785913e-64
NDAI0J012508.279ON11763095482e-56
KNAG0J015908.654ON8053225224e-54
CAGL0M11396g8.279ON11922885286e-54
NDAI0B020708.279ON12583625243e-53
NDAI0E023208.654ON9322915184e-53
Kpol_1066.468.279ON12252835224e-53
NCAS0B037408.279ON10492885196e-53
TPHA0D011408.654ON6222905039e-53
NDAI0E012908.654ON7292935071e-52
NCAS0B050908.279ON12102935172e-52
Smik_4.3678.279ON10662835152e-52
TPHA0G017108.654ON8052885082e-52
Suva_16.1698.654ON8582945093e-52
TPHA0J008208.279ON12183155144e-52
SAKL0H07084g8.654ON9192865094e-52
TDEL0A060008.654ON7902865055e-52
ZYRO0F06842g8.654ON8432875065e-52
Kpol_1012.68.654ON6282894968e-52
Suva_2.2838.279ON10892835109e-52
KLTH0D10714g8.654ON8722875059e-52
KAFR0B028008.279ON10952865091e-51
NCAS0C015908.654ON8642915051e-51
Skud_4.3838.279ON10652835081e-51
Suva_10.1808.279ON11592885082e-51
Kwal_26.87098.654ON8292875022e-51
Skud_16.1408.654ON8652915022e-51
YDR122W (KIN1)8.279ON10642835062e-51
Smik_12.1558.279ON11622885072e-51
Smik_6.3398.654ON8652915013e-51
SAKL0H16632g8.279ON10622885053e-51
YLR096W (KIN2)8.279ON11472885054e-51
YPL141C (FRK1)8.654ON8652945004e-51
Skud_12.1648.279ON11602885046e-51
CAGL0M02299g8.668ON8932794997e-51
CAGL0J03872g8.654ON6612914909e-51
KNAG0G021108.279ON11922885029e-51
TDEL0F040608.279ON11262835029e-51
CAGL0M02519g8.654ON7563014931e-50
Smik_15.4178.654ON8062904932e-50
Kpol_1072.298.654ON8932874952e-50
KAFR0A037308.654ON7882894903e-50
TBLA0B039708.654ON12083044974e-50
TBLA0C046008.279ON13152834974e-50
NCAS0B014708.654ON7272884866e-50
Ecym_83398.654ON9202844901e-49
Ecym_42918.279ON11452954912e-49
KLTH0G13288g8.279ON11422884912e-49
KLLA0F19536g8.279ON11042884893e-49
AGR058W8.279ON10712924884e-49
KAFR0H025408.654ON8173324825e-49
ZYRO0D06776g8.279ON12042834885e-49
Skud_15.3998.654ON8072904753e-48
CAGL0B01925g8.279ON9442944783e-48
Suva_8.2848.654ON8082904753e-48
TBLA0C017508.654ON9812884784e-48
KNAG0A030408.654ON6442894676e-48
ACR119W8.654ON9312904741e-47
YOR233W (KIN4)8.654ON8002904701e-47
NCAS0C016708.668ON8962834721e-47
KNAG0H031408.279ON9362834704e-47
ZYRO0F07194g8.668ON9382994642e-46
NDAI0E023908.668ON8833134604e-46
SAKL0H06754g8.668ON8842764604e-46
Kpol_1072.198.668ON8962864579e-46
TDEL0A061408.668ON8613154523e-45
TBLA0B038608.668ON9882794518e-45
KLLA0D07348g8.654ON9092844508e-45
Kwal_26.87518.668ON8482744481e-44
KNAG0J016708.668ON10092754501e-44
KLTH0D11044g8.668ON8493474462e-44
TPHA0G016308.668ON8712764452e-44
KLLA0F11319g8.668ON8434004433e-44
KNAG0D010906.222ON3722754204e-44
ACR133C8.668ON8512774425e-44
NDAI0G053001.374ON4372744192e-43
Smik_6.3508.676ON8222884329e-43
Ecym_24058.668ON8552794311e-42
Kpol_1065.36.222ON3762714082e-42
KLTH0H11396g1.374ON4372764112e-42
Kwal_0.961.374ON4272704103e-42
YFR014C (CMK1)1.374ON4462764104e-42
Skud_16.1328.668ON9242904284e-42
YPL150W8.668ON9012874275e-42
TPHA0E028206.222ON3842614055e-42
Skud_16.1298.676ON8272884256e-42
YPL153C (RAD53)8.676ON8212884256e-42
Suva_16.1608.668ON9183014267e-42
Suva_16.1578.676ON8322934212e-41
NCAS0A088801.374ON4222744032e-41
Smik_6.3478.668ON9172774222e-41
KLTH0D11242g8.676ON7952774193e-41
Smik_7.3191.374ON4462764043e-41
TBLA0A020506.222ON4342894033e-41
TPHA0O011201.374ON4293004033e-41
NCAS0D021006.31ON7262894163e-41
KAFR0H024308.676ON7842804184e-41
SAKL0D07656g1.374ON4322714024e-41
KNAG0I014801.374ON4402744024e-41
Kwal_26.87968.676ON7962764174e-41
Kpol_1069.131.374ON4272764006e-41
Kwal_56.224766.31ON6972854137e-41
CAGL0L07326g2.352ON5063094049e-41
KNAG0J017008.676ON8202824151e-40
NDAI0E021108.676ON9032864161e-40
Skud_6.891.374ON4462763982e-40
CAGL0F04741g1.374ON4423003972e-40
CAGL0M02233g8.676ON7672934122e-40
ACL006W6.31ON7082654102e-40
CAGL0K10604g1.374ON4462813972e-40
KLTH0C10912g6.31ON6972854092e-40
Ecym_30356.31ON7402654102e-40
KLLA0F23155g1.374ON4273393953e-40
Skud_15.1441.374ON4492743954e-40
Kwal_56.240916.222ON3812603905e-40
TDEL0A062208.676ON7942804086e-40
Suva_15.1551.374ON4523003937e-40
TDEL0B063201.374ON4442843929e-40
Kpol_1037.206.31ON7042914031e-39
SAKL0E01584g6.31ON6952874021e-39
Suva_6.781.374ON4452763902e-39
TBLA0B004906.31ON7872934042e-39
Suva_13.1636.31ON7053004012e-39
KLTH0H03982g6.222ON3982633862e-39
NCAS0B044906.222ON3492593813e-39
SAKL0H06534g8.676ON8042804023e-39
TBLA0D050101.374ON4342753873e-39
AFL101C6.222ON3672863823e-39
KLLA0F11143g8.676ON8132754023e-39
Smik_15.1531.374ON4423003874e-39
KAFR0G026906.31ON7132793994e-39
KAFR0H025108.668ON8792864024e-39
KAFR0C044801.374ON4352743864e-39
KLLA0E01585g2.352ON5122943915e-39
KAFR0B054108.279ON5393063925e-39
YMR001C (CDC5)6.31ON7053003985e-39
KNAG0E008506.31ON7112983986e-39
TBLA0A020306.214ON4032863836e-39
Kwal_56.237178.279ON8581894016e-39
Ecym_12751.374ON4512723867e-39
YOL016C (CMK2)1.374ON4473003859e-39
YDL101C (DUN1)2.352ON5132943881e-38
KAFR0K003306.214ON3732683791e-38
Skud_13.1546.31ON7052673961e-38
KLLA0B02332g6.222ON3612723781e-38
TPHA0G016008.676ON8452793991e-38
TPHA0J004206.31ON7072913951e-38
NCAS0C013708.676ON7992773971e-38
Smik_13.1596.31ON7053003951e-38
AAR009W1.374ON4532693832e-38
SAKL0E05984g2.352ON5052943852e-38
Suva_4.1452.352ON5143033862e-38
TDEL0G043806.31ON7222853942e-38
TBLA0B038408.676ON8582793963e-38
ACR142W8.676ON8372843944e-38
Smik_4.1352.352ON5132953835e-38
NDAI0A009601.182ON4082523765e-38
NDAI0F016006.222ON4122613765e-38
Skud_10.501.182ON3972703756e-38
YPL203W (TPK2)6.214ON3802683746e-38
KLLA0B07205g1.182ON4552703787e-38
KLTH0H04180g6.214ON3532523718e-38
Skud_16.766.214ON3822683739e-38
Kpol_1072.168.676ON7952803901e-37
Smik_6.4086.214ON3812683721e-37
NDAI0H035201.374ON4582693761e-37
CAGL0G09020g6.214ON3612683701e-37
NCAS0D006301.374ON4273023741e-37
KAFR0F018001.182ON4242683742e-37
CAGL0J11638g6.31ON7462643872e-37
Skud_4.1542.352ON5132953792e-37
YJL164C (TPK1)1.182ON3972703712e-37
ZYRO0C07480g6.31ON7742293872e-37
KAFR0I020101.374ON4322763732e-37
ZYRO0F07370g8.676ON7622773872e-37
KAFR0G004801.182ON4002523712e-37
KLLA0C06138g6.31ON7082873852e-37
NCAS0A011006.214ON3542683673e-37
Kwal_56.240596.214ON3532523673e-37
ZYRO0E07018g6.222ON3672613673e-37
TDEL0E053106.222ON3742673683e-37
Smik_10.661.182ON3972703693e-37
Suva_16.1046.214ON3832683683e-37
KAFR0K002806.222ON3602143664e-37
Suva_6.2451.182ON3942703676e-37
NOTE: 1 genes in the same pillar as Ecym_1058 were not hit in these BLAST results
LIST: YCL024W

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1058
         (1164 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...  1124   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   964   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   818   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   801   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   793   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   748   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   741   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   738   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   732   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   718   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   717   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   713   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   712   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...   712   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   711   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   711   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   704   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    697   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   636   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   598   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   592   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   533   e-171
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   441   e-137
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   412   e-122
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   402   e-120
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   404   e-119
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   402   e-119
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   401   e-118
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   394   e-118
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   398   e-117
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   397   e-116
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   397   e-116
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   393   e-116
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   395   e-115
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   390   e-114
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   390   e-114
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   389   e-114
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   386   e-114
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   379   e-110
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   378   e-109
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   377   e-109
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   331   1e-93
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   319   2e-89
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   247   2e-75
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   247   1e-69
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   244   6e-69
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              243   5e-68
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   243   5e-68
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   240   2e-67
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   241   3e-67
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   241   3e-67
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   240   5e-67
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   240   6e-67
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   239   8e-67
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   239   8e-67
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   239   8e-67
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   239   1e-66
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   238   2e-66
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   238   2e-66
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   238   2e-66
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   239   3e-66
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   237   4e-66
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   236   4e-66
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   235   1e-65
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   234   3e-65
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   232   3e-64
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   215   2e-56
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   205   4e-54
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   207   6e-54
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             206   3e-53
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              204   4e-53
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   205   4e-53
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   204   6e-53
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   198   9e-53
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   199   1e-52
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             203   2e-52
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   202   2e-52
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   200   2e-52
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   200   3e-52
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   202   4e-52
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   200   4e-52
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   199   5e-52
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   199   5e-52
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   195   8e-52
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   201   9e-52
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   199   9e-52
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   200   1e-51
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    199   1e-51
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   200   1e-51
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   200   2e-51
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   197   2e-51
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   197   2e-51
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   199   2e-51
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   199   2e-51
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   197   3e-51
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   199   3e-51
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   199   4e-51
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   197   4e-51
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   198   6e-51
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   196   7e-51
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   193   9e-51
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   197   9e-51
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   197   9e-51
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   194   1e-50
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   194   2e-50
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   195   2e-50
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   193   3e-50
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   196   4e-50
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   196   4e-50
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    191   6e-50
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   193   1e-49
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   193   2e-49
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   193   2e-49
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   192   3e-49
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   192   4e-49
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   190   5e-49
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   192   5e-49
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   187   3e-48
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   188   3e-48
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   187   3e-48
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   188   4e-48
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   184   6e-48
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   187   1e-47
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   185   1e-47
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   186   1e-47
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   185   4e-47
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   183   2e-46
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   181   4e-46
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   181   4e-46
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   180   9e-46
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   178   3e-45
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   178   8e-45
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   177   8e-45
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   177   1e-44
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   177   1e-44
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   176   2e-44
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   176   2e-44
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   175   3e-44
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   166   4e-44
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   174   5e-44
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   166   2e-43
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   171   9e-43
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   170   1e-42
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   161   2e-42
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   162   2e-42
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   162   3e-42
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   162   4e-42
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   169   4e-42
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   169   5e-42
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   160   5e-42
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   168   6e-42
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   168   6e-42
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   168   7e-42
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   166   2e-41
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   159   2e-41
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   167   2e-41
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   166   3e-41
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   160   3e-41
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              159   3e-41
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   159   3e-41
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     164   3e-41
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   165   4e-41
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   159   4e-41
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   159   4e-41
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   165   4e-41
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   158   6e-41
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   163   7e-41
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   160   9e-41
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             164   1e-40
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   164   1e-40
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   157   2e-40
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   157   2e-40
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   163   2e-40
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   162   2e-40
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   157   2e-40
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   162   2e-40
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   162   2e-40
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   156   3e-40
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   156   4e-40
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   154   5e-40
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   161   6e-40
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   155   7e-40
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   155   9e-40
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   159   1e-39
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   159   1e-39
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   154   2e-39
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   160   2e-39
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   159   2e-39
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   153   2e-39
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    151   3e-39
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   159   3e-39
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   153   3e-39
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   151   3e-39
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   159   3e-39
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   153   4e-39
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   158   4e-39
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   159   4e-39
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   153   4e-39
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   155   5e-39
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   155   5e-39
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   157   5e-39
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   157   6e-39
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   152   6e-39
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   159   6e-39
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   153   7e-39
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   152   9e-39
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   154   1e-38
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   150   1e-38
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   157   1e-38
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   150   1e-38
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   158   1e-38
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   156   1e-38
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   157   1e-38
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   156   1e-38
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   152   2e-38
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   152   2e-38
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   153   2e-38
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   156   2e-38
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   157   3e-38
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   156   4e-38
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   152   5e-38
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   149   5e-38
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   149   5e-38
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   149   6e-38
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   148   6e-38
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   150   7e-38
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   147   8e-38
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   148   9e-38
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   154   1e-37
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   147   1e-37
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              149   1e-37
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   147   1e-37
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   148   1e-37
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   148   2e-37
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   153   2e-37
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   150   2e-37
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   147   2e-37
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   153   2e-37
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   148   2e-37
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   153   2e-37
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   147   2e-37
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   152   2e-37
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              145   3e-37
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   145   3e-37
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   145   3e-37
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   146   3e-37
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   146   3e-37
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   146   3e-37
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   145   4e-37
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   145   6e-37
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   148   6e-37
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   144   9e-37
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   145   1e-36
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              145   1e-36
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   145   1e-36
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   147   1e-36
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   148   1e-36
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   146   1e-36
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   144   2e-36
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   147   2e-36
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   146   2e-36
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   144   2e-36
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   149   3e-36
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   142   3e-36
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   150   4e-36
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   149   4e-36
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   143   4e-36
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   142   9e-36
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   145   1e-35
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   145   1e-35
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   142   1e-35
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   141   1e-35
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   141   1e-35
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              145   1e-35
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   142   2e-35
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   143   2e-35
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      142   2e-35
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   140   2e-35
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   141   2e-35
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   147   2e-35
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   140   2e-35
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   141   2e-35
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   140   3e-35
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   140   3e-35
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    140   3e-35
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   142   3e-35
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   141   3e-35
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   139   4e-35
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   140   4e-35
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   141   4e-35
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   140   4e-35
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   139   5e-35
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   142   7e-35
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   147   7e-35
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   146   8e-35
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   139   9e-35
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   142   1e-34
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   141   1e-34
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   142   2e-34
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   137   2e-34
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   138   3e-34
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   138   4e-34
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   144   4e-34
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   139   5e-34
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   137   5e-34
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   142   9e-34
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   136   1e-33
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   142   1e-33
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   137   1e-33
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   138   2e-33
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   141   2e-33
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   138   2e-33
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   142   2e-33
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   141   2e-33
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   135   3e-33
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   141   3e-33
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   137   3e-33
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             139   3e-33
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   139   9e-33
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   137   9e-33
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   140   9e-33
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   137   1e-32
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   137   1e-32
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   139   1e-32
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   137   2e-32
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   132   2e-32
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   137   2e-32
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   134   2e-32
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   135   2e-32
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   138   2e-32
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    137   2e-32
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   138   3e-32
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   137   3e-32
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   136   4e-32
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   137   4e-32
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   135   5e-32
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   133   7e-32
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   135   7e-32
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   137   8e-32
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   137   8e-32
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   136   8e-32
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   130   9e-32
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   135   9e-32
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   135   9e-32
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   133   9e-32
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   137   9e-32
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   136   1e-31
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   133   1e-31
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   135   1e-31
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   135   1e-31
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   132   1e-31
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   135   1e-31
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   134   1e-31
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   134   1e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   131   1e-31
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   135   2e-31
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   132   2e-31
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   134   2e-31
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   132   2e-31
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   132   2e-31
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   134   2e-31
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   135   3e-31
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   134   3e-31
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   134   3e-31
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   133   3e-31
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   133   4e-31
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   133   4e-31
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   133   4e-31
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   134   4e-31
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   134   5e-31
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   134   5e-31
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   133   5e-31
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             132   5e-31
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   131   5e-31
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   130   6e-31
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   132   6e-31
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   130   6e-31
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   134   7e-31
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   129   8e-31
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   132   8e-31
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   132   8e-31
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   130   9e-31
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   132   9e-31
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   132   1e-30
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   132   1e-30
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   131   1e-30
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   132   1e-30
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   132   1e-30
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   128   1e-30
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   132   1e-30
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    131   2e-30
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   132   2e-30
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   131   2e-30
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              132   2e-30
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   131   2e-30
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   130   2e-30
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   132   2e-30
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   132   2e-30
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   129   2e-30
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   131   2e-30
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   131   2e-30
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   131   2e-30
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   130   2e-30
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   130   2e-30
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   131   2e-30
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   132   2e-30
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   131   3e-30
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   130   3e-30
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   130   3e-30
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     132   3e-30
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   130   4e-30
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   129   4e-30
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   130   4e-30
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   130   4e-30
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   131   4e-30
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   130   4e-30
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   130   5e-30
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   130   5e-30
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   131   5e-30
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   127   5e-30
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   131   6e-30
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   129   7e-30
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   127   1e-29
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   129   1e-29
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   130   1e-29
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   130   1e-29
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   126   1e-29
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   126   1e-29
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   128   1e-29
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   129   1e-29
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   126   1e-29
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   129   1e-29
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   130   1e-29
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   130   1e-29
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   126   1e-29
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   126   1e-29
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   129   1e-29
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   128   2e-29
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   129   2e-29
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   129   2e-29
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   129   2e-29
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   127   2e-29
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   128   2e-29
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   129   2e-29
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   129   2e-29
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   125   2e-29
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   128   2e-29
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   125   3e-29
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   129   3e-29
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   125   3e-29
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   128   3e-29
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   128   3e-29
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   125   3e-29
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   128   3e-29
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   126   3e-29
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   127   3e-29
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   128   3e-29
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   128   3e-29
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    127   4e-29
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   126   4e-29
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   127   4e-29
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   128   4e-29
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   128   4e-29
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   127   4e-29
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   128   4e-29
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   126   4e-29
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   126   5e-29
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   128   5e-29
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   125   5e-29
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   127   6e-29
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   128   6e-29
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   128   6e-29
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   127   6e-29
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   126   6e-29
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   127   6e-29
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   127   6e-29
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   123   7e-29
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   126   7e-29
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   127   7e-29
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   126   7e-29
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   127   8e-29
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   126   8e-29
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   127   8e-29
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   127   9e-29
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   124   9e-29
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   126   9e-29
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   127   9e-29
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   124   9e-29
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   127   9e-29
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   126   1e-28
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   126   1e-28
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   124   1e-28
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   124   1e-28
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   123   1e-28
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   126   1e-28
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   126   2e-28
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   124   2e-28
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   123   2e-28
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   125   2e-28
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   125   2e-28
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   125   2e-28
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   125   2e-28
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   125   2e-28
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   124   2e-28
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   123   2e-28
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   118   3e-28
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   125   3e-28
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   122   3e-28
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   125   3e-28
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   124   3e-28
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   125   3e-28
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   122   3e-28
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   124   3e-28
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   125   4e-28
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   125   4e-28
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   125   4e-28
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   123   4e-28
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   124   4e-28
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   124   4e-28
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   124   4e-28
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   124   4e-28
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   120   4e-28
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   125   5e-28
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   124   5e-28
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   124   5e-28
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    119   5e-28
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   124   5e-28
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   124   5e-28
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   117   5e-28
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   124   5e-28
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   124   6e-28
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   124   6e-28
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   124   7e-28
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   122   7e-28
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   120   7e-28
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   124   7e-28
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   122   7e-28
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   123   7e-28
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   120   8e-28
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   119   9e-28
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   120   9e-28
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   124   9e-28
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   123   9e-28
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   124   9e-28
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   118   9e-28
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   120   9e-28
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   123   9e-28
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   124   9e-28
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   124   9e-28
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   124   9e-28
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   123   9e-28
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   121   1e-27
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   122   1e-27
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   122   1e-27
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   123   1e-27
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   123   1e-27
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   122   1e-27
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   122   1e-27
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   120   1e-27
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   122   1e-27
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   121   1e-27
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   119   1e-27
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   122   2e-27
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   115   2e-27
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   123   2e-27
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   122   2e-27
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   122   2e-27
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   122   2e-27
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   122   2e-27
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   118   2e-27
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   118   2e-27
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   122   2e-27
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   122   2e-27
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   118   2e-27
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   122   2e-27
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   122   2e-27
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   122   2e-27
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   122   2e-27
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   122   3e-27
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   122   3e-27
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   122   3e-27
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   119   3e-27
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   122   3e-27
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   121   3e-27
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   119   3e-27
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   117   4e-27
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   121   4e-27
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   120   4e-27
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   121   4e-27
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   121   4e-27
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   120   4e-27
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   117   4e-27
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   121   4e-27
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   119   4e-27
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   119   4e-27
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   121   4e-27
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   120   5e-27
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   120   5e-27
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   119   6e-27
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   117   6e-27
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   120   6e-27
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   121   6e-27
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   121   6e-27
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   117   7e-27
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    120   7e-27
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   120   7e-27
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   120   7e-27
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   120   7e-27
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                117   7e-27
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   120   7e-27
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   117   8e-27
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   118   8e-27
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   119   8e-27
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   120   8e-27
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   113   9e-27
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   120   9e-27
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   118   9e-27
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   120   9e-27
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   120   1e-26
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   120   1e-26
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   120   1e-26
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   120   1e-26
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   117   1e-26
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   120   1e-26
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   120   1e-26
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   119   1e-26
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   120   1e-26
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    119   1e-26
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   120   1e-26
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   117   2e-26
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   119   2e-26
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   113   2e-26
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   118   2e-26
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   119   2e-26
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   117   2e-26
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   119   2e-26
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   119   2e-26
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   118   2e-26
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   119   2e-26
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   119   2e-26
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   116   2e-26
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   115   2e-26
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   118   2e-26
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   118   2e-26
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   112   2e-26
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   112   2e-26
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   115   2e-26
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   115   2e-26
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   118   3e-26
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   115   3e-26
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   118   3e-26
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   117   3e-26
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   116   3e-26
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   118   3e-26
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   116   3e-26
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   118   3e-26
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   118   3e-26
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   115   3e-26
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   115   3e-26
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   118   3e-26
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   115   4e-26
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   118   4e-26
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   118   4e-26
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   116   4e-26
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   114   4e-26
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   118   4e-26
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   115   4e-26
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   118   4e-26
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   118   5e-26
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   115   5e-26
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   117   5e-26
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   117   5e-26
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             117   5e-26
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   118   5e-26
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   117   6e-26
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   114   6e-26
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   118   6e-26
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   117   7e-26
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   114   7e-26
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   111   7e-26
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   116   7e-26
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   114   7e-26
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   114   8e-26
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   115   8e-26
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   117   8e-26
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   117   9e-26
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   116   1e-25
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   114   1e-25
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   110   1e-25
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   117   1e-25
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              115   1e-25
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   117   1e-25
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   117   1e-25
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   114   1e-25
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   115   1e-25
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   116   1e-25
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   115   1e-25
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   116   1e-25
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   114   1e-25
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   116   1e-25
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   116   2e-25
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   115   2e-25
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   113   2e-25
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   116   2e-25
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   113   2e-25
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   114   2e-25
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   115   2e-25
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   116   2e-25
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   114   2e-25
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   116   2e-25
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   109   2e-25
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   114   2e-25
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   109   2e-25
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   115   2e-25
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   115   2e-25
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   114   2e-25
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   113   2e-25
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   114   2e-25
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   112   2e-25
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   113   2e-25
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   113   2e-25
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   115   3e-25
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   113   3e-25
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   115   3e-25
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   115   3e-25
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   113   3e-25
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   115   3e-25
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   115   3e-25
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   112   3e-25
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   114   3e-25
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   115   3e-25
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   113   3e-25
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   115   3e-25
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   114   3e-25
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   108   3e-25
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   113   3e-25
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   115   4e-25
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   115   4e-25
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   115   4e-25
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   115   4e-25
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   114   4e-25
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   114   4e-25
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   114   4e-25
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   114   4e-25
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   108   4e-25
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   114   4e-25
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   113   5e-25
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   114   5e-25
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   109   5e-25
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   114   5e-25
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   114   5e-25
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   114   6e-25
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   114   6e-25
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   108   6e-25
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   114   7e-25
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   112   7e-25
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   114   7e-25
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   113   7e-25
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   114   7e-25
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   114   7e-25
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   108   7e-25
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   114   7e-25
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   112   8e-25
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      114   8e-25
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   114   8e-25
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   114   8e-25
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   114   8e-25
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   113   8e-25
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   110   9e-25
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   113   9e-25
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   112   9e-25
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   114   1e-24
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   113   1e-24
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   113   1e-24
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}             107   1e-24
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   107   1e-24
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   111   1e-24
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   112   1e-24
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   109   2e-24
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    108   2e-24
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   112   2e-24
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   107   2e-24
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   106   2e-24
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   112   2e-24
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   109   2e-24
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   111   2e-24
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   112   2e-24
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   112   2e-24
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   111   2e-24
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   110   3e-24
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   110   3e-24
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   111   3e-24
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   110   3e-24
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   110   3e-24
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   112   3e-24
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   110   4e-24
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   111   4e-24
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...   105   4e-24
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   109   4e-24
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              110   4e-24
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   109   4e-24
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   111   5e-24
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...   109   5e-24
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   111   5e-24
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...   105   5e-24
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   110   6e-24
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...   105   6e-24
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   108   6e-24
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   106   6e-24
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   111   6e-24
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            110   6e-24
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   108   6e-24
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   110   7e-24
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   109   7e-24
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   110   7e-24
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   109   8e-24
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   110   8e-24
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   110   9e-24
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   110   9e-24
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   109   1e-23
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   108   1e-23
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   110   1e-23
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...   106   1e-23
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   108   1e-23
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...   104   1e-23
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   109   1e-23
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   110   1e-23
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   107   1e-23
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...   105   1e-23
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   109   1e-23
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   107   1e-23
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   108   1e-23
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   104   2e-23
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   110   2e-23
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   108   2e-23
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   107   2e-23
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   107   2e-23
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   109   2e-23
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   109   2e-23
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   107   2e-23
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...   107   3e-23
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   107   3e-23
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   106   3e-23
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   106   3e-23
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   106   3e-23
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   108   3e-23
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   108   4e-23
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   105   4e-23
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   108   4e-23
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   108   4e-23
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...   102   5e-23
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   105   5e-23
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...   103   5e-23
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   108   5e-23
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   107   6e-23
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              107   6e-23
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652    105   6e-23
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   107   6e-23
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...   102   6e-23
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...   105   7e-23
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...   106   7e-23
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   105   7e-23
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...   107   8e-23
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   105   8e-23
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   107   9e-23
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...   101   9e-23
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   102   1e-22
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...   101   1e-22
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   105   1e-22
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   107   1e-22
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   105   1e-22
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   106   1e-22
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   106   1e-22
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...   100   1e-22
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   107   1e-22
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...   105   1e-22
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   102   2e-22
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   106   2e-22
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...   101   2e-22
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...   104   2e-22
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   105   2e-22
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...   104   2e-22
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   106   2e-22
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...   103   2e-22
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   105   2e-22
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    98   2e-22
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   106   2e-22
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   106   2e-22
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   103   2e-22
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   104   3e-22
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...   104   3e-22
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...   104   3e-22
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   105   3e-22
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   103   3e-22
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    99   3e-22
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   105   3e-22
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   105   4e-22
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   104   4e-22
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   103   4e-22
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...   104   4e-22
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...   102   4e-22
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   105   4e-22
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...   100   4e-22
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   105   4e-22
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652    102   4e-22
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   101   4e-22
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   105   4e-22
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   105   5e-22
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   105   5e-22
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   105   5e-22
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   100   5e-22
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   102   5e-22
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...   100   5e-22
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   102   5e-22
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   102   5e-22
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...   103   6e-22
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   104   6e-22
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    99   7e-22
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...   103   7e-22
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   104   8e-22
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...   101   8e-22
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   102   8e-22
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   100   8e-22
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...   102   9e-22
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   103   9e-22
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   103   9e-22
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   102   9e-22
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   104   9e-22
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...   100   1e-21
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...   101   1e-21
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   103   1e-21
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    99   1e-21
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...   100   1e-21
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    99   1e-21
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...   102   1e-21
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...   101   1e-21
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   102   1e-21
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...   102   1e-21
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   102   1e-21
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...   102   1e-21
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    103   1e-21
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...   102   2e-21
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    98   2e-21
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    98   2e-21
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...   101   2e-21
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...   101   2e-21
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   102   2e-21
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    98   2e-21
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   102   2e-21
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...   100   2e-21
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...   100   3e-21
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   102   3e-21
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    99   3e-21
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...   101   3e-21
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    97   3e-21
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    97   3e-21
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   101   3e-21
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...   101   3e-21
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    97   3e-21
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...   100   4e-21
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    97   4e-21
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....   102   4e-21
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   102   4e-21
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   101   4e-21
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   101   4e-21
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...   100   4e-21
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...   100   4e-21
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...   100   4e-21
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...   100   4e-21
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    98   5e-21
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...   100   5e-21
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...   100   5e-21
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    98   5e-21
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...   101   5e-21
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    97   5e-21
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...   100   5e-21
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    98   5e-21
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   101   6e-21
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    98   6e-21
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    98   6e-21
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    98   6e-21
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...   100   7e-21
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...   100   7e-21
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    99   7e-21
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   100   7e-21
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    97   8e-21
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    97   9e-21
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...   100   9e-21
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...   100   9e-21
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    99   9e-21
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...   100   9e-21
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    96   1e-20
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...   100   1e-20
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...   100   1e-20
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    98   1e-20
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    99   1e-20
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    99   1e-20
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    99   1e-20
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   100   1e-20
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    99   1e-20
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    99   1e-20
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    99   1e-20
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    99   2e-20
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...   100   2e-20
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    97   2e-20
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   100   2e-20
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    98   2e-20
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    99   2e-20
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    96   2e-20
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    97   2e-20
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    99   2e-20
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     99   2e-20
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    99   2e-20
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    97   2e-20
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    98   3e-20
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    99   3e-20
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    96   3e-20
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    99   3e-20
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      98   3e-20
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    98   3e-20
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    97   3e-20
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    99   4e-20
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    96   4e-20
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    98   4e-20
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    93   4e-20
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    98   4e-20
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    99   4e-20
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    99   4e-20
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    99   4e-20
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    97   5e-20
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    98   5e-20
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    98   5e-20
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    97   6e-20
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    94   6e-20
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    98   6e-20
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    98   6e-20
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    97   7e-20
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    97   7e-20
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    98   7e-20
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    96   7e-20
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    97   7e-20
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    96   7e-20
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    97   7e-20
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    96   7e-20
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    96   8e-20
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     97   8e-20
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    96   8e-20
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    97   8e-20
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    97   9e-20
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    98   9e-20
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    97   9e-20
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    97   1e-19
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    94   1e-19
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    97   1e-19
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    96   1e-19
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    97   1e-19
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    96   1e-19
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     96   1e-19
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    96   1e-19
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    97   1e-19
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    96   1e-19
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    95   1e-19
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    93   1e-19
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    97   2e-19
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    96   2e-19
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    97   2e-19
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    94   2e-19
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    97   2e-19
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    93   2e-19
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    94   2e-19
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    97   2e-19
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    96   2e-19
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    95   2e-19
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    97   2e-19
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    96   2e-19
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    95   2e-19
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    96   2e-19
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    92   2e-19
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    96   2e-19
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    94   2e-19
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    94   2e-19
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    96   2e-19
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    96   2e-19
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    96   2e-19
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    95   2e-19
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    95   3e-19
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    92   3e-19
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    93   3e-19
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    93   3e-19
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    94   3e-19
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    94   3e-19
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    94   4e-19
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    96   4e-19
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    95   4e-19
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    92   4e-19
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    94   4e-19
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    96   4e-19
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    95   4e-19
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    95   4e-19
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    92   4e-19
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    96   4e-19
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    96   5e-19
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    94   5e-19
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    94   5e-19
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    95   5e-19
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    95   5e-19
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    91   5e-19
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    94   6e-19
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    94   6e-19
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    93   6e-19
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    94   7e-19
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    94   7e-19
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    95   7e-19
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    93   7e-19
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    94   7e-19
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    94   7e-19
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    92   8e-19
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    94   8e-19
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    94   8e-19
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    94   8e-19
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    94   8e-19
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    94   8e-19
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    95   8e-19
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    94   9e-19
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    94   9e-19
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    92   9e-19
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    93   1e-18
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    93   1e-18
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    93   1e-18
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    93   1e-18
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    93   1e-18
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    92   1e-18
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    94   1e-18
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    94   1e-18
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    92   1e-18
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    94   1e-18
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    94   1e-18
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    92   1e-18
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    91   1e-18
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    94   1e-18
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    94   1e-18
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    90   1e-18
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    94   1e-18
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    92   1e-18
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    92   2e-18
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    92   2e-18
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    92   2e-18
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    93   2e-18
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    93   2e-18
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     91   2e-18
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    93   2e-18
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    94   2e-18
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    91   2e-18
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    93   2e-18
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    94   2e-18
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    91   2e-18
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    93   2e-18
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    90   2e-18
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    93   2e-18
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    91   2e-18
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    92   2e-18
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    92   2e-18
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    93   2e-18
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    93   2e-18
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    92   2e-18
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    91   2e-18
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    92   3e-18
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    90   3e-18
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    92   3e-18
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    92   3e-18
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    92   3e-18
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    92   3e-18
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    91   3e-18
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    92   3e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    91   3e-18
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    92   3e-18
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    91   3e-18
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    92   3e-18
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    89   3e-18
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    90   3e-18
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    92   3e-18
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    91   3e-18
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    92   3e-18
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    89   3e-18
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    91   3e-18
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    93   3e-18
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    92   4e-18
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       92   4e-18
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    92   4e-18
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    91   4e-18
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    89   4e-18
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    92   4e-18
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    89   4e-18
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        91   4e-18
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    88   4e-18
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    90   4e-18
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    92   5e-18
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    92   5e-18
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    91   5e-18
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    91   5e-18
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    91   6e-18
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    89   6e-18
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    89   6e-18
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    92   6e-18
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    91   6e-18
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    92   7e-18
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    90   7e-18
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    90   7e-18
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    91   7e-18
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    90   7e-18
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    92   7e-18
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    90   8e-18
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    89   8e-18
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    87   8e-18
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    92   8e-18
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    92   8e-18
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    91   8e-18
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    91   9e-18
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    90   9e-18
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    90   9e-18
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    91   1e-17
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    91   1e-17
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    89   1e-17
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    91   1e-17
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    91   1e-17
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    89   1e-17
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    91   1e-17
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    89   1e-17
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    90   1e-17
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    90   1e-17
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    90   1e-17
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    89   1e-17
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    91   1e-17
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    88   2e-17
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    90   2e-17
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    89   2e-17
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    90   2e-17
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    91   2e-17
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    89   2e-17
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    91   2e-17
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               90   2e-17
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    90   2e-17
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    90   2e-17
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    89   3e-17
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    88   3e-17
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    88   3e-17
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    90   3e-17
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    88   3e-17
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    88   3e-17
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    88   3e-17
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    87   3e-17
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    89   3e-17
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    89   4e-17
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    89   4e-17
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    89   4e-17
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    89   4e-17
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    89   4e-17
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    89   4e-17
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    89   4e-17
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    87   4e-17
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    87   4e-17
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    85   4e-17
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    89   4e-17
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    86   5e-17
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    88   5e-17
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    87   5e-17
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    89   5e-17
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    87   5e-17
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    88   5e-17
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    87   6e-17
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    86   6e-17
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    87   6e-17
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    88   6e-17
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    85   6e-17
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    87   6e-17
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    87   6e-17
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    85   6e-17
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    87   6e-17
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    86   6e-17
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    86   6e-17
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    88   6e-17
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    88   6e-17
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    87   6e-17
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    88   7e-17
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    86   7e-17
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    87   7e-17
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    88   8e-17
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    87   8e-17
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    87   8e-17
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    84   8e-17
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             88   8e-17
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    88   9e-17
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    87   9e-17
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    87   9e-17
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    84   9e-17
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    87   9e-17
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    88   9e-17
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    87   1e-16
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    87   1e-16
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    85   1e-16
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    87   1e-16
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    87   1e-16
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    87   1e-16
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    84   1e-16
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    88   1e-16
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    87   1e-16
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    87   1e-16
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    86   2e-16
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    87   2e-16
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    86   2e-16
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    85   2e-16
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    86   2e-16
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    85   2e-16
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    87   2e-16
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    86   2e-16
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    87   2e-16
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    84   2e-16
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    84   2e-16
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    86   2e-16
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    86   2e-16
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    86   2e-16
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    85   2e-16
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    86   2e-16
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    87   2e-16
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    86   2e-16
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    84   2e-16
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    86   2e-16
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    86   2e-16
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    85   3e-16
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    84   3e-16
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               86   3e-16
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              87   3e-16
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    86   3e-16
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    86   3e-16
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      86   3e-16
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     86   3e-16
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    86   3e-16
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    86   3e-16
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    86   3e-16
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    86   3e-16
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    86   3e-16
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    85   3e-16
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    85   3e-16
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     85   4e-16
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    84   4e-16
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    86   4e-16
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    86   4e-16
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    86   4e-16
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    84   4e-16
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    83   4e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    84   4e-16
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    86   4e-16
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    85   5e-16
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    86   5e-16
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    85   5e-16
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    83   5e-16
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    82   5e-16
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    85   5e-16
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    86   5e-16
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    83   5e-16
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    85   5e-16
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    85   6e-16
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    85   6e-16
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    85   6e-16
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    84   6e-16
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    83   6e-16
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    83   6e-16
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    85   6e-16
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    84   6e-16
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    86   6e-16
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    83   6e-16
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      85   6e-16
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    82   6e-16
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    85   6e-16
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    84   6e-16
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    85   7e-16
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    82   7e-16
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    84   7e-16
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    85   7e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    84   7e-16
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    83   8e-16
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    82   8e-16
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    84   8e-16
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    84   8e-16
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    85   8e-16
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    84   9e-16
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    83   1e-15
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    84   1e-15
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      84   1e-15
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    82   1e-15
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    84   1e-15
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    84   1e-15
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    84   1e-15
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    84   1e-15
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    85   1e-15
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    84   1e-15
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    83   1e-15
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    81   1e-15
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    82   1e-15
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    84   1e-15
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     82   1e-15
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    82   1e-15
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    82   1e-15
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    84   1e-15
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    84   1e-15
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    84   1e-15
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    84   1e-15
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    82   1e-15
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    84   1e-15
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    84   1e-15
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    84   2e-15
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    84   2e-15
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    84   2e-15
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    83   2e-15
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    84   2e-15
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    83   2e-15
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    82   2e-15
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    83   2e-15
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    83   2e-15
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               84   2e-15
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    80   2e-15
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    83   2e-15
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    83   2e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    82   2e-15
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    83   2e-15
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    82   2e-15
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    83   2e-15
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    81   2e-15
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    81   2e-15
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    83   2e-15
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    83   2e-15
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    83   2e-15
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    83   2e-15
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    83   2e-15
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    83   2e-15
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    81   3e-15
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    81   3e-15
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    83   3e-15
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    82   3e-15
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              82   3e-15
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    82   3e-15
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    80   3e-15
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    80   3e-15
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    83   3e-15
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    82   4e-15
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    80   4e-15
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    82   4e-15
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    80   4e-15
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    82   4e-15
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    82   5e-15
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    82   5e-15
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    82   5e-15
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    80   5e-15
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    80   5e-15
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     80   5e-15
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    80   5e-15
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    81   5e-15
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    80   6e-15
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    80   6e-15
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    82   6e-15
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    79   6e-15
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     81   6e-15
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    80   6e-15
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    80   7e-15
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    80   7e-15
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    82   7e-15
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    80   7e-15
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     81   7e-15
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    80   7e-15
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    81   8e-15
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    82   8e-15
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    82   8e-15
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    81   8e-15
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    80   8e-15
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    80   8e-15
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    80   9e-15
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    79   9e-15
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    79   9e-15
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    79   1e-14
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    81   1e-14
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    79   1e-14
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    79   1e-14
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              81   1e-14
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    81   1e-14
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    80   1e-14
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    79   1e-14
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    79   1e-14
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    81   1e-14
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    80   1e-14
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    79   1e-14
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    79   1e-14
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    80   1e-14
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    81   1e-14
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    79   1e-14
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    81   1e-14
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    79   1e-14
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    81   1e-14
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    80   2e-14
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    80   2e-14
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    78   2e-14
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    79   2e-14
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    80   2e-14
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    80   2e-14
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    80   2e-14
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    78   2e-14
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     80   2e-14
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    78   2e-14
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    78   2e-14
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    80   2e-14
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    78   2e-14
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    80   2e-14
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              79   2e-14
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    78   3e-14
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    80   3e-14
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               78   3e-14
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    80   3e-14
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    79   3e-14
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    77   3e-14
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      79   4e-14
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    77   4e-14
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    77   4e-14
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    76   4e-14
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    78   4e-14
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    79   5e-14
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    79   5e-14
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    79   5e-14
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    79   5e-14
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    79   5e-14
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    79   5e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    79   5e-14
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     79   5e-14
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    79   5e-14
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    77   5e-14
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    77   6e-14
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    79   6e-14
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    77   6e-14
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    79   6e-14
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    79   6e-14
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    79   6e-14
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    78   7e-14
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    77   7e-14
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    78   7e-14
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    78   7e-14
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             76   8e-14
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    78   8e-14
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    78   8e-14
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    78   9e-14
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    78   1e-13
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    78   1e-13
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    78   1e-13
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    78   1e-13
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    77   1e-13
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    78   1e-13
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    77   1e-13
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    78   1e-13
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    75   1e-13
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    77   1e-13
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    77   1e-13
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    76   1e-13
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    76   1e-13
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    76   1e-13
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    77   1e-13
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               77   1e-13
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    76   1e-13
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    77   1e-13
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    75   1e-13
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    77   1e-13
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    77   2e-13
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    77   2e-13
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    75   2e-13
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    77   2e-13
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    77   2e-13
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    77   2e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    75   2e-13
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    77   2e-13
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    75   2e-13
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     76   2e-13
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    77   3e-13
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    77   3e-13
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    75   3e-13
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    75   3e-13
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    76   3e-13
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    76   3e-13
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    75   3e-13
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    76   3e-13
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    74   3e-13
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    74   3e-13
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    75   4e-13
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    76   4e-13
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    74   4e-13
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    76   4e-13
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    74   4e-13
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    76   4e-13
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    76   4e-13
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    75   4e-13
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    75   4e-13
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    75   4e-13
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    75   5e-13
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    76   5e-13
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    76   5e-13
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    75   5e-13
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    74   5e-13
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    75   5e-13
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    74   6e-13
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    75   6e-13
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    74   6e-13
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    75   6e-13
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    74   6e-13
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    75   6e-13
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    75   7e-13
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    75   7e-13
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    75   7e-13
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    75   7e-13
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    75   8e-13
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    74   8e-13
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    74   8e-13
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    75   9e-13
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    74   9e-13
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    74   9e-13
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    75   1e-12
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    74   1e-12
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    74   1e-12
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    75   1e-12
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    74   1e-12
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    75   1e-12
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    74   1e-12
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    75   1e-12
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    74   1e-12
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    74   1e-12
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    74   1e-12
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    74   1e-12
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    74   1e-12
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    74   2e-12
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    74   2e-12
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    73   2e-12
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    74   2e-12
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    74   2e-12
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    74   2e-12
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    72   2e-12
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    74   2e-12
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     73   2e-12
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    73   3e-12
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    72   3e-12
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    73   3e-12
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     73   3e-12
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    73   3e-12
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    73   3e-12
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    73   3e-12
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    73   4e-12
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    73   4e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    73   4e-12
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    73   4e-12
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    72   4e-12
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    73   4e-12
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    72   5e-12
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    72   5e-12
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    72   5e-12
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    72   6e-12
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    72   6e-12
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    72   6e-12
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    72   6e-12
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    72   6e-12
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    72   7e-12
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    72   7e-12
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    71   7e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    70   8e-12
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    72   8e-12
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    72   8e-12
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    72   8e-12
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    70   8e-12
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    70   9e-12
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    72   1e-11
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    71   1e-11
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    71   1e-11
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    71   1e-11
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    71   1e-11
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    71   1e-11
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    70   2e-11
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    70   2e-11
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    70   2e-11
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    70   2e-11
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    70   2e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    70   2e-11
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    70   2e-11
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    69   2e-11
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               69   2e-11
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    69   2e-11
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    69   2e-11
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    70   2e-11
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    70   2e-11
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    70   2e-11
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    70   2e-11
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    69   2e-11
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    70   2e-11
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    70   3e-11
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    70   3e-11
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    70   3e-11
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    70   3e-11
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    70   4e-11
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    69   4e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    69   4e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    68   4e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       69   4e-11
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    68   4e-11
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    68   5e-11
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    69   5e-11
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    68   5e-11
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    69   5e-11
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    69   7e-11
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    69   8e-11
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    67   1e-10
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    67   1e-10
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    68   1e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    67   1e-10
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    68   1e-10
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    66   2e-10
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    67   2e-10
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    67   2e-10
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    67   2e-10
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    67   2e-10
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    67   2e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    67   2e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    66   2e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    67   2e-10
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    67   2e-10
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    67   2e-10
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    67   3e-10
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    66   3e-10
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    67   3e-10
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    66   3e-10
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    65   3e-10
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    65   3e-10
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    67   4e-10
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    66   4e-10
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    66   5e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    65   5e-10
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    65   5e-10
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    65   5e-10
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    65   6e-10
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    64   6e-10
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    66   6e-10
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    65   6e-10
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    65   7e-10
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    65   7e-10
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    65   7e-10
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    65   8e-10
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    65   8e-10
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    65   8e-10
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    65   9e-10
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    65   1e-09
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               64   1e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    64   1e-09
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    64   1e-09
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    65   1e-09
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    64   1e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    63   2e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    64   2e-09
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    64   2e-09
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    64   2e-09
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               64   2e-09
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    64   2e-09
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    64   3e-09
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    62   3e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    63   3e-09
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    63   3e-09
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    64   3e-09
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    62   3e-09
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    63   3e-09
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    63   3e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    62   4e-09
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    63   4e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    62   4e-09
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    62   5e-09
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    62   6e-09
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    62   6e-09
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    62   7e-09
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    62   7e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    61   8e-09
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    62   8e-09
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    62   8e-09
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    62   8e-09
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    60   9e-09
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    60   1e-08
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    61   1e-08
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    61   1e-08
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    61   2e-08
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    61   2e-08
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    61   2e-08
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    60   2e-08
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    61   2e-08
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    60   2e-08
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    60   2e-08
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    60   3e-08
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    59   3e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    60   4e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    59   4e-08
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    60   4e-08
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    59   5e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    59   5e-08
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    59   5e-08
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    59   5e-08
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    59   5e-08
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    59   6e-08
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    58   6e-08
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    59   6e-08
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    58   6e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    58   6e-08
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    59   8e-08
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    59   8e-08
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    59   9e-08
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    57   9e-08
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    58   9e-08
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    58   1e-07
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    57   2e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    57   2e-07
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    57   2e-07
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    56   2e-07
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    57   2e-07
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    56   2e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    57   3e-07
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    57   3e-07
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    57   3e-07
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    57   3e-07
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    56   4e-07
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    56   6e-07
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    56   6e-07
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    55   7e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    54   9e-07
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    55   9e-07
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    55   9e-07
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    55   9e-07
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    55   9e-07
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    54   1e-06
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    55   1e-06
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    55   1e-06
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    55   1e-06
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    55   1e-06
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    55   1e-06
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    55   1e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    54   2e-06
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    54   2e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    54   2e-06
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    53   3e-06
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    53   4e-06
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    52   1e-05
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    52   1e-05
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    52   1e-05
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    52   1e-05
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    51   1e-05
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    51   2e-05
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    51   2e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    51   2e-05
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    51   2e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    50   2e-05
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    50   2e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    50   2e-05
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    50   2e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    49   3e-05
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    47   3e-05
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    49   4e-05
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    49   4e-05
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    49   4e-05
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    49   4e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    49   5e-05
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    49   5e-05
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    49   7e-05
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    49   8e-05
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    48   8e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    48   9e-05
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    49   9e-05
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    49   9e-05
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    49   1e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    48   1e-04
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    48   2e-04
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    47   2e-04
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    47   2e-04
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    47   2e-04
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    47   2e-04
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    46   4e-04
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    47   4e-04
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    47   4e-04
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    47   4e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    46   4e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    46   4e-04
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    46   5e-04
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    46   5e-04
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    46   5e-04
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    44   6e-04
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    46   6e-04
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    45   6e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    45   7e-04
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    46   8e-04
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    45   8e-04
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    45   9e-04
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    45   0.001
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    45   0.001
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    45   0.001
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    45   0.001
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    45   0.001
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    44   0.002
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    44   0.002
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    45   0.002
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    44   0.002
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    44   0.002
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    44   0.002
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    44   0.002
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    44   0.002
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     44   0.003
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    44   0.003
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    44   0.004
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    43   0.004
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    43   0.004
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    43   0.005
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    42   0.007
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    43   0.007
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     42   0.007
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    42   0.009
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    42   0.009
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    42   0.009
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.010
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    42   0.010
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    42   0.011
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    42   0.011
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    42   0.011
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    42   0.011
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    41   0.011
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    41   0.014
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    41   0.014
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    41   0.015
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    41   0.018
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     41   0.019
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    41   0.019
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    41   0.021
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    40   0.021
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    41   0.021
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    41   0.022
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    41   0.023
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    40   0.024
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    40   0.025
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    40   0.030
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    40   0.030
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    40   0.031
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    40   0.037
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    40   0.038
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    40   0.043
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.045
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    40   0.046
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    40   0.047
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    40   0.047
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    39   0.053
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    40   0.053
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    39   0.054
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    40   0.055
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    40   0.057
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    39   0.061
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    39   0.064
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    39   0.065
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    39   0.067
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.069
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    39   0.071
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    39   0.080
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    39   0.080
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.095
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    39   0.095
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    39   0.10 
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    39   0.11 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    38   0.12 
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    38   0.12 
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    38   0.13 
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    38   0.14 
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    38   0.14 
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    38   0.15 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    38   0.19 
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    37   0.20 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    37   0.22 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    37   0.23 
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    37   0.23 
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    37   0.24 
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    35   0.26 
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    37   0.26 
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    37   0.28 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    37   0.30 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    37   0.30 
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    37   0.32 
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    37   0.33 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    37   0.41 
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    36   0.46 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    36   0.48 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    36   0.51 
KNAG0J01310 Chr10 complement(235080..238256) [3177 bp, 1058 aa] ...    36   0.59 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    36   0.67 
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    36   0.69 
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    36   0.72 
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    35   1.2  
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     35   1.3  
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     35   1.4  
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    35   1.4  
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    35   1.6  
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    35   1.7  
KAFR0C02170 Chr3 (431896..434289) [2394 bp, 797 aa] {ON} Anc_6.1...    34   2.1  
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    34   2.1  
KLLA0E19207g Chr5 (1709335..1711638) [2304 bp, 767 aa] {ON} simi...    34   2.2  
YEL010W Chr5 (136279..136629) [351 bp, 116 aa] {OFF} Dubious ope...    32   2.3  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    34   2.5  
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    34   3.0  
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    33   3.8  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    33   4.6  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    33   6.0  
KLTH0F09020g Chr6 complement(775420..776130,776219..776260) [753...    32   8.4  

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/562 (96%), Positives = 540/562 (96%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG 60
           MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG
Sbjct: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG 60

Query: 61  STFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLL 120
           STFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLL
Sbjct: 61  STFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLL 120

Query: 121 IERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 180
           IERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES
Sbjct: 121 IERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 180

Query: 181 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLL 240
           KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLL
Sbjct: 181 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLL 240

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIR 300
           LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIR
Sbjct: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIR 300

Query: 301 NLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHR 360
           NLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHR
Sbjct: 301 NLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHR 360

Query: 361 FKYENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAH 420
           FKYENE        IAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAH
Sbjct: 361 FKYENEQQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAH 420

Query: 421 KRPVSIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAILNTPSSSPSRKRMSIAQDAPPMPT 480
           KRPVSIQKWGEIGGGNNGLI              AILNTPSSSPSRKRMSIAQDAPPMPT
Sbjct: 421 KRPVSIQKWGEIGGGNNGLISPSKKRSLSNRKLSAILNTPSSSPSRKRMSIAQDAPPMPT 480

Query: 481 SVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFA 540
           SVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFA
Sbjct: 481 SVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFA 540

Query: 541 TLIDNIFEHEKYEQIRREKEGL 562
           TLIDNIFEHEKYEQIRREKEGL
Sbjct: 541 TLIDNIFEHEKYEQIRREKEGL 562

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/507 (93%), Positives = 476/507 (93%)

Query: 639  VAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSSTSKRDSLLALQYSINTVLNKR 698
            VAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSSTSKRDSLLALQYSINTVLNKR
Sbjct: 639  VAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSSTSKRDSLLALQYSINTVLNKR 698

Query: 699  AVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRSNFLGSQFDI 758
            AVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRSNFLGSQFDI
Sbjct: 699  AVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRSNFLGSQFDI 758

Query: 759  HXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRHTT 818
            H                  QLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRHTT
Sbjct: 759  HKELKNAKKEKIEKAKKRKQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRHTT 818

Query: 819  VGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSDVQ 878
            VGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSDVQ
Sbjct: 819  VGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSDVQ 878

Query: 879  LKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKLNYADRFYKP 938
            LKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKLNYADRFYKP
Sbjct: 879  LKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKLNYADRFYKP 938

Query: 939  VEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSSPREDFKHAVRSV 998
            VEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSSPREDFKHAVRSV
Sbjct: 939  VEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSSPREDFKHAVRSV 998

Query: 999  TPNENKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGVXXXXXXXXXXXXXEKIKP 1058
            TPNENKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGV             EKIKP
Sbjct: 999  TPNENKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGVPKKRPSFFRKFSKEKIKP 1058

Query: 1059 EYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAF 1118
            EYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAF
Sbjct: 1059 EYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAF 1118

Query: 1119 QVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            QVVVAGSNHGSSVRFTKKSGSKKTFAR
Sbjct: 1119 QVVVAGSNHGSSVRFTKKSGSKKTFAR 1145

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  964 bits (2491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/563 (83%), Positives = 500/563 (88%), Gaps = 5/563 (0%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG 60
           MG K+N NVTSL+G RIGPW LGETLG GSTGKVL+AQN +TGQIAAVK+ISKS+FNAQG
Sbjct: 1   MGDKNN-NVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQG 59

Query: 61  STFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLL 120
           STFVGSNDPDVLPYGIEREI IMKLLNHPNVLRLYDVWET+ DLYMVLEYVEKGELFNLL
Sbjct: 60  STFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLL 119

Query: 121 IERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 180
           ++RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES
Sbjct: 120 VQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 179

Query: 181 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLL 240
           KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE+DGNIR LL
Sbjct: 180 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIR 300
           LKVQSG++E+P +DEIS EA+DLI +ILTV+P  RIKTREILKHPLL+KYPSIKDSKSIR
Sbjct: 240 LKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIR 299

Query: 301 NLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHR 360
           NLPREDTYLNPLDHNDGT+D+ IL+NLVVLWHGRD+NEI MKL E G NLEKTFYALLHR
Sbjct: 300 NLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHR 359

Query: 361 FKYENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAH 420
           FK+ENE        IAKRISS SSSPQ+NIVKSSSRRSIN IL TPKKKRSS INVSSAH
Sbjct: 360 FKFENEQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTPKKKRSSAINVSSAH 419

Query: 421 KRPVSIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAIL-NTPSSSPSRKRMSIAQDAPPMP 479
           KRPVSIQK  + G  N                  A+L  + SSSPSRKRMS+ QDAPP+P
Sbjct: 420 KRPVSIQKLNDCGTLNP--TSPSKKRSLSNRKLSAVLAGSNSSSPSRKRMSVGQDAPPVP 477

Query: 480 TSVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDF 539
           T+VLRDYNKRASR SKR SFLPS KR SIT+KIIATYAKLSEDNDWEYID+EAKRTSSDF
Sbjct: 478 TAVLRDYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDF 536

Query: 540 ATLIDNIFEHEKYEQIRREKEGL 562
           ATLIDNIFEHEKYEQIRREKE L
Sbjct: 537 ATLIDNIFEHEKYEQIRREKEEL 559

 Score =  404 bits (1039), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 254/526 (48%), Positives = 338/526 (64%), Gaps = 34/526 (6%)

Query: 639  VAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSS-TSKRDSLLALQYSINTVLNK 697
            VA+L+AE+  T+ E++++   +  V  RS+SEP +R  +  SKRDS LALQ +IN++L +
Sbjct: 613  VARLKAEVAATKQEKRISLAQEQHV--RSISEPMERKGTRPSKRDSFLALQNNINSLLKR 670

Query: 698  RAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRSNFLGSQFD 757
            R +S++TRPISRLDPGI   E    L+ D E   +E  LR EK ILETIRRS FLGSQ+D
Sbjct: 671  RTLSLETRPISRLDPGIRLSEENTILEDDLE--CNEDRLRVEKNILETIRRSKFLGSQYD 728

Query: 758  IHXXXXXXXXXXXXXXXXXXQLNRKL-PDRISYHDQRFVSDGTTITSAHDGYDTTSLTRH 816
            I                     +RKL P   S  +QRFVSDGTT+TS+H+  ++  L ++
Sbjct: 729  IDKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKN 788

Query: 817  -TTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKS 875
             T +GVL+D+ESEP+KLSEV+IP+ TRRS+H SASSKR SVLSMYST  SYTNLAD++ +
Sbjct: 789  VTAIGVLKDEESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLNN 848

Query: 876  DVQLKPLNDTA--SSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIK----- 928
            DVQLK L  +A  S K+ Q+PEFMFES        +  +N + ++  AP +T ++     
Sbjct: 849  DVQLKSLQPSAPTSIKIPQEPEFMFES--------AGQENRYQAA--APTDTYLERPKVG 898

Query: 929  LNYADRFYKPVEVIELDDT-DNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQH-SS 986
            +       +PVE+IELDD+ D ++  +EEDI KVKLP LPPL+ LNK PNGLGIYQ  + 
Sbjct: 899  VEGDHEPGEPVELIELDDSEDRSKQYSEEDIAKVKLPILPPLDHLNK-PNGLGIYQAPAP 957

Query: 987  PREDFKHAV-RSVTPNENK-----ENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGV 1040
            P+E     V +S+ P++ K         P     ++AP   + K +  R    +      
Sbjct: 958  PKEPLGQPVMKSMIPDDIKIKCVPNQLSPRRRATERAPEKKLTKTVPERVIAAETFPPPN 1017

Query: 1041 XXXXXXXXXXXXXEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSM 1100
                         EK+  + D QLDTTV ++KMFRAL+KLLNGWTSYGLK+VRS P+   
Sbjct: 1018 TKKKPSFFKKFSREKMHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYT 1077

Query: 1101 ITGKLSSDNILSLRSTAFQVVVAG-SNHGSSVRFTKKSGSKKTFAR 1145
            ITGKLSSDNILSLRSTAF++V+   ++ GSSV+FTKKSGSKKTF R
Sbjct: 1078 ITGKLSSDNILSLRSTAFEIVILSVADTGSSVKFTKKSGSKKTFTR 1123

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/567 (72%), Positives = 456/567 (80%), Gaps = 10/567 (1%)

Query: 5   DNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFV 64
           + + +T+LKG  IGPW LG TLGVGSTGKV+MA N   GQ AAVKIISKSIFNAQGST +
Sbjct: 2   NGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMI 61

Query: 65  GSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERG 124
           G NDPDVLPYGIEREI IMKLLNHPNVLRLYDVWETS DLYMVLEYVEKGELFNLL+ERG
Sbjct: 62  GGNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERG 121

Query: 125 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 184
           PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN+KLADFGMAALESKDKL
Sbjct: 122 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKL 181

Query: 185 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQ 244
           LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE+DGNIR LLLKVQ
Sbjct: 182 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 241

Query: 245 SGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPR 304
           SG+FEMP  DEIS EAQDLIA+ILTVDP  RIKTREILKHPLL+KYPSIKDSKSIRNLPR
Sbjct: 242 SGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPR 301

Query: 305 EDTYLNPLDHNDG--TVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFK 362
           EDTYLNPL    G   VD TIL+NLVVLWHGR++ +I+ KL E G NLEKTFYALLHRFK
Sbjct: 302 EDTYLNPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFK 361

Query: 363 YENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAHKR 422
           ++N         + K+ S +S+S        S  +S +  + TPKKKR+S I  SS+HKR
Sbjct: 362 HDNYQDQLKQQELQKKQSVSSNSLMYVGSLPSPNKS-DSPVTTPKKKRTSIIVASSSHKR 420

Query: 423 PVSIQKWGEIGGG--NNGLIXXXXXXXXXXXXXXAILNTPSSSP---SRKRMSIAQD--A 475
           PVS+QK          NG I              + L + SSSP   + KR+S   D  A
Sbjct: 421 PVSMQKLSSQHSSPVKNGSIGKRLSKTFPSNKRISQLVSNSSSPTPAAHKRVSRINDSAA 480

Query: 476 PPMPTSVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRT 535
           PP+P  +LRDY +++ R SKRFS LP++KR SIT+K+IATYAKLSED++WEYI+KE KRT
Sbjct: 481 PPVPKEMLRDYKRQSKRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYIEKETKRT 540

Query: 536 SSDFATLIDNIFEHEKYEQIRREKEGL 562
           S DFATL+D IFEHEKYEQIR+EKE L
Sbjct: 541 SQDFATLMDQIFEHEKYEQIRKEKEEL 567

 Score =  285 bits (728), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 206/525 (39%), Positives = 296/525 (56%), Gaps = 67/525 (12%)

Query: 639  VAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSSTSKRDSLLALQYSINTVLNKR 698
            +AKL+AE E      Q +S  +N    RSVS P +   + +KRDS   ++  IN ++N R
Sbjct: 618  IAKLKAEYEAV----QGSSDERNTANGRSVSAPIETDRTANKRDSTFGIKNDINELINTR 673

Query: 699  AVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRSNFLGSQFDI 758
              S+QTRP+SRLDPGI+A E     + +D++        +EKTILETIRRS FLGSQF++
Sbjct: 674  NFSLQTRPVSRLDPGIIAAESRLSANLEDDQA------SKEKTILETIRRSKFLGSQFNL 727

Query: 759  HXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRHT- 817
            +                  +L +   D +S   Q  +   +  T+    Y+   L ++  
Sbjct: 728  NV-----------------ELEKAQKDLVSKERQEQLRKYSEQTAK---YEVQKLPKNAK 767

Query: 818  TVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSDV 877
             V  LRDDE EP+KLSEV++P+ TRRS+H S+S+KRFSVLS+YST TS+TNL D +K+D 
Sbjct: 768  AVATLRDDEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTNLVDHLKNDN 827

Query: 878  QLKPL---NDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKLNYADR 934
             L+PL    + +SSKV Q+PEFMFE+    VE +  ++NS +   E P     KL  A R
Sbjct: 828  YLEPLPGQPEYSSSKVAQEPEFMFET----VEEL--DENSKL--FEVPETEEGKLASAAR 879

Query: 935  FYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPN-----GLGIYQ-HSSPR 988
                      + TD  +  T +    + LP+LPPL+  +   +     GLGIYQ +   +
Sbjct: 880  ---------KESTDARKQSTND--KDINLPSLPPLQVSHDVADENGALGLGIYQPNDQTQ 928

Query: 989  EDFKHAVRSVTPNENKENEDPAGTTQ--QKAPLTS-VGKELGIREPLTDL---AQQGVXX 1042
            +  K  +   + +EN  +      T+  +K PL   V K    R+PL ++    +     
Sbjct: 929  KPHKTMLIDESIDENISSTSDVSRTEVVKKPPLNDVVRKNNNERKPLEEITPKVENKRKI 988

Query: 1043 XXXXXXXXXXXEKIKPE-YDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMI 1101
                       +K+ PE +D QL   V+  KM++ALD+LLN WT+YGLK V SSP+  +I
Sbjct: 989  SFFRKFSQGSEKKLGPESFDSQLKAGVSAPKMYKALDRLLNEWTNYGLKHVESSPNDFVI 1048

Query: 1102 TGKLSSDNILSLRSTAFQV-VVAGSNHGSSVRFTKKSGSKKTFAR 1145
            +GKL+SDNILSLRST F++ V+ G  +GS ++FTKKSGS KTF R
Sbjct: 1049 SGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGSTKTFNR 1093

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/570 (70%), Positives = 453/570 (79%), Gaps = 26/570 (4%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG--STFV 64
           S +T+LKG +IGPW LG TLG GSTGKV+MAQ+  TGQ AAVKI+SKSIF  Q   ST V
Sbjct: 13  STLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSSTIV 72

Query: 65  GSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERG 124
           GSNDPDVLPYGIEREI IMKLLNHPNVLRLYDVWET++ LYMVLEYVEKGELFNLL++RG
Sbjct: 73  GSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRG 132

Query: 125 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 184
           PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALESKDKL
Sbjct: 133 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKL 192

Query: 185 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQ 244
           LETSCGSPHYAAPEIVSGLPYHGFESDVWSCG+IL+ALLTGRLPFDE+DGNIR LLLKVQ
Sbjct: 193 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQ 252

Query: 245 SGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPR 304
           SG+FEMPD +EIS EAQDLIAKILTVDP+ RIK+R ILKHPLL+KYPSIKDSKSIRNLPR
Sbjct: 253 SGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPR 312

Query: 305 EDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYE 364
           EDTYLNPLD  DGT+D TI+ NLVVLWHGRD NEI  KL E G NLEKTFYALL RFK++
Sbjct: 313 EDTYLNPLDSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHD 372

Query: 365 NEXXXXXXXXIAKRISSASSSPQR-NIVKSSSRRSINQILVTPKKK-RSSGINVSSAHKR 422
           ++          +R  +   SP++  + KS+SRRSIN    TPKKK R+  I+ SS+HKR
Sbjct: 373 SQQEQLKQQ---RRSQAMQVSPKKTGLRKSNSRRSINS--TTPKKKTRAPVISASSSHKR 427

Query: 423 PVSIQKWGEIGGGN------NGLIXXXXXXXXXXXXXXAILNTPSS-SPSRKRMSIAQ-- 473
           PVS  +     G N      N                 A++N  SS +P+ KR S+ +  
Sbjct: 428 PVSFSRLSYSNGSNTDHNTPNSSGKRSSVNLSSNKRISALINPNSSPTPASKRASLRELD 487

Query: 474 -DAPPMPTSVLRDYNKRA-------SRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDW 525
             APP+P  +L+DYNK A       SR SKR SFLP  KR SIT+K+IATYAK+SEDNDW
Sbjct: 488 PSAPPIPVDMLKDYNKAAPKANRKSSRISKRLSFLPGNKRGSITTKLIATYAKISEDNDW 547

Query: 526 EYIDKEAKRTSSDFATLIDNIFEHEKYEQI 555
           EYI+KE KRTS+DFATL D IFEHEKYEQI
Sbjct: 548 EYIEKETKRTSADFATLCDEIFEHEKYEQI 577

 Score =  277 bits (709), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 194/511 (37%), Positives = 266/511 (52%), Gaps = 54/511 (10%)

Query: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDY 725
            RSVS P +      KR S+ AL   I  +LN+R  S++TRP SRLDPGI   E     D 
Sbjct: 658  RSVSAPVESVLKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGIYTLEEVPNSDI 717

Query: 726  DDEEILSERTLRREKTILETIRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPD 785
             D      R L+ EKTILETIRRS FLGS FDI+                  Q  RK  D
Sbjct: 718  KD----GGRDLKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQ--RKKED 771

Query: 786  RISYHDQRFVSDGTTITSAHDGYDTTSLTRHTTVGVLRDDE-SEPKKLSEVRIPEVTRRS 844
            R+       VS+ T   S  +GY+  +L ++     + +D  S+P+K+SEV++P+ TRRS
Sbjct: 772  RV-------VSNATGNYS-ENGYEPQTLPKNAAATKISNDAGSDPRKISEVQVPQFTRRS 823

Query: 845  RHLSASSKRFSVLSMYSTMTSYTNLADFMKSDVQLKPLNDTASSKVTQQPE--FMFESTI 902
            RH +AS+KR SVLSMYST  S+TNLAD ++    L+ +N +  S    +PE  FMFES  
Sbjct: 824  RHFTASNKRLSVLSMYSTKASFTNLADHLRGKTDLQSINGSPPSTSRMEPETEFMFESVD 883

Query: 903  -DNVERISSNDNSHISSMEAPNN------TVIKLNYADRFYKPVEVIELDDTDNTQPDTE 955
             +  E   ++ +S +  +   N+      + ++LN+ADRF KP          +  P + 
Sbjct: 884  GEGKETADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPT---------SPPPQSV 934

Query: 956  EDITKVKLPALPPLEKL-NKSPNGLGIYQHSS--PREDFKHAVRSVTPNENKENE----- 1007
            ED   +KLP+LPPL+K  +   NGLG+YQ +S     +  H  +S+ P + ++ E     
Sbjct: 935  EDPNGIKLPSLPPLDKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQKEAAEAK 994

Query: 1008 -------DPAGTTQQKAPLTSVGKELGIRE------PLTDLAQQGVXXXXXXXXXXXXXE 1054
                    P       APL  V K+    E      P  +  ++               E
Sbjct: 995  PEEQKQVPPKDVESAPAPLNKVMKKNTEAEKNQPNQPAPNAVKKNNKSFFRRFSGKSDDE 1054

Query: 1055 KIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLR 1114
            K   EYD++ DT +  T+MF AL KLL  W  YGLK V +SPS   I GK+SSDN+LSLR
Sbjct: 1055 KRPGEYDFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLR 1114

Query: 1115 STAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            ST F++ +     GS V FTKKSGS KTF +
Sbjct: 1115 STLFEISIVSKGEGSIVGFTKKSGSTKTFKK 1145

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/601 (67%), Positives = 450/601 (74%), Gaps = 44/601 (7%)

Query: 6   NSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNA----QGS 61
           +S +T+LK  +IGPW LG  LG GS GKVLMAQ+  TGQ AAVKI+SKSIF A      S
Sbjct: 12  SSPLTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSS 71

Query: 62  TFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
           T VGSNDPD+LPYGIEREI IMKLLNH NVLRLYDVWET ++LYMVLEYVEKGELFNLL+
Sbjct: 72  TIVGSNDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLV 131

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALESK
Sbjct: 132 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESK 191

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
           DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDED+GNIR LLL
Sbjct: 192 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLL 251

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRN 301
           KVQSGE+EMP  DEIS EAQDLIAKILTVDP  RIKTREILKHPLL+KYPSIKDSKSIRN
Sbjct: 252 KVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRN 311

Query: 302 LPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRF 361
           LPREDTYLNPLDH DG++D  IL+NLVVLWHGRD NEIV KLNE G NLEKTFY LL RF
Sbjct: 312 LPREDTYLNPLDHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRF 371

Query: 362 KYE-----------------NEXXXXXXXXIAKRISSASSSPQRNIVKSSSRR----SIN 400
           K++                  +           R S   S  +  + KS+SR+    +  
Sbjct: 372 KHDVHQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITSTSL 431

Query: 401 QILVTPKKK-RSSGINVSSAHKRPVSIQKWGEIGGGNNGL------IXXXXXXXXXXXXX 453
               TPKKK R S I+VSS+HKRPVS  K    G  ++                      
Sbjct: 432 SGTTTPKKKNRVSMISVSSSHKRPVSFNKLSTAGKSDSACGTPGSSTKRMSISLSSSKRL 491

Query: 454 XAILNTPSSSPSRKRMSIA---QDAPPMPTSVLRDY---------NKRASRNSKRFSFLP 501
            A+    S +P+ KRMS+      APP+P  VL DY          KRASR SKR SFLP
Sbjct: 492 SAMGPNTSPTPANKRMSVRDMDSSAPPVPMDVLNDYTSALPNRKATKRASRASKRLSFLP 551

Query: 502 SIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEG 561
           +IKR SIT+K+IATYAKLSE++DWEYI+KE KRTS+DFATL D IFEHEKYEQIR+EK+ 
Sbjct: 552 NIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHEKYEQIRKEKQE 611

Query: 562 L 562
           L
Sbjct: 612 L 612

 Score =  303 bits (775), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 215/563 (38%), Positives = 300/563 (53%), Gaps = 90/563 (15%)

Query: 639  VAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSST--SKRDSLLALQYSINTVLN 696
            VA LRA+  E + E +    SKN    R VS P    S+    KRDS+  L   I+ +L 
Sbjct: 668  VAMLRADYGEPQTEPEEQGASKN----RCVSAPIASSSAKDDGKRDSIARLSGDIDDLLK 723

Query: 697  KRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRSNFLGSQF 756
            +R VS+QTRP+SRLDPGI+A E    + Y++ + + E TLR EKTILETIRRS FLGS F
Sbjct: 724  RRTVSLQTRPVSRLDPGIVAAENLGSVIYEEADGVDETTLRTEKTILETIRRSRFLGSSF 783

Query: 757  DIHXXXXXXXXXXXXXXXXXXQLNRKLPDRIS-YHDQRFVSDGTTITSAHDGYDTTSLTR 815
            DI                   +  RK  + ++  H QR +S  T  ++ +D Y++ +L +
Sbjct: 784  DIK--------------KELERAQRKKEEALARQHQQRILSSATAASATNDAYESRALPK 829

Query: 816  H-TTVGVLRDDES-EPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFM 873
            +   V  L D+ + EP+K+SE+++P+ TRRSRH +AS+KR SVLSMYST +S+TNLAD +
Sbjct: 830  NAAAVDTLNDERNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHL 889

Query: 874  KSDVQLKPLNDTASS--KVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNT------ 925
            K    L+ ++ +A S  K+TQ+PEF+FES  +     + +  +     E P+ +      
Sbjct: 890  KGGADLQEVSGSAPSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTS 949

Query: 926  ---VIKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEK-LNKSPNGLGI 981
                ++LN+ADRF             NT+    ++   VKLP LPPLEK  +K PNGLGI
Sbjct: 950  TKAAMRLNFADRF-------------NTR--AGDNPADVKLPPLPPLEKNGSKKPNGLGI 994

Query: 982  YQHSS-PR-------------------EDFKHAVRSVTPNENKENEDPAGTTQ------- 1014
            YQ    PR                   +D     +S  P E+ EN   + T +       
Sbjct: 995  YQSPERPRADPNPTSMVHEPKVFSMIPDDIAGPAKSTKPAES-ENVPTSATKKSEPKNAL 1053

Query: 1015 --------QKAPLTSVGKELGIREPLTDL---AQQGVXXXXXXXXXXXXXEKIKPEYDYQ 1063
                     + PL  + ++   R+PL D+   A++               EK    +D +
Sbjct: 1054 HSADAPEASQPPLNGMMRKNNDRKPLEDITPAAEKKRNRSFFRKFSRSSEEKKSDNFDAK 1113

Query: 1064 LDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVA 1123
            L+T+V   +MF AL KLL GW  YGLK+VR       ITGKLSSDNILSLRST F+++V 
Sbjct: 1114 LNTSVEAVQMFNALGKLLGGWKDYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVR 1173

Query: 1124 -GSNHGSSVRFTKKSGSKKTFAR 1145
              S+ GS V F KKSGS KTF R
Sbjct: 1174 DDSSKGSVVWFVKKSGSTKTFKR 1196

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/594 (63%), Positives = 445/594 (74%), Gaps = 47/594 (7%)

Query: 6   NSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG--STF 63
           N    S+KG  IGPW LGETLG+GSTGKV +A N  T Q AA+K+ISKS+F++ G  S+ 
Sbjct: 5   NKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGNNSSM 64

Query: 64  VGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIER 123
           V S  PD L YGIEREI IMKLLNHPNVLRLYDVWET+ +LYMVLEY EKGELFNLL+E+
Sbjct: 65  VSST-PDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEK 123

Query: 124 GPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDK 183
           GPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIK+ADFGMAALE++DK
Sbjct: 124 GPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDK 183

Query: 184 LLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKV 243
           LLETSCGSPHYAAPEIVSGLPYHG E+DVWSCGVIL+ALLTGRLPFDE+DGNIR LLLKV
Sbjct: 184 LLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 243

Query: 244 QSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLP 303
           Q GEFEMP  DEIS EAQDL+ KIL VDP  RIK+REILKHPLL+KYPSIKDSK+IRNLP
Sbjct: 244 QKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLP 303

Query: 304 REDTYLNPLDHNDG---TVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHR 360
           REDTYLNPL  NDG   T+D+TIL+NLVVLWHGR+E++I  KL E G N EKT YALL+R
Sbjct: 304 REDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYR 363

Query: 361 FKYENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKK--RSSGINVSS 418
           FK ++E        I KR         ++I+ +++ +S N    TP+KK  R+S I+VSS
Sbjct: 364 FKVDSEQEALKNSQIKKR---------QSIISNNNLKSGNINTTTPQKKKNRNSVISVSS 414

Query: 419 AHKRPVSIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAILN----------------TPSS 462
           +HKRPVS+ +   I  G + +                 ++                +P+ 
Sbjct: 415 SHKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTP 474

Query: 463 SPSRKRMSI-----AQDAPPMPTSVLRDYN---------KRASRNSKRFSFLPSIKRQSI 508
           +P  KRMS+     + + PP+P  +L+DY          KRASR SKR S LP+ KR SI
Sbjct: 475 APRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSI 534

Query: 509 TSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           T+KII+TYAKLSED+DWE+I+KE KR SSDFATLID IFEHEKYEQIR+EKE L
Sbjct: 535 TTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIRKEKEEL 588

 Score =  196 bits (497), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 158/474 (33%), Positives = 237/474 (50%), Gaps = 66/474 (13%)

Query: 697  KRAVSVQTRPISRLDPGI---------MAQEVAHELDYDDEEILSERTLRREKTILETIR 747
            +R+ S+QTRP+S+LDPGI         M + V  ELD         +T+  +K ILETIR
Sbjct: 674  QRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELD---------KTIDSQKVILETIR 724

Query: 748  RSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDG 807
            RS FLGS F+I                           R S  + R VS G  ++  ++ 
Sbjct: 725  RSKFLGSSFNIDKELKQVKKDAEVKRM-----------RKSQKEDRDVS-GRIVSETNEQ 772

Query: 808  YDTTSLTRHTTV-GVLRDD--ESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMT 864
            Y+T  L ++ T  G L+DD  E EP+K+S++++P+ TR+S+  + S+KR SVLS+YS+  
Sbjct: 773  YETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQ 832

Query: 865  SYTNLADFMK-SDVQLKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPN 923
            SYTNLA+ +K   V +     + + +V+++PEF FE+    +E     +   I +    +
Sbjct: 833  SYTNLANVLKEGGVDIGVNEGSNNVEVSEEPEFQFETVGTEIENNKYEEEKEIENENNLS 892

Query: 924  NTV-IKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIY 982
                IKLNYADRF                 DT  ++ +VKLP LPPL   +K  +GLGIY
Sbjct: 893  QGANIKLNYADRF-----------------DTAGNVNEVKLPTLPPLGD-DKVSDGLGIY 934

Query: 983  QHSSPRE-DFKHAVRSVTPNENKE-----NEDPAGTTQQKAPLTSVGKELGIREPLTDLA 1036
               S  E +    V S+  N+++E     N +P        P T   K+  + +   + A
Sbjct: 935  SSKSGSEGNESKPVPSIKENKSEETLKEKNVEPKPPLNDVVPKTRDTKKTNVVQ--NNNA 992

Query: 1037 QQGVXXXXXXXXXXXXXEKIKPE-----YDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQ 1091
            +                + +  +     YD +L + V+ T+++  L  LL GW  YGLK+
Sbjct: 993  KHSSDKPRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKE 1052

Query: 1092 VRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            ++S+     I+ +LSSDNILSLRST   +VV      S + F KKSGS KT  R
Sbjct: 1053 IKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSGSSKTLKR 1106

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/589 (63%), Positives = 441/589 (74%), Gaps = 30/589 (5%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG 60
           M    N +V ++KG +IGPW LGETLG+GSTGKV +A +  T Q AA+K+ISK+IFN +G
Sbjct: 1   MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60

Query: 61  S---TFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
           S   + V ++ PD LPYGIEREI IMKLLNHPNVLRLYDVWET+++LYMVLEY +KGELF
Sbjct: 61  SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           NLL+ERGPLPE EA+RFFRQI+IGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAA
Sbjct: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           LE++DKLLETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFD++DGNIR
Sbjct: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297
            LLL+VQSG +EMP  DEIS +AQDLIA+ILTVDP  RIK R+ILKHPLL+KYPSI DSK
Sbjct: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300

Query: 298 SIRNLPREDTYLNPLDHNDGT-VDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYA 356
           SIRNLPREDTYL+PL   +   +D  IL+NLVVLWHGR++ EI+ KL E G N EKT YA
Sbjct: 301 SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360

Query: 357 LLHRFKYENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKK-RSSGIN 415
           LL RFK + E          KR+S  +   Q    K+ S+   N    +PK++ R+S I+
Sbjct: 361 LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTN---ASPKRRNRTSMIS 417

Query: 416 VSSAHKRPVSIQKW------GEIGGGNNGLIXXXXXXXXXXXXXXAILNTPSSSPS---- 465
           VSS+HKRPVS  K       G +   N+                 + + T S SP+    
Sbjct: 418 VSSSHKRPVSFNKLSNVVSPGSVPSSNSNTPSKRVSVNLSSNKRLSAVYTNSGSPTPASR 477

Query: 466 RKRMSIA-------QDAPPMPTSVLRDYN-----KRASRNSKRFSFLPSIKRQSITSKII 513
            KR+SI         D PP+P  +L+DY+     KR SRN+ R SF PS KR SIT+K+I
Sbjct: 478 HKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLI 537

Query: 514 ATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           +TYAKLSED+DWEYI+KE KRTSSDFATL D IFEHEK+EQIRREKE L
Sbjct: 538 STYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFEQIRREKEEL 586

 Score =  255 bits (651), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 186/513 (36%), Positives = 269/513 (52%), Gaps = 68/513 (13%)

Query: 663  VARRSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIMAQEVAHE 722
            V  RSVSEP ++ S+    D +  LQ +I+ +L +R  S+QTRP+SRLDPG+ + + + +
Sbjct: 659  VNGRSVSEPLQKKSA----DPMADLQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEK 714

Query: 723  LDYDDEEILSERTLRREKTILETIRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRK 782
              Y   E  ++  L  +K ILETIRRS FLGS FDI+                  +L R 
Sbjct: 715  DQYTGSEDRAK--LNNDKIILETIRRSKFLGSSFDINK-----------------ELKRA 755

Query: 783  LPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRHTTVGV-LRDD--ESEPKKLSEVRIPE 839
              +      Q   +    I++ +D Y+T  L ++ T    L+D   ++EP+K+S++++P+
Sbjct: 756  ADNEAKKQRQSKATSDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQ 815

Query: 840  VTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSDV-QLKPLNDTASSKVTQQPEFMF 898
             TR+SR    S+KR SVLSMYS+  SYTNLAD +  +    K   D+ + +   +PEF+F
Sbjct: 816  FTRKSRQFGDSNKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLF 875

Query: 899  ESTIDNVERISSNDNSHISSM-EAPNNT-----VIKLNYADRFYKPVEVIELDDTDNTQP 952
            E+  ++ E   + D+SH   + E P ++      +KLN+ADRF           T N + 
Sbjct: 876  ENVQEDGE--VTGDSSHDGRLYEVPEDSNMTKEKLKLNFADRF----------KTSNGED 923

Query: 953  DTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSSPR--EDFKHAVRSVTPNENKE----- 1005
             T ED   V+LP LPPL+   K   GLGIYQ SS    E  +H V+S+  N+  +     
Sbjct: 924  RTAED-KNVRLPTLPPLD--GKEAKGLGIYQSSSESLPEPAQHNVKSMIQNDENQPSETA 980

Query: 1006 -----NEDPAGTT-QQKAPLTSV-------GKELGIREPLTDLAQQGVXXXXXXXXXXXX 1052
                  ED A    QQ+APL +        G +   R P  + +++              
Sbjct: 981  EVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSERMPSKEGSEKKRNTSFFRKFSKSS 1040

Query: 1053 XEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILS 1112
             EK   E+D +L  +V   ++F  L  LL GW  YGLK V+S P    +TGKLSS+NILS
Sbjct: 1041 NEKTNGEFDAELYASVAAKQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILS 1100

Query: 1113 LRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            LRST F++VV     GS V F KKSGS KT  R
Sbjct: 1101 LRSTLFEMVVWSRGKGSIVGFRKKSGSTKTLKR 1133

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/571 (65%), Positives = 434/571 (76%), Gaps = 30/571 (5%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           +N+ S+KG ++GPW LGETLG+GSTGKV +A N  TG+ AA+K+ISKS+FN   +     
Sbjct: 5   NNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSL 64

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
             PD LPYGIEREI IMKLLNHPNVLRLYDVWET+++LYMVLEY EKGELFNLL+E+GPL
Sbjct: 65  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPL 124

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
            E EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAALE++DKLLE
Sbjct: 125 QEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE 184

Query: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246
           TSCGSPHYAAPEIVSG+PYHGF SDVWSCGVIL+ALLTGRLPFDE+DGNIR LLLKVQSG
Sbjct: 185 TSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSG 244

Query: 247 EFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPRED 306
           EFEMP  DEIS EAQDL+AKILTVDP  RI+ R+ILKHPLL+KYPSIKDSKSIRNLPRED
Sbjct: 245 EFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPRED 304

Query: 307 TYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYENE 366
           TYLNPL  N+ T+D+TIL+NLVVLWHGRD NEI+ KL E G N EKT YALL RFK ++E
Sbjct: 305 TYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSE 364

Query: 367 XXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTP--KKKRSSGINVSSAHKRPV 424
                   I KR  S +SS  R+  K +S         TP  +K R S I+VSS+HK+P 
Sbjct: 365 KENFKNEQIRKR-QSITSSVSRSPAKKAS---------TPQRRKNRISMISVSSSHKKPA 414

Query: 425 SIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAILNTPSSSPSRKRMSIAQDAPPMP----- 479
           S  +   +   N   +                +N   S  + K  S + ++ P P     
Sbjct: 415 SFNRLSSVVHNN---LSASSSTTTTPASKKFSMNKKLSMIADK--SNSNNSSPTPAHRNK 469

Query: 480 -TSVLR-------DYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKE 531
            TS++          NKRASR+SKR S + ++KR SIT+K+IATYAKLSED+DWEYI+KE
Sbjct: 470 RTSMINTDRQSILSKNKRASRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKE 529

Query: 532 AKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
            KRTSSDFATLID IFEHEKYEQIR+EKE L
Sbjct: 530 TKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 560

 Score =  196 bits (497), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 170/503 (33%), Positives = 236/503 (46%), Gaps = 94/503 (18%)

Query: 692  NTVLNKRAVSVQTRPISRLDPGIMAQEVA--HELDYDDEEILSERTLRREKTILETIRRS 749
            + +L +R  S+QTRPISRLDPG+   E +   E     +E +  + L  EK ILETIRRS
Sbjct: 643  DNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILETIRRS 702

Query: 750  NFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYD 809
             FLGS FDI                     NR+L       ++R +   T      +   
Sbjct: 703  KFLGSSFDI---------------------NREL----KAAEKRVMQPPTVQKLTTENKS 737

Query: 810  TTSLTRHTT-VGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTN 868
            +  L +H      L    +E  K+S++R+P+ TR+SRH + S++R SVLSMYST  S++N
Sbjct: 738  SDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSN 797

Query: 869  LADFMKSDVQLKPLND-TASSKVTQQPEFMFESTIDNVERI--SSNDN-----SHISSME 920
            L D +K+      L   T +       EF+FE+  +  E    SSND+     + + + E
Sbjct: 798  LVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAE 857

Query: 921  APNNTVIKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLG 980
             P+   +KLN+ADRF K  E       D+T+P    DI   KLP LPPL+       GLG
Sbjct: 858  KPSG--MKLNFADRFNKKEE-------DSTEPS--RDIQN-KLPVLPPLD----GKAGLG 901

Query: 981  IYQHSS--------------------------PREDFKHAV--------RSVTPNE---- 1002
            IYQ SS                          P ++ K  +        ++V+P E    
Sbjct: 902  IYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKT 961

Query: 1003 NKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGVXXXXXXXXXXXXXEKIKPEYDY 1062
             K+ E       +K P     K+   RE   +  ++ V              K K E + 
Sbjct: 962  RKDQEHDKRPVMEKKPEVVAPKQ---RESDQE-KKRSVSFFRKFSGSSISSNKSKAETEK 1017

Query: 1063 QLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVV 1122
             L T +   ++F  L +LLNGW+ YGLK VRS  S   I+GKLSSDNILSLRST F++ V
Sbjct: 1018 VLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKV 1077

Query: 1123 AGSNHGSSVRFTKKSGSKKTFAR 1145
              +   SSV   KKSGS K   R
Sbjct: 1078 TSNGESSSVLIRKKSGSSKAVLR 1100

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/577 (63%), Positives = 436/577 (75%), Gaps = 26/577 (4%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNA-- 58
           M    NS + ++K   IGPW LGETLG+GSTGKV +A+N  TGQ AAVK+ISK++FN+  
Sbjct: 1   MAVNGNS-IQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGN 59

Query: 59  -QGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
             G++ VGSN PD LPYGIEREI IMKLLNHPNVLRLYDVWET+TDLY+VLEY EKGELF
Sbjct: 60  VSGTSIVGSNTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           NLL+ERGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAA
Sbjct: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           LE++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDE+DGNIR
Sbjct: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297
            LLLKVQ GEFE+P  DEIS EAQDLI+KILTVDP  RIK R+ILKHPLL+KYPSI+DSK
Sbjct: 240 ALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSK 299

Query: 298 SIRNLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357
           SIR+LPREDTYL PL  ++ ++D TIL+NLV+LWHGRD + I  KL E G N EKT YAL
Sbjct: 300 SIRDLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYAL 359

Query: 358 LHRFKYENEXXXXXXXXIAKR--ISSASSSPQRNIVKSSSRRSINQILVTPKKKRSSGIN 415
           L+RFK + +        I KR  I S S SP +    +  RR          + R S I+
Sbjct: 360 LYRFKCDTQKELIKQQQIRKRQSIGSVSISPPKRTSTTPQRR----------RNRESIIS 409

Query: 416 VSSAHKRPVSIQKWGEIGGGNNGLIX-----XXXXXXXXXXXXXAILNTPSSSPS--RKR 468
           VSS+ K+P+S  K+      ++ L                     I+N  S +PS   KR
Sbjct: 410 VSSSRKKPISFNKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPSSRNKR 469

Query: 469 MSIAQ-DAPPMPTSVLR--DYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDW 525
            SIA  D      S+      NKRAS++++R S +PS+KR+S+T+K+++TYAKL+ED+DW
Sbjct: 470 TSIANVDKNQKRASIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDW 529

Query: 526 EYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           EYI+KE KRTSS+FATLID IFE+EKY+QIR+EKE L
Sbjct: 530 EYIEKETKRTSSNFATLIDEIFEYEKYDQIRKEKEEL 566

 Score =  182 bits (461), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 163/525 (31%), Positives = 236/525 (44%), Gaps = 94/525 (17%)

Query: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDY 725
            RS+S P +     ++ +++  L+  I+ +L +R  S+QTRP+SRLDPGI+        D 
Sbjct: 636  RSISAPME-----NEENNINHLEADIDNILRRRNFSLQTRPVSRLDPGIIFSSPIETEDP 690

Query: 726  DDEEILSERTLRREKTILETIRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPD 785
             + +      L  EK ILETIRRS FLGS F+I                         P 
Sbjct: 691  VEPKKAENERLTTEKKILETIRRSKFLGSSFNIDKELKLSQMEYPGMAA---------PQ 741

Query: 786  RISYHDQRFVSDGT----TITSAHDGYDTTSL---TRHTTVGVLRDDESEPKKLSEVRIP 838
            R+S  ++R VSD      ++    D      L   T  TT  +L +   E +K+S++R+P
Sbjct: 742  RLS--EERIVSDSNGKYESLVLPKDAKGVAHLKDNTAPTTTELLSN--GELRKISDIRVP 797

Query: 839  EVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKS---DVQLKPLNDTASSKVTQQPE 895
            + TR+SRH S S+KR SVLSMYST  S+TNL D +K+   D+  +      + +     E
Sbjct: 798  QFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDINPQQNQRVPTPRSADDSE 857

Query: 896  FMFESTIDNVERI--SSNDNS--HISSMEAPNNTVIKLNYADRFYKPVEVIELDDTDNTQ 951
            F+FE+  +  E    SSND     +      +   +KLN+ADRF                
Sbjct: 858  FLFETVNEEAEYTGNSSNDERLYDVGDSCIKDKNTLKLNFADRFNGST------------ 905

Query: 952  PDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSSPREDFKHA--VRSVTP--------- 1000
               E++   + LP LPPL   +++    G       +ED      V+S+ P         
Sbjct: 906  --NEKETKNLHLPTLPPLNGKDEA----GKQGEEQEKEDLHEQPKVKSMIPESDSLSHAE 959

Query: 1001 NENKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGVXXXXXXXXXXXXXEKIKPEY 1060
             E KE ED     QQ+      GK+L   EP  + + Q                  KP  
Sbjct: 960  KEQKERED-----QQRG-----GKDL---EPPLNKSVQKTREKNNDTQAKNQSTDPKPNK 1006

Query: 1061 DYQ--------------------LDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSM 1100
            +                      L   V+  ++F  L+KLL GW  YGLK V+S+P+   
Sbjct: 1007 NVSGNGSFFRKFSKSSTSEKSTELYAKVSAKQLFNGLEKLLRGWNQYGLKNVKSNPNNLT 1066

Query: 1101 ITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            +TGKLSS+N+ SLRST F+V +      S V F K SGS KT  +
Sbjct: 1067 LTGKLSSENMFSLRSTLFEVSIYQKGKVSVVEFKKISGSFKTVKK 1111

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/592 (62%), Positives = 437/592 (73%), Gaps = 51/592 (8%)

Query: 9   VTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQ---GSTFVG 65
           + ++KG  IGPW LGETLG+GSTGKV +A N  T Q AA+KIISKSIFN +     T + 
Sbjct: 11  IPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMV 70

Query: 66  SNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGP 125
           +N PD LPYGIEREI IMKLL H NVL LYDVWET+++LYM+LEY EKGELFNLL+E+GP
Sbjct: 71  ANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGP 130

Query: 126 LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 185
           LPE EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALE++DKLL
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLL 190

Query: 186 ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQS 245
           ETSCGSPHYAAPEIVSG+PYHGFESDVWSCGVIL+ALLTGRLPFDE+DGNIR LLLKVQS
Sbjct: 191 ETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 250

Query: 246 GEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPRE 305
           G+FEMPD DE+S +AQDLI++ILTVDP+ RIKTREILKHPLL+KYPSIKDSKSI+NLPRE
Sbjct: 251 GQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPRE 310

Query: 306 DTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYEN 365
           DTYL PL  N+  +D +IL+NLVVLWHGRD+ +I  KL E G N EKT YALL+RFK E 
Sbjct: 311 DTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370

Query: 366 EXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKK-RSSGINVSSAHKRPV 424
           E        + ++ S         I+K    +S   +   P+KK R S ++VSS+ KRPV
Sbjct: 371 ENLSAKQEQVKRKQS---------IIK----KSTANVSTPPRKKNRISTMSVSSSRKRPV 417

Query: 425 SIQKWGEIGGGN------NGLIXXXXXXXXXXXXXXAI------------------LNTP 460
           S  +   I  G       NG                +I                   N+ 
Sbjct: 418 SFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHSNGNSN 477

Query: 461 SSSPSR-KRMSIAQ----DAPPMPTSVLRDY-----NKRASRNSKRFSFLPSIKRQSITS 510
           S +PSR KR+S+       APP+P +VL+DY     + +  R SKR +FL + KR SIT+
Sbjct: 478 SPTPSRSKRISLINLDNSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGNGKRGSITT 537

Query: 511 KIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           K+++TYAKLSED++WEYI+KE KRTSSDFATLID IFEHEKYEQIR+EKE L
Sbjct: 538 KLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 589

 Score =  207 bits (528), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 174/537 (32%), Positives = 254/537 (47%), Gaps = 93/537 (17%)

Query: 643  RAELE-ETRVEQQLNSMSKNQVARRSVSEPHKRHSSTS---KRDSLLALQYSINTVLNKR 698
            R +LE +  ++Q+++++  +       +EP++   S S   +R++  A++  IN +  +R
Sbjct: 623  RQQLELQNHIDQEISNLKADLANETKGAEPYENPRSVSAPLERENPEAIERDINDLFARR 682

Query: 699  AVSVQTRPISRLDPGIM----AQEVAHELDYD-DEEILSERTLRREKTILETIRRSNFLG 753
             VS+QTRP SRLDPGI+    A+ V++ L  D D+EI       REK ILETIRRS FLG
Sbjct: 683  NVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEI------DREKKILETIRRSRFLG 736

Query: 754  SQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSL 813
            S ++I+                      K   R     Q  V+D   I            
Sbjct: 737  SSYNINKELEFAKKTALAETS-------KKEKRSKVTSQNIVADKAAIG----------- 778

Query: 814  TRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFM 873
                 V  L D E+  +K+SE+++P+ TR+SRH S S++R SVLSMYST  SYTNL D +
Sbjct: 779  -----VIPLNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDIL 833

Query: 874  K-SDVQLKP-LNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKLNY 931
            K   V L    N+T +SK + +PEF FES  +                            
Sbjct: 834  KEGGVNLASEANNTTTSKASTEPEFQFESVNEGT-------------------------- 867

Query: 932  ADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSS----- 986
            A++ Y+  E  E  D +      +++   VKLP LPPL +     NGL IYQ SS     
Sbjct: 868  ANKLYELQEEPEYTDVNKEDGKPKKN---VKLPTLPPLHEKTNQANGLAIYQSSSDDDKK 924

Query: 987  -------------PREDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKELGIREPLT 1033
                          R+D  +   SV      E E  A T +   P     K+   R+PL 
Sbjct: 925  PTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQA-TKKINKPKQRQPKKEEERKPLN 983

Query: 1034 DL-----AQQGVXXXXXXXXXXXXXEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYG 1088
            ++      ++ V                K  +DY++   V+  ++++ L +LL GW+ YG
Sbjct: 984  EMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYG 1043

Query: 1089 LKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            LK V+S  +   +TGKLS+DNILSLRST F+++V      S V F K SGS KT  R
Sbjct: 1044 LKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVVGFNKISGSSKTVRR 1100

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/585 (61%), Positives = 427/585 (72%), Gaps = 42/585 (7%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFN--- 57
           M    NS V ++K   IGPW LGETLG+GSTGKV +A+N  TGQ AAVK+ISK++FN   
Sbjct: 1   MAVNGNS-VPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGN 59

Query: 58  AQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
             G++ VGS  PD LPYGIEREI IMKLLNHPNVLRLYDVWET+ DLY+VLEY EKGELF
Sbjct: 60  VSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELF 119

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           NLL+ERGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAA
Sbjct: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           LE++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDE+DGNIR
Sbjct: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297
            LLLKVQ GEFE+P  DEIS EAQDLI++ILTVDP  RIKTR+ILKHPLL+KYPSIKDSK
Sbjct: 240 TLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSK 299

Query: 298 SIRNLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357
           SIR LPREDTYL PL  ++ ++D TIL+NLV+LWHGRD + I  KL E G N EKT YAL
Sbjct: 300 SIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYAL 359

Query: 358 LHRFKYENEXXXXXXXXIAKR----------ISSASSSPQRNIVKSSSRRSINQILVTPK 407
           L+RFK + +        I KR              S++PQR                  +
Sbjct: 360 LYRFKCDTQKELVKQQQIKKRQSISSLSISPSKKLSTTPQR------------------R 401

Query: 408 KKRSSGINVSSAHKRPVSIQKWGEIGGGNNGLIX-----XXXXXXXXXXXXXAILNTPSS 462
           K R S I+VSS+ K+P+S  K+      ++ L                     I+N  S 
Sbjct: 402 KNRESMISVSSSRKKPISFNKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSP 461

Query: 463 SPS--RKRMS---IAQDAPPMPTSVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYA 517
           +P+   KR S   I ++            NKR S++ KR S +PS+KR+S+T+K+++TYA
Sbjct: 462 TPASRNKRASVINIEKNQKRASVFSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYA 521

Query: 518 KLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           KL+ED+DWEYI+KE KRTSS+FATLID IFE+EKYEQIR+EKE L
Sbjct: 522 KLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEEL 566

 Score =  177 bits (448), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 160/496 (32%), Positives = 224/496 (45%), Gaps = 65/496 (13%)

Query: 687  LQYSINTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSE-RTLRREKTILET 745
            L   I+ +L +R  S+QTRP+SRLDPGI+      E  Y  E   SE   L  EK ILET
Sbjct: 652  LGTDIDNILRRRNFSLQTRPVSRLDPGIVFSNPI-ETVYPVEPKRSENERLTTEKKILET 710

Query: 746  IRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRIS--YHDQRFVSDGTTITS 803
            IRRS FLGS F+I                       ++   ++  Y       D   ++ 
Sbjct: 711  IRRSKFLGSSFNIEKELKLSKMEYPSVLAPEKLSGERVVSDLNGKYESLILPKDAKGVSQ 770

Query: 804  AHDGYDTTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTM 863
              D   T++ T H + G LR       K+SEVR+P+ TR+SRH S S+KR S+LSMYST 
Sbjct: 771  LKDDI-TSTTTEHLSDGKLR-------KISEVRVPQFTRKSRHFSESNKRLSLLSMYSTK 822

Query: 864  TSYTNLADFMKS---DVQLKPLNDTASSKVTQQPEFMFESTIDNVERI--SSNDNS--HI 916
             S+TNL D +K+   DV  +      + +     EF+FE+  +  E    SSND     +
Sbjct: 823  ESFTNLVDILKNSNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDV 882

Query: 917  SSMEAPNNTVIKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPL------E 970
                  + T +KLN+ADRF    E  E  +TDN           + LP+LPPL       
Sbjct: 883  GDSTIKDKTALKLNFADRFN---ESTEYKETDN-----------LHLPSLPPLSGDDEMR 928

Query: 971  KLNKSPNGLGIYQHSS--PREDFKHAVRSVTPNEN-------------KENEDPAGTTQQ 1015
            K N   + L   +  S  P+ D       V   E              K+ E P   + Q
Sbjct: 929  KQNSEEDSLVQPKVKSMIPQSDSSSHTEKVEEKEGESQEVQEESEKEAKDIEPPLNKSVQ 988

Query: 1016 K------APLTSVGKELGIREPLTDLAQQGVXXXXXXXXXXXXXEKIKPEYDYQLDTTVN 1069
            K       P     +   ++E   D    G              +K+      +L   V+
Sbjct: 989  KLREKNPGPQEKDHQRDHLKEHKQDRNTTGNSSFFRKFSKSSASDKL-----VELYAKVS 1043

Query: 1070 NTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNHGS 1129
              ++F  L+KLL GWT +GLK ++S P+   +TGKLSS+NI SLRST F++ +      S
Sbjct: 1044 ARQLFNGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIYPKGRMS 1103

Query: 1130 SVRFTKKSGSKKTFAR 1145
             V+F K SGS K   +
Sbjct: 1104 VVQFKKISGSFKAVKK 1119

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/612 (60%), Positives = 440/612 (71%), Gaps = 65/612 (10%)

Query: 4   KDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFN------ 57
           K N +  ++ G  IGPW LGETLG GSTGKV +A N QT Q AA+KIISKS+F+      
Sbjct: 3   KANISDVTVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSN 62

Query: 58  ------------AQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLY 105
                         GS     ++ + LPYGIEREI IMKLLNH NVLRLYDVWET+ +LY
Sbjct: 63  NNNNSALAASDVNNGSV---QHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLY 119

Query: 106 MVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK 165
           MVLEY EKGELFNLL+E+GPL ENEAVRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK
Sbjct: 120 MVLEYAEKGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHK 179

Query: 166 FNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTG 225
            NIK+ADFGMAALE++DKLLETSCGSPHYAAPEIVSGLPY+G E+D+WSCGVIL+ALLTG
Sbjct: 180 SNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTG 239

Query: 226 RLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHP 285
           RLPFDE+DGNIR LLLKVQ GEFEMP  DE+S+EAQDLI KILTV+P  RIKTREILKHP
Sbjct: 240 RLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHP 299

Query: 286 LLKKYPSIKDSKSIRNLPREDTYLNPLDHNDGT---VDRTILKNLVVLWHGRDENEIVMK 342
           LL+KYP+IKDSK+IR+LPREDTYLNPL  N+G    +D +IL+NL VLWHG+D+NEI+ K
Sbjct: 300 LLQKYPNIKDSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKK 359

Query: 343 LNEQGPNLEKTFYALLHRFKYENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQI 402
           L E G N EKT Y LLHRFK + E        + KR S         ++K+SS  S NQ 
Sbjct: 360 LKEPGANAEKTLYVLLHRFKEDTERENHKNSQLRKRQS---------LMKASSSSSSNQG 410

Query: 403 LVTPKKK-RSSGINVSSAHKRPVSIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAI----- 456
            V  ++K R+S I+V+S+HK+PVS  K   +GG +  +I               I     
Sbjct: 411 NVPRRRKNRNSMISVTSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLS 470

Query: 457 ----------LNTPSSSPS---RKRMSIAQ-------DAPPMPTSVLRDY------NKRA 490
                       + SSSP+   R R S  Q       +APP+P  VL+DY      NKR 
Sbjct: 471 SSNKRNSRLYTQSNSSSPTPAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQNKRG 530

Query: 491 SRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHE 550
           SR SKR+SFL + KR S+T+KI++TYAKL+ED+DWE+I+KE KR SSDFATLID IFEHE
Sbjct: 531 SRLSKRYSFLLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHE 590

Query: 551 KYEQIRREKEGL 562
           K+E+IR+EKE L
Sbjct: 591 KFEKIRKEKEEL 602

 Score =  191 bits (485), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 171/512 (33%), Positives = 239/512 (46%), Gaps = 87/512 (16%)

Query: 660  KNQVARRSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIMAQEV 719
            +N +  RSVSEP K   +  K                +R  S+QTRPISRLDPG+M  ++
Sbjct: 670  ENPINSRSVSEPVKNGGTDEK---------------GQRNFSLQTRPISRLDPGLMFSKL 714

Query: 720  AHELDYDDEEILSER-TLRREKTILETIRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQ 778
                D D+   + E  T+  +KTILETIRRS FLGS FDI+                  Q
Sbjct: 715  G---DVDNNSSVDENLTMNNQKTILETIRRSKFLGSSFDINKELNNANEERKRLRQLQLQ 771

Query: 779  LNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRHTTVGV--LRDDES--EPKKLSE 834
              ++L ++       +VS+   + S +             +GV  L+D  S  EP+K+SE
Sbjct: 772  KQKELEEKERIASTSYVSNENQVLSKN------------AIGVVDLKDFSSDVEPRKISE 819

Query: 835  VRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSDVQLKPLNDTASSKVTQQP 894
            V++P+ TR+S++ S S+KR SVLS YS+  SYTNL D +K +    P+ D     VT+ P
Sbjct: 820  VQVPQFTRKSKYFSESNKRLSVLSFYSSKQSYTNLVDMIKEN----PVED---EDVTEDP 872

Query: 895  EFMFE-STIDNVERISSNDNSHISSMEAP------------NNTVIKLNYADRFYKPVEV 941
             F FE S  D +E    N+     S E P            N+  +KLN+ADRF      
Sbjct: 873  GFNFEDSQYDYLEE--KNEAPLEVSDEVPKEVDDKVQEEEKNSVSMKLNFADRFSNV--- 927

Query: 942  IELDDTDNTQPDTEEDITKVKLPALPPLEKLNKS-PNGLGIYQHSSPREDFKHAVRSVTP 1000
                +++  Q  + ED    K P +     L+KS   GLG+Y  +   E     V+S+ P
Sbjct: 928  ----NSNTKQESSFED----KFPNI-----LSKSGTEGLGLYSKNEKTE--PKPVKSMIP 972

Query: 1001 NENKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGVXXXXXXXX-------XXXXX 1053
             E+K N  P      +APL  V  +       T     G                     
Sbjct: 973  EEDKVNSSPV----VEAPLNKVVNKTRAENKSTSKGPSGSQKVSNTSSFLRKISGKSSNS 1028

Query: 1054 EKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSL 1113
               K  ++  L ++V  T++F  L  LL GWT+YGLK V+      MI GKLS+DNILSL
Sbjct: 1029 TVAKGAFEVNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILSL 1088

Query: 1114 RSTAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            RST  ++ V   +  S +   KKSGS KT  R
Sbjct: 1089 RSTIVELCVFTESKFSVIGIRKKSGSSKTMRR 1120

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/586 (61%), Positives = 430/586 (73%), Gaps = 46/586 (7%)

Query: 6   NSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF-NAQGSTFV 64
           N    ++KG +IG W +GETLG+GSTGKV +A N  TG  AA+K+ISK+IF ++  ++ V
Sbjct: 4   NKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMV 63

Query: 65  GSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERG 124
            +  PD LPYGIEREI IMKLLNH NVLRLYDVWET+++LYMVLEY EKGELFNLL+ERG
Sbjct: 64  DNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERG 123

Query: 125 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 184
           PLPENEA+RFFRQIIIGISYCHALGIVHRDLKPENLLLD K+NIK+ADFGMAALE++DKL
Sbjct: 124 PLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL 183

Query: 185 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQ 244
           LETSCGSPHYAAPEIVSG+PYHGF SDVWSCGVILYALLTGRLPFDE+DGNIR LLLKVQ
Sbjct: 184 LETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQ 243

Query: 245 SGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPR 304
           +G+FEMP+ DEIS EAQ+LI+KIL V+P+ RI  R+ILKHPLL+KYPSIKDSKSIRNLPR
Sbjct: 244 AGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPR 303

Query: 305 EDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYE 364
           EDTYL+PL   +  +D  IL+NLVVLWHGRD  EI +KL E G N EKT YA+L+RFK +
Sbjct: 304 EDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLD 363

Query: 365 NEXXXXXXXXIAKRIS---SASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAHK 421
            E        +  R S   S S +P  N   + +R S N+     KK R+S I+V+S+HK
Sbjct: 364 VEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSSHK 423

Query: 422 RPVSIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAILNTPSSSPSRKRMSIAQDAP----- 476
           RP+S QK   +                      AI  TPS+S  RKR+S     P     
Sbjct: 424 RPISFQKLPTLNS---------------TSSLAAI--TPSTSARRKRLSKISGYPVSNVN 466

Query: 477 --PMP----------------TSVLRDYN--KRASRNSKRFSFLPSIKRQSITSKIIATY 516
             P P                +S ++  N  K+ +R SKR S LP+ K  +I SK+I+TY
Sbjct: 467 GSPTPASRKKRNSMANIQAARSSTIKKTNTFKKNNRASKRVSILPNNKNGTIASKLISTY 526

Query: 517 AKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           AKLSED++WEY+++E KRTSS+FATLID IFEHEKYEQIR+EKE L
Sbjct: 527 AKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIRKEKEEL 572

 Score =  171 bits (434), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 160/542 (29%), Positives = 246/542 (45%), Gaps = 92/542 (16%)

Query: 645  ELEETRVEQQLNSMS-KNQVARRSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQ 703
            E E   ++++L+ MS + +   RSVSEP  +            ++  +  +L +R  ++Q
Sbjct: 616  EEEIENLKKELDMMSHEGKTESRSVSEPLNKKQG--------GVEIEVKELLRQRNAALQ 667

Query: 704  TRPISRLDPGIMAQEVAHELDYDDEEILS---ERTLRREKTILETIRRSNFLGSQFDIHX 760
            TRP SRLDPG+       +      ++     +  L+ EK ILETIRRS FLGS FDI  
Sbjct: 668  TRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAILETIRRSKFLGSSFDISK 727

Query: 761  XXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRHTTVG 820
                                     R  Y      + G  IT+  +   +  L ++    
Sbjct: 728  ELKSASA------------------RSDYSR----APGRVITAPSNLERSDVLPKNAIAT 765

Query: 821  V---LRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSDV 877
                +  D+ E +K+S++++P+ TR+SR+ S SSKR SVLSMYST  S+ NL+D M  + 
Sbjct: 766  APLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFES 825

Query: 878  Q----LKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTV------- 926
            +     +     A+     Q EF+FES   N E  ++N+ S    +   + +        
Sbjct: 826  ENTDAAENRGQIATPNSAGQSEFLFESV--NEEAENTNNTSTDGKLYEVSESPESSSKKG 883

Query: 927  IKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQ--- 983
            +++N +DR+ K           N++ D E      KLP LPPL+       GLGIYQ   
Sbjct: 884  LRVNLSDRYNKA----------NSEADMEN-----KLPILPPLD---PEIAGLGIYQDQP 925

Query: 984  ---HSSPREDFKHAVRSVTPNENKENE----DPAGTTQQKAPLTSV--GKELGIREPLTD 1034
               ++ P+E  K   +S    +  E E    D      +KAP   +   K+L  ++   D
Sbjct: 926  EEVNAKPQEK-KSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEKKKLDAKKQRND 984

Query: 1035 LAQQGVXXXX-----------XXXXXXXXXEKIKPEYDYQLDTTVNNTKMFRALDKLLNG 1083
               +                          +K K   +  + TTV+ T+M++ L  LL G
Sbjct: 985  ERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLYNLLRG 1044

Query: 1084 WTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTF 1143
            W SYGLK ++ +     ITGKL+S+NILSLRST F++++     GS V   KKSGS K  
Sbjct: 1045 WGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDIKKKSGSTKAV 1104

Query: 1144 AR 1145
             R
Sbjct: 1105 NR 1106

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/577 (62%), Positives = 431/577 (74%), Gaps = 26/577 (4%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNA-- 58
           M    NS V ++K   IGPW LGETLG+GSTGKV +A+N  TGQ AAVK+ISK++FNA  
Sbjct: 1   MAVNGNS-VPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGN 59

Query: 59  -QGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
             G++ VGS  PD LPYGIEREI IMKLLNHPNVLRLYDVWET+TDLY+VLEY EKGELF
Sbjct: 60  MSGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           NLL+ERGPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAA
Sbjct: 120 NLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           LE++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDE+DGNIR
Sbjct: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297
            LLLKVQ G+FE+P  DE+S EAQDLI KILTVDP  RIK R+ILKHPLL+KYPSI+DSK
Sbjct: 240 TLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSK 299

Query: 298 SIRNLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357
           SIR LPREDTYL PL  ++ ++D TIL+NLV+LWHGRD + I  KL E G N EKT YAL
Sbjct: 300 SIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYAL 359

Query: 358 LHRFKYENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTP--KKKRSSGIN 415
           L+RFK + +        I K          R  + S S  S N+I  TP  +K R S I+
Sbjct: 360 LYRFKCDTQKELIRQQQIKK----------RQSISSVSTSSPNKISTTPQRRKNRESIIS 409

Query: 416 VSSAHKRPVSIQKWGEIGGGNNGLIXXXXXXX-----XXXXXXXAILNTPSSSPS--RKR 468
           V+S+ K+P+S  K+      ++ L                     I+N  S +P+   KR
Sbjct: 410 VTSSRKKPISFNKFTASSASSSNLTTPGSSKRLSKNFSSKKRLSTIVNQASPTPASRNKR 469

Query: 469 MSIAQ-DAPPMPTSVLR--DYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDW 525
            SI   D      SV      NK+ SR++K+ S +PS+KR+S+T+K+++TYAKL+ D+DW
Sbjct: 470 TSIINVDKNQRRASVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAKLAADDDW 529

Query: 526 EYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           EYI+KE KRTSS+FATLID IFE+EKYE+IR+EK+ L
Sbjct: 530 EYIEKETKRTSSNFATLIDEIFEYEKYEKIRKEKKEL 566

 Score =  187 bits (476), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 169/525 (32%), Positives = 244/525 (46%), Gaps = 87/525 (16%)

Query: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIM-AQEVAHELD 724
            RS+S P +     S+  ++  L+  I+ +L +R  S+QTRP+SRLDPGIM +  V  E  
Sbjct: 636  RSISAPME-----SEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESA 690

Query: 725  YDDEEILSERTLRREKTILETIRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLP 784
             + +   +ER L  EK ILETIRRS FLGS F+I                         P
Sbjct: 691  VEPKRTENER-LTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVP---------P 740

Query: 785  DRISYHDQRFVSDGT----TITSAHDGYDTTSLTRHT--TVGVLRDDESEPKKLSEVRIP 838
             R+S  ++R VSD +    ++    D    + L  H   T G L  +  E +K+SEVR+P
Sbjct: 741  QRLS--EERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSN-GELRKISEVRVP 797

Query: 839  EVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKS---DVQLKPLNDTASSKVTQQPE 895
            + TR+SRH S S+KR SVLSMYS+  S+TNL D +K+   DV  +      + K     E
Sbjct: 798  QFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSE 857

Query: 896  FMFESTIDNVERI--SSNDNS--HISSMEAPNNTVIKLNYADRFYKPVEVIELDDTDNTQ 951
            F+FE+  +  E    SSND     +      + + +KLN+ADRF                
Sbjct: 858  FLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRF--------------NA 903

Query: 952  PDTEEDITKVKLPALPPL---EKLNKSPNG--LGIY-------------QHSSP------ 987
               E++   + LP LPPL   +++NK  +   LGI               H+        
Sbjct: 904  STNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTGKEEEKEE 963

Query: 988  -----REDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKELGI--REPLTDLAQQGV 1040
                 RED +   +       K+ E P   + QK      G ++    REP  D    G 
Sbjct: 964  KGEEGREDQEKDAKGA-----KDIEPPLNKSVQKTRANDSGPQVKSHPREPKKDRNISGN 1018

Query: 1041 XXXXXXXXXXXXXEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSM 1100
                         +K       +L   V+  ++F  L+KLL GWT YGLK ++S P+   
Sbjct: 1019 GSFFRKFSKSSTSDK-----SVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLT 1073

Query: 1101 ITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            +TGKLSS+NI SLRST F++ +      S V+F K SG+ K   +
Sbjct: 1074 LTGKLSSENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKK 1118

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/587 (60%), Positives = 430/587 (73%), Gaps = 46/587 (7%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFN--- 57
           M    NS + ++K   IGPW LGETLG+GSTGKV +A+N  TGQ AAVK+ISK++FN   
Sbjct: 1   MAINGNS-IPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGN 59

Query: 58  AQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
             G++ VGS  PD LPYGIEREI IMKLLNHPNVLRLYDVWET+TDLY+VLEY EKGELF
Sbjct: 60  VSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           NLL+ERGPLPE+EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAA
Sbjct: 120 NLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           LE++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDE+DGNIR
Sbjct: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297
            LLLKVQ GEFEMP  DEIS EAQDLI KILTVDP  RIKTR+ILKHPLL+KYPSI+DSK
Sbjct: 240 TLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSK 299

Query: 298 SIRNLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357
           SIR LPREDTYL PL  ++ ++D TIL+NLV+LWHGRD   I  KL E G N EKT YAL
Sbjct: 300 SIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYAL 359

Query: 358 LHRFKYENEXXXXXXXXIAKR----------ISSASSSPQRNIVKSSSRRSINQILVTPK 407
           L+RFK + +        + KR              S++PQR                  +
Sbjct: 360 LYRFKCDTQKELIKQQQVKKRQSISSVSVSPSKKVSTTPQR------------------R 401

Query: 408 KKRSSGINVSSAHKRPVSIQKWGEIGGGNNGLIX-----XXXXXXXXXXXXXAILNTPSS 462
           + R S I+V+S+ K+P+S  K+      ++ L                     I+N  S 
Sbjct: 402 RNRESLISVTSSRKKPISFNKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSP 461

Query: 463 SPS--RKRMSIA-----QDAPPMPTSVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIAT 515
           +P+   KR S+      Q    + ++  +  NKR+SR+ KR S +PS+KR+S+T+K+++T
Sbjct: 462 TPASRNKRASVINVEKNQKRASIFSTTKK--NKRSSRSIKRMSLIPSMKRESVTTKLMST 519

Query: 516 YAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           YAKL+ED+DWEYI+KE KRTSS+FATLID IFE+EKYEQIR+EKE L
Sbjct: 520 YAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEEL 566

 Score =  182 bits (463), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 165/559 (29%), Positives = 252/559 (45%), Gaps = 96/559 (17%)

Query: 641  KLRAELEETRVEQQLNSMSKNQVAR--RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKR 698
            K + E++ + +EQ+L+   + ++    RS+S P +     ++  ++  L+  I+ +L +R
Sbjct: 609  KKQIEIDISDLEQELSKHKEEKLDGNIRSISAPME-----NEEKNINHLEVDIDNILRRR 663

Query: 699  AVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRSNFLGSQFDI 758
              S+QTRP+SRLDPGIM      E+   + +      L  EK ILETIRRS FLGS F+I
Sbjct: 664  NFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSSFNI 723

Query: 759  HXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRH-T 817
                                     P R+S  ++R VSD      ++DGY++  L +   
Sbjct: 724  DKELKLSKMEYPSIIA---------PQRLS--EERVVSD------SNDGYESLILPKDGN 766

Query: 818  TVGVLRD--------DESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNL 869
             V  L+D         +   +K+SE+R+P+ TR+SRH S S+KR SVLSMYST  S+TNL
Sbjct: 767  GVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNL 826

Query: 870  ADFMKS---DVQLKPLNDTASSKVTQQPEFMFESTIDNVERI--SSNDNS--HISSMEAP 922
             D +K+   DV  +      + +     EF+FE+  +  E    SSND     +      
Sbjct: 827  VDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIK 886

Query: 923  NNTVIKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIY 982
            + + +KLN+ADRF    E  + D+              + LP LPPL   N+      + 
Sbjct: 887  DKSALKLNFADRFNGSNEAKQTDN--------------LHLPILPPLNGDNE------LR 926

Query: 983  QHSSPREDFKH-AVRSVTPNENKENEDPAGTT------------QQKAPLTSVGKELGIR 1029
            + +S   D  H  ++S+ P     +                   +Q+       K +   
Sbjct: 927  KQNSQEGDQAHPKIKSMIPESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEKREKVVDDM 986

Query: 1030 EPLTDLAQQGVXXXXXXXXXXXXXEKIKPEYDYQLDTTVNNTKMFR-------------- 1075
            EP  + + Q +             +    E+    +T + N   FR              
Sbjct: 987  EPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNGSFFRKFSKSSDKTMELYA 1046

Query: 1076 ---------ALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSN 1126
                      L+KLL GWT YGLK ++S P+   +TGKLSSDNI SLRST F+V +    
Sbjct: 1047 KISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIYPRG 1106

Query: 1127 HGSSVRFTKKSGSKKTFAR 1145
              S V+F K SGS K   +
Sbjct: 1107 KMSVVQFKKVSGSFKAVKK 1125

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/594 (61%), Positives = 429/594 (72%), Gaps = 46/594 (7%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQ- 59
           M   +  +  +++G ++GPW LGETLG GSTGKV +A N  T Q AAVK ISK+IF+A+ 
Sbjct: 1   MSGMNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKT 60

Query: 60  --GSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
             G++ + ++ PD LPYGIEREI IMKLLNHPNVLRLYDVWET+  LYMVLEY EKGELF
Sbjct: 61  APGNSSIAASTPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELF 120

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           NLL+E GPLPENEAV FFRQIIIG+SYCHALGIVHRDLKPENLLLDH  NIK+ADFGMAA
Sbjct: 121 NLLVENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAA 180

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           LE++DKLLETSCGSPHYAAPEIVSG+PYHGF SD+WSCGVI +ALLTGRLPFDE+DGNIR
Sbjct: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIR 240

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297
            LLLKVQSG+FEMPD DEIS EAQDL+AKILTVDP  RIK REILKHPLL+KYP++ D+K
Sbjct: 241 NLLLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNK 300

Query: 298 SIRNLPREDTYLNPL-DHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYA 356
           SIRNLPREDTYL+PL D     VD+ IL+NLVVLWHGR   EI  KL + G N EKT YA
Sbjct: 301 SIRNLPREDTYLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYA 360

Query: 357 LLHRFKYENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKK-RSSGIN 415
           LL RFK + E        I KR S   +              +N   V+PKK+ R+S IN
Sbjct: 361 LLARFKNDTEREAARQKQIKKRSSLNGTGA-----------GVNNNHVSPKKRNRASTIN 409

Query: 416 VSSAHKRPVSIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAILN----------------- 458
            SS+HKRPVS+ K   + G +N                   +N                 
Sbjct: 410 ASSSHKRPVSLIK---LSGSSNSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTVKTQGNGG 466

Query: 459 TPSSSPSRKRMSIAQD-----APPMPTSVLRDYNK-----RASRNSKRFSFLPSIKRQSI 508
           +P+ +   KR+SI +      APP+P  +L+DYNK     R SR S R SF P+ KR S+
Sbjct: 467 SPTPASRSKRVSIIESDKNGGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSV 526

Query: 509 TSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           T+K+I+TYAKLSE++DWEYI+KE KRTSSDFATLID IFEHEK+EQIR+EK  L
Sbjct: 527 TTKLISTYAKLSEEDDWEYIEKETKRTSSDFATLIDEIFEHEKFEQIRKEKAEL 580

 Score =  175 bits (443), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 143/413 (34%), Positives = 211/413 (51%), Gaps = 66/413 (15%)

Query: 649  TRVEQQLNSMSKNQVARRSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPIS 708
            T  E  ++S ++     RSVS P +R     KRDS++ +Q  I  +  +R +S+QTRP+S
Sbjct: 628  TDTESDVHSNNQAPNGVRSVSAPLERK----KRDSMVNVQSDIEEIFGQRTMSLQTRPVS 683

Query: 709  RLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRSNFLGSQFDIHXXXXXXXXX 768
            RLDPG+   E ++E +  D E   E+ LR +K ILETIRRS FLGS FDI          
Sbjct: 684  RLDPGLFYAEESNEPEAGDTE--EEKKLRTQKNILETIRRSKFLGSSFDIGKELQ----- 736

Query: 769  XXXXXXXXXQLNRKLPDRISY-HDQRFVSDGTTITSAHDGYDTTSL-TRHTTVGVLRDDE 826
                       N +L  + S  H  R      T++  ++ YDT  L T+      LRD  
Sbjct: 737  -----------NEELKKKASQPHRDR------TVSQTNEPYDTRVLPTQAVATAPLRD-- 777

Query: 827  SEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMK----SDVQLKPL 882
             EP+K+SE+ +P+ TR+SR  S S+KR SVLSMYST  SY NL++ +     SD +L   
Sbjct: 778  QEPRKISEISVPQFTRKSRFFSDSNKRLSVLSMYSTKHSYNNLSNLLNDSDASDGRLNSA 837

Query: 883  NDTASSKVTQQPEFMFE-----STIDN-VERISSNDN--SHISSMEA----PNNTV---- 926
             + +  K  ++PEF FE     S  DN + R+S+ND    ++S        P++ +    
Sbjct: 838  AEYSDVKGKKEPEFQFEAVREASDEDNGISRLSNNDERLRNVSGTSGGSGVPHDNLSSKH 897

Query: 927  -IKLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHS 985
             +KLN+ADRF         D+      ++      VKLP LPPL+  +++ NGLGIYQ S
Sbjct: 898  NMKLNFADRF-------SADEPTAGSSNSSSASKNVKLPTLPPLDGTSEA-NGLGIYQSS 949

Query: 986  SPREDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQ 1038
            S  E F+  V    P    + +D +   +Q+      G+E  ++    D A +
Sbjct: 950  S--ESFRDIVE---PTPKSKLQDNSSNPEQEVEEEVAGREGSVKHSAIDTASK 997

 Score = 89.4 bits (220), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%)

Query: 1054 EKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSL 1113
            EK    +D +++TTV+  ++F  L  LL+GWT YGLK VRS P    +TGKL+S+NILSL
Sbjct: 1081 EKDTTGFDGEINTTVSAKQLFLGLQNLLHGWTQYGLKDVRSHPEKMTLTGKLTSENILSL 1140

Query: 1114 RSTAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            RST F++VV      S V F KKSGS K   R
Sbjct: 1141 RSTLFEMVVWSRGKVSVVGFRKKSGSSKAMRR 1172

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/594 (59%), Positives = 429/594 (72%), Gaps = 56/594 (9%)

Query: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG 60
           M    ++ V+ +K  +IGPW LGETLG GSTGKVL+A N  T Q AAVK+ISK++F A  
Sbjct: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60

Query: 61  STFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLL 120
           ++    +  + LPY IE+EI IMKLLNHPNVLRL+DVWET++DLY+VLEY EKGELFN+L
Sbjct: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120

Query: 121 IERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 180
           +ERGPLPENEAVR FRQIIIGISYCH+LG+VHRDLKPENLLLD+K NIK+ADFGMAALES
Sbjct: 121 VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALES 180

Query: 181 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLL 240
           +DKLLETSCGSPHYAAPEI+SGLPY GF SDVWSCGVIL+ALLTGRLPFDE+DGNIR LL
Sbjct: 181 EDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIR 300
           LKVQ GEFEMPD DEI+ EAQDL+A++LTVDPS RI  REILKHPLL+KYPSIKDS+SIR
Sbjct: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIR 300

Query: 301 NLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHR 360
           NLPREDTYL+PL   +  +D  IL+NLV+LWHG+D  EI  KL E G N EKT YALL+R
Sbjct: 301 NLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYR 360

Query: 361 FKYENEXXXXXXXXIAKRISSASSSPQRN-IVKSSSRRSIN-QILVTPKKKRSSGINVSS 418
           FK + +         A R    S   QRN  ++S++  S + +   TP+KK      ++S
Sbjct: 361 FKCDTQRE-------ANRARRQSKIVQRNSTIRSTAPESPSKKKTYTPQKKNKRASIIAS 413

Query: 419 AHKRPVSIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAILNTPSSS-------PSRKRMSI 471
           + KRPVS+ K                          +I  TP S+        +RKRMS 
Sbjct: 414 SSKRPVSVTKTA-----------------TNITVNSSITGTPKSAKRMSMNNSARKRMSA 456

Query: 472 ---AQDAP--------------------PMPTSVLRDYNKRASRNSKRFSFLPSIKRQSI 508
               +D+P                    P  + +   +NKRAS++SKR S +P++KRQS+
Sbjct: 457 LYGTRDSPTKTSRSRRSSIITKDFLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSV 516

Query: 509 TSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           T+K++ATYAKLSED+DWEYI++E KRTSSDFATLID IFE+EKYEQIR+EK  L
Sbjct: 517 TTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAEL 570

 Score =  158 bits (399), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 160/562 (28%), Positives = 244/562 (43%), Gaps = 126/562 (22%)

Query: 642  LRAELEETRVEQQLNSMSK------------------NQVARRSVSEPHKRHSSTSKRDS 683
            L+  LE  R+E+Q   +++                  N+   RSVSEP +     SK   
Sbjct: 593  LQERLERERIEKQKEDIARQMDEEISNLKKELVGDQDNEDKFRSVSEPLE-----SKSKK 647

Query: 684  LLALQYSINTVLNKRAVSVQTRPISRLDPGI--------MAQEVAHELDYDDEEILSERT 735
            +  ++  I+ +L  R  S+QTRP+SRLDPGI          Q V   ++ + E  L E  
Sbjct: 648  IEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPE--LEET- 704

Query: 736  LRREKTILETIRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFV 795
               E+ ILETIRRS FLGS FDI                      +K  + +  H Q   
Sbjct: 705  ---EQKILETIRRSKFLGSSFDI----------------------KKELENVKRHRQ--- 736

Query: 796  SDGTTITSAHDGYDTTSLTRHTTVGVLRDDES-EP--KKLSEVRIPEVTRRSRHLSASSK 852
                T           +L       V + + S +P  +K+S++++P+ TR+SRH S S++
Sbjct: 737  ----TSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNR 792

Query: 853  RFSVLSMYSTMTSYTNLADFMKSDVQLKPLNDTASSKVTQQPEFMFESTIDNVE---RIS 909
            R SVLSMYST  SY+NLAD +K+    K +  TA +  +         TID  +    +S
Sbjct: 793  RLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVS 852

Query: 910  SNDNSHISSMEAPNNTVIKLNYADRFYKPVEVIELDDTDNTQ-PDTEEDITKVKLPALPP 968
              +  +  + E+ N             K +++ +L +++ +     EE    +KLP LPP
Sbjct: 853  REERLYEVAEESENELA---------NKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPP 903

Query: 969  LEKLNKSPNGLGIYQHSSPREDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKELGI 1028
            L            ++  S +E  K   +S+ P      E+   +  QK    +   E G 
Sbjct: 904  L------------FEDGSTKET-KEQSKSMIP------ENMQSSESQKQIEKNNSDEGGS 944

Query: 1029 REPLT----DLAQQGVXXXXXXXXXXXXXEKIKPE---------------------YDYQ 1063
              P      D++ +GV             E++  +                      D  
Sbjct: 945  LNPFMTKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRKLSKGSSSSKDNVDVT 1004

Query: 1064 LDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVA 1123
            L T+V++ ++F  L  LL GWT YGLK +    +   ITGKL++DNILS RSTAF +++ 
Sbjct: 1005 LSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIF 1064

Query: 1124 GSNHGSSVRFTKKSGSKKTFAR 1145
                GS+V F K SGS K   R
Sbjct: 1065 SQEKGSAVTFRKVSGSGKAVRR 1086

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/581 (61%), Positives = 427/581 (73%), Gaps = 61/581 (10%)

Query: 10  TSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG----STFVG 65
           T +KG  IGPW LG+TLG+GSTGKV +A N  T Q AA+KIISKSIF +QG    S+ V 
Sbjct: 8   TKMKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIF-SQGTVGESSMVS 66

Query: 66  SNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGP 125
           ++ PD LPYGIEREI IMKLL HPNVL LYDVWET++ LYM+LEY EKGELFNLL+ERGP
Sbjct: 67  NSSPDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGP 126

Query: 126 LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 185
           LPE EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK NIK+ADFGMAALE+KDK+L
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKML 186

Query: 186 ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQS 245
           ETSCGSPHYAAPEIVSG+PYHGF+SDVWSCGVIL+ALLTGRLPFDE+DGNIR LLLKVQS
Sbjct: 187 ETSCGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQS 246

Query: 246 GEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPRE 305
           GE+EMPD DEIS EAQDLI +ILTVDP  RIKTR+ILKHPLL+KYPSIKDS+SI+NLPRE
Sbjct: 247 GEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPRE 306

Query: 306 DTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYEN 365
           DTYL PL  N+  +D +IL+NLV LWHGRD+++I  KL E G + EKT YALL+RFK E 
Sbjct: 307 DTYLYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEA 366

Query: 366 EXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSSGINVSSAHKRPVS 425
           E              +  SSP+R                   K R S I+VSS+HKRPVS
Sbjct: 367 EKM------------NTCSSPRR-------------------KNRISMISVSSSHKRPVS 395

Query: 426 IQKWGEIGGG---NNGLIXXXXXXXXXXXXXXAILNTPSS-SPSR-KRMSIA-------Q 473
           ++K   +      +N  +               + +T SS +PSR KR+S+        +
Sbjct: 396 MKKISTVQNNTPPSNRRLSISLSSTQRKRMSGILQHTNSSPTPSRTKRISVINIDDSENK 455

Query: 474 DAPPMPTSVLRDYNKRASRNSKRFSF------------LPSIKRQSITSKIIATYAKLSE 521
             PP+P  +L DY K  S+N +R               L + KR SIT+K+++TYAKLSE
Sbjct: 456 APPPVPMEMLEDY-KNNSKNVRRTIKKKKKKKNNYRLTLVNNKRVSITTKLLSTYAKLSE 514

Query: 522 DNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREKEGL 562
           D++WEYI++E KRTSSDFATLID +FEHEKYE+IR+EKE L
Sbjct: 515 DDNWEYIERETKRTSSDFATLIDELFEHEKYERIRKEKEEL 555

 Score =  162 bits (410), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 148/471 (31%), Positives = 209/471 (44%), Gaps = 111/471 (23%)

Query: 696  NKRAVSVQTRPISRLDPGIMAQEVAHELDYDD---EEILSERTLRREKTILETIRRSNFL 752
            N+R  S+QTRP+SRLDPGI+    A    Y+     E  ++ + ++++ ILETIRRS FL
Sbjct: 627  NRRQFSLQTRPVSRLDPGILYSAPAEIPSYERVVVNESGNKSSAQQQRKILETIRRSKFL 686

Query: 753  GSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTS 812
            GS F+I                                +  F      + +     D   
Sbjct: 687  GSSFNIQ------------------------------QELEFSQRNVLVPTKEQVVDVDE 716

Query: 813  LTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADF 872
            +      G LR       K+SEV+IP+ TR+SRH S S+KR SVLSMYST  SYTNL   
Sbjct: 717  VKLE---GGLR-------KISEVKIPQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHI 766

Query: 873  MKSDVQLKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKLNYA 932
            +K   +        S    + PE +FES  D                             
Sbjct: 767  LKDGTE-------ESEPAKKTPELLFESGRD----------------------------- 790

Query: 933  DRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEK-------LNKSP-NGLGIY-- 982
            DR Y   EV      +    + +EDI  V LP LPPL++        N++  NGL I+  
Sbjct: 791  DRLY---EV----SEEPEIQEEKEDIETVTLPQLPPLKQSANTNANANETEINGLAIFRP 843

Query: 983  QHSSPREDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGVXX 1042
            + +   ED    V+ V P+++   + P      K  L     E+     L ++A   V  
Sbjct: 844  KENIELEDITKEVKEVIPSQDHGKDKPIAINNPKQRL-----EVKPERQLDEIAPNKVGT 898

Query: 1043 XXXXXXXXXXXE------KIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSP 1096
                       +       IK  YD+++   + + +++  L KLL GWT YGLK VRS  
Sbjct: 899  TEKKRNVSFFRKFSNNSATIKG-YDHEIYVNIGSRQLYTGLRKLLEGWTQYGLKDVRSDN 957

Query: 1097 SVSMITGKLSSDNILSLRSTAFQVVV--AGSNHGSSVRFTKKSGSKKTFAR 1145
            +   ITGKL++DNILSLRST F+++V   GS + S + FTK  GS K   R
Sbjct: 958  TAMKITGKLANDNILSLRSTLFELLVEPKGSKY-SLIGFTKVQGSSKVVRR 1007

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/515 (61%), Positives = 369/515 (71%), Gaps = 39/515 (7%)

Query: 12  LKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSN--DP 69
           +KG  +GPW LGETLG+GSTGKV +A N  TGQ AA+K+ISK++FN   +    S    P
Sbjct: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANASDSALLTP 71

Query: 70  DVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPEN 129
           D LPYGIEREI IMKLLNHPNVLRLYDVWET ++LYMVLEY EKGELFNLL+ERGPLPEN
Sbjct: 72  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN 131

Query: 130 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSC 189
           EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAALE++DKLLETSC
Sbjct: 132 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 191

Query: 190 GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFE 249
           GSPHYAAPEI+SGLPYHG E+DVWSCG+IL+ALLTGRLPFDE+DGNIR LLLKVQSG+FE
Sbjct: 192 GSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 251

Query: 250 MPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYL 309
           MP  DEIS EAQDLI+KILTVDP  RIKTREILKHPL++KYPSIKDSK+IRNLPREDTYL
Sbjct: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYL 311

Query: 310 NPLDHNDGTV---DRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYENE 366
           NPL  ++G V   D  IL+NLVVLWHGRD  EI  KL E G N EKT YALL RFK + E
Sbjct: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTE 371

Query: 367 XXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQ--ILVTP--KKKRSSGINVSSAHKR 422
                   + KR S    +   +   +S+   +++  ++ TP  +K R+S ++VSSAHKR
Sbjct: 372 KEIKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHKR 431

Query: 423 PVSIQKWGE-------IGGGNNGL-----------------------IXXXXXXXXXXXX 452
           PVS  +          I  G NG                        I            
Sbjct: 432 PVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQLL 491

Query: 453 XXAILNTPSSSPSRKRMSIAQDAPPMPTSVLRDYN 487
              +  +P+ S   KRMSI    PP+P  ++++YN
Sbjct: 492 ANDLNTSPTPSNCTKRMSIINGTPPVPMDIMKNYN 526

 Score =  147 bits (370), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 125/381 (32%), Positives = 194/381 (50%), Gaps = 64/381 (16%)

Query: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIM----AQEVAH 721
            RSVS P ++  +   RDS     YS      +R  S++TRP+SRLDPG+M        A+
Sbjct: 762  RSVSAPLEK--TEKSRDS--PFDYS-----KQRNFSLRTRPVSRLDPGLMYSSGTGSSAY 812

Query: 722  ELDYDDEEILSERTLRR---EKTILETIRRSNFLGSQFD-------IHXXXXXXXXXXXX 771
               +  E++ S  +L R   +K ILETIRRS FLGS FD       +             
Sbjct: 813  NPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEMVEELESNRIKQQAF 872

Query: 772  XXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRH-----TTVGVLRDDE 826
                  ++N    D +S H+    S+   +++ +D Y+T  L +       T+G L D  
Sbjct: 873  QDSHLEEMNDVTED-LSQHNVD-TSNDRIVSTTNDRYETEILPKSHAGKTQTIG-LNDSS 929

Query: 827  SEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSD-VQLKPLNDT 885
             +P+ LSE+++P+ TR+S+  S S+KR SVLS+YS+  S+TNL D +K D + ++P   +
Sbjct: 930  VQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERS 989

Query: 886  ASSKVTQQPEFMFES-TIDNVERISSNDNSHISSME-----APNNTVIKLNYADRFYKPV 939
             ++K +Q+PEF+FES ++D   R SS ++  I+  E       NN  ++L++ DRF + +
Sbjct: 990  PTTK-SQEPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNN--LRLSFHDRFNRQL 1046

Query: 940  EVIELDDTDN--------------------TQPDTEEDITKVKLPALPPLEKLNKSPNGL 979
               + + T N                    + P  +++   VKLPALPPL    K  +GL
Sbjct: 1047 STEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPL--TTKKTDGL 1104

Query: 980  GIYQHSSPREDFKHAVRSVTP 1000
            GIYQ S  R    +A   +TP
Sbjct: 1105 GIYQKSKQRTS-SNASNPITP 1124

 Score =  112 bits (279), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 51/74 (68%), Positives = 66/74 (89%)

Query: 489 RASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFE 548
           RASR+ KR S  P+++R SIT+K+I+TYA+L+ED+DWE+I+KE KR SS+FATLIDNIFE
Sbjct: 606 RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665

Query: 549 HEKYEQIRREKEGL 562
           HEKYEQIR+EK+ L
Sbjct: 666 HEKYEQIRKEKDEL 679

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (64%), Gaps = 1/88 (1%)

Query: 1059 EYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAF 1118
            +YD+QL   V   +MF+ LD L  GW+ YGLK ++SSP     TGK+SS+NILS +ST F
Sbjct: 1287 DYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVF 1346

Query: 1119 QV-VVAGSNHGSSVRFTKKSGSKKTFAR 1145
            ++ +++ S     +RF K SGS K+  R
Sbjct: 1347 ELEIISNSVKTCLLRFKKTSGSSKSVRR 1374

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/545 (56%), Positives = 379/545 (69%), Gaps = 30/545 (5%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           IGPW LGETLGVGS GKV +AQ+  T    AVKIISKSIFN +G+     N   VLPY I
Sbjct: 18  IGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNY---GNHGSVLPYNI 74

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
           EREI IMKLL+HPNVL LYDVWET+ +LY++LEY EKGELFNLL++RG LPE EA++ FR
Sbjct: 75  EREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMKCFR 134

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QIII +SYCHALGIVHRDLKPENLLLD  +NIK+ADFGMAAL++   LLETSCGSPHYAA
Sbjct: 135 QIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSPHYAA 194

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDE++GNIR LLLKVQ G+FEMPD  EI
Sbjct: 195 PEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEI 254

Query: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLDHND 316
           S +AQDLI+KIL VDP+ RIK R+IL HPLLK+Y +IKDSKSI++LPREDTYL PL    
Sbjct: 255 SKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADAG 314

Query: 317 GTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYENEXXXXXXXXIA 376
             +D +IL+NLVVLWHGR  +EI  KL   G N EKT YALL+RFK E+           
Sbjct: 315 AAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNK----- 369

Query: 377 KRISSASSSPQRNIVKSSSRRSINQILVTPKKK--RSSGINVSSAHKRPVSIQKWGEIGG 434
           +R      +  R    SSS      +  TP+K+  ++   N SS  KR   I     I  
Sbjct: 370 RRRHKTKKTKNRKFSTSSSLVKGRNLESTPRKRTSKTHSNNFSSGKKRSSFILSPNSINS 429

Query: 435 GNNGLIXXXXXXXXXXXXXXAILNTPSSSPSRKRMSIAQDAPPMPTSVLRDYNKRASRNS 494
                               + +   +S     R + +  +P +P  +L  + + +  +S
Sbjct: 430 --------------------SPIPLRNSKGISLRNATSGGSPVVPVILLNSFKRNSKLSS 469

Query: 495 KRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQ 554
           KR S++P++K  S+TS++++ Y KL +++DWE I+K+ KRTSS+FATLID IFE E++E 
Sbjct: 470 KRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFATLIDEIFEPEEFEL 529

Query: 555 IRREK 559
            +REK
Sbjct: 530 AKREK 534

 Score =  133 bits (334), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 132/472 (27%), Positives = 218/472 (46%), Gaps = 68/472 (14%)

Query: 687  LQYSINTVL-NKRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILET 745
            L   I+T+L N+  +S  TRPIS+LDPG+M        D  ++  L   T   E  I+ET
Sbjct: 584  LLQDIDTLLTNRYQLSAYTRPISKLDPGLMPAAGTTPHDIKEQTALIRDT---EVKIIET 640

Query: 746  IRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRF--VSDGTTITS 803
            I RS FLGS  ++                          + +S  D     + + + I+ 
Sbjct: 641  IHRSKFLGSLLNVR-------------------------EGMSKDDDELAPIEESSIIS- 674

Query: 804  AHDGYDTTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTM 863
                          T  ++ DD +E +K+S+V +P  TR+SRH +A+S R SVLS+YS+ 
Sbjct: 675  --------------TTPLIYDDRTEVRKISDVEVPHFTRKSRHFTAASNRRSVLSLYSSR 720

Query: 864  TSYTNLADFMKSDVQLKP----LNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSM 919
             S+ +L+   K++    P    ++DT+SSK     E +  S  ++++  S ND  H S M
Sbjct: 721  DSFKDLSQISKNEYSDSPSQRSVDDTSSSKKVGHTESL-ASVAEHIDDDSYND--HNSGM 777

Query: 920  EAPNNTVIKLNYADRFYKPVEVIELDD--TDNTQPDTEEDITKVKLPALPPLEKLNKSPN 977
             + N   +  +  +    P EV   D+  + +    + E    V+LP+L   +  N S  
Sbjct: 778  NSDN---VLYDVPEGVDLPQEVKNSDEQSSCSLVSSSLEPTPVVELPSLSSFQGKNAS-- 832

Query: 978  GLGIYQHSSPREDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKEL---GIREPLTD 1034
            GLGIYQ    RE  K ++ + T + +   E+     +++    S+   L    ++E    
Sbjct: 833  GLGIYQ----REPSKVSLPTATIDTSDAVENRETEVKKELKHDSIATNLPDDNVKENNNA 888

Query: 1035 LAQQGVXXXXXXXXXXXXXEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRS 1094
             A+                       + ++   + N ++F  L KLL GW  YGLK++  
Sbjct: 889  TAEAPSRIKKSSNVSILKNISKGKILELEIHAKIPNKRLFEGLHKLLEGWKQYGLKKLGF 948

Query: 1095 SPSVSMITGKLSSDNILSLRSTAFQVVV-AGSNHGSSVRFTKKSGSKKTFAR 1145
              +  +I GKL +D+ILSLRST F+++V    +  S ++F KK+GS K   +
Sbjct: 949  DAAKMIIKGKLVNDSILSLRSTLFEIIVLPNGDDRSLIKFNKKTGSSKVLTK 1000

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/568 (54%), Positives = 390/568 (68%), Gaps = 62/568 (10%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           IGPW LGETLG GSTGKV +A++ +TGQ  AVK+I KSIF ++GS   G+ND  VLP+ I
Sbjct: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSH--GNND-SVLPFNI 74

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
           EREI IMKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLL++RGPLPE EA++ F+
Sbjct: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QIII ISYCHALGIVHRDLKPENLLLD+ +NIK+ADFGMAAL++   +LETSCGSPHYAA
Sbjct: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDE++GN+R LLLKVQ G+FEMP+  EI
Sbjct: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254

Query: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPL---- 312
           S +AQDLI +IL VDP+ RIK R+IL HPLLKKY +IKDSKSI++LPRE+TYL PL    
Sbjct: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADAD 314

Query: 313 DHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYENEXXXXXX 372
           +H   T+D +IL+NLV+LWHGR   EI+ KL + G N EKT YALL+RFK E+       
Sbjct: 315 NHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLES------- 367

Query: 373 XXIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSS--------GINVSSAHKRPV 424
                             +K +++RS ++I  T K KR S          N  S    P 
Sbjct: 368 ------------------MKETNKRSRSKINKTKKSKRVSTLSSSSSSAFNHQSLDSAP- 408

Query: 425 SIQKWGEIGGGNNGLIXXXXXXXXXXXXXXAILNTPSSSPS----------RKRMSIAQD 474
             +K    G   N                  IL++ S+  S              ++  +
Sbjct: 409 --RKHASRGHSKN--------FPSSRKRSSFILSSNSTDCSPIPLRSSKRISISSAVPGN 458

Query: 475 APPMPTSVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKR 534
              +P S L+   + + R+SKR S++P++ R S+T+ +++ Y  L +D+DWEYIDK+ KR
Sbjct: 459 TLQVPDSSLK-LKRNSKRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKR 517

Query: 535 TSSDFATLIDNIFEHEKYEQIRREKEGL 562
           TSS+FATLID IFE EK+E  +REK  L
Sbjct: 518 TSSNFATLIDEIFEPEKFELAKREKAEL 545

 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 127/468 (27%), Positives = 216/468 (46%), Gaps = 69/468 (14%)

Query: 691  INTVL-NKRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRS 749
            I+T+L N+  +S  TRPISRLDPG+     A      ++  L + T   E  I+ETIR+S
Sbjct: 604  IDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDT---EMKIIETIRKS 660

Query: 750  NFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYD 809
             FLGS  ++                          + IS  + +  S   +         
Sbjct: 661  EFLGSLLNVR-------------------------EGISQDNNQLASIEVS--------- 686

Query: 810  TTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNL 869
                 + +T  ++ +D+ E +K+S+V +P  TR+S+H + ++ R SVLS+YS   S  +L
Sbjct: 687  ----PKISTTPLMYNDQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDL 742

Query: 870  ADFMKSDVQLKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKL 929
                K++    P     S+    + E      +D +E ++   NS     ++ ++  +  
Sbjct: 743  NQISKNEEPDSP--PQGSTDNASKSEL-----VDVIEEVTEQKNSQHDQDDSNDSNGMNN 795

Query: 930  NYADRFYKPVEVIE------LDDTDNTQ-PDTEEDITK--VKLPALPPLEKLNKSPNGLG 980
            N     Y   E ++      ++D  +TQ P ++    K  VKLP+L   ++ N S  GLG
Sbjct: 796  NNI--LYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSLSSFQRKNAS--GLG 851

Query: 981  IYQHSSPREDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGV 1040
            IYQ  S RE    ++ SVT N ++ ++      Q++         L   +   D  +  +
Sbjct: 852  IYQRESSRE----SLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDGKADSYKGDI 907

Query: 1041 XXXXXXXXXXXXXEKIKPEYDYQLDT--TVNNTKMFRALDKLLNGWTSYGLKQVRSSPSV 1098
                         +K+      +LD    ++  +++  L KLL GW  YGLK +  + + 
Sbjct: 908  SNIVRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTAD 967

Query: 1099 SMITGKLSSDNILSLRSTAFQVVVAGSNHGSS-VRFTKKSGSKKTFAR 1145
             +I+GKL +D ILSLRST F++V+  +  G S ++F KK+GS KT  +
Sbjct: 968  MIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTK 1015

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  533 bits (1374), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 248/352 (70%), Positives = 293/352 (83%), Gaps = 7/352 (1%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           IGPW LGETLG GSTG+V +AQ+ +TG   AVK+ISK+IF+ +     G      LPY I
Sbjct: 10  IGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDG---GGXXXLALPYNI 66

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
           EREI +MKLL+HPNVL LYDVWET+ +LY++LEY EKGELFNLL++RGPLPE EAV+ FR
Sbjct: 67  EREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVKCFR 126

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QIII ISYCHALGIVHRDLKPENLLLD+ +NIK+ADFGMAAL++  +LLETSCGSPHYAA
Sbjct: 127 QIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGSPHYAA 186

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDED+GN+R LLLKVQ G+FEMPD  EI
Sbjct: 187 PEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEI 246

Query: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPL---- 312
           S +AQ+LI++IL VDP+ R+KTR+IL HPLLKKY +I+DSKSIRNLPRE+TYL PL    
Sbjct: 247 SKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLADAG 306

Query: 313 DHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYE 364
           +H + T+D +IL+NLVVLWHGR  +EIV  L + G N EKT YALL+RFK E
Sbjct: 307 NHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFKQE 358

 Score =  106 bits (265), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 131/473 (27%), Positives = 211/473 (44%), Gaps = 77/473 (16%)

Query: 691  INTVLNKRA-VSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRS 749
            INT+L  R  +S  TRPIS+LDPG+M       + YD +E  ++  L  E  ILETIR+S
Sbjct: 594  INTLLTNRCQLSAYTRPISKLDPGLMP--TPETIPYDIKE-KTDLLLDTEMKILETIRKS 650

Query: 750  NFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPDRISYHDQRFVSDGTTITSAHDGYD 809
              L S  ++                      RK   R          D   + S  +   
Sbjct: 651  KILDSSLNL----------------------RKEVSR----------DADRLPSVEE--- 675

Query: 810  TTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNL 869
              S    TT  V  +D  E  K+S++++P  TR+S+  + ++ R SVLS+YS+  S+  L
Sbjct: 676  --SPIASTTPLVYNNDSKEVCKISDIQVPHFTRKSKCFTPTNNRRSVLSLYSSRHSFKGL 733

Query: 870  ADFMKS-DVQLKP---LNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNT 925
            +  + S D    P   +N   S ++           I N++ I +N+N++    +   + 
Sbjct: 734  SRILNSKDPSANPYSHINGPLSEEID------LTEDIANMKNIENNNNNNNRLYDVSESA 787

Query: 926  VI-------KLNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNG 978
            ++         +  +      + I+   ++NT+P      T VKLP+L   ++ N S  G
Sbjct: 788  ILLQGNDDDDDDDDNENDDGSQSIQSSVSNNTEP-----TTFVKLPSLSSFQEKNAS--G 840

Query: 979  LGIYQHSSPREDFKHAVRSVTPNEN----KENEDPAGTTQQKAPLTSVGKELGIREPLTD 1034
            LGIYQ     E    +     PN        +ED     Q +   TS+  +  I++   D
Sbjct: 841  LGIYQREPSIEPSIESSIEPLPNVTIAIEDVDEDGENEIQHENITTSLSND-NIKK--ND 897

Query: 1035 LAQQGVXXXXXXXXXXXXXE-KIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVR 1093
              +  +             + KI    + ++   +   ++F  L KLL GW  YGLK + 
Sbjct: 898  DTKDTIREYSNVSFLKKFSKGKI---LELEIHAKIPAERLFEGLHKLLEGWKQYGLKNLG 954

Query: 1094 SSPSVSMITGKLSSDNILSLRSTAFQVVV-AGSNHGSSVRFTKKSGSKKTFAR 1145
               +  +ITGKL +DNILSLRST F+++V    +  S ++F KK+GS KT  +
Sbjct: 955  FDTANMIITGKLVNDNILSLRSTLFEIIVLPNRDDRSLIKFNKKTGSTKTLKK 1007

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  441 bits (1135), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 277/380 (72%), Gaps = 26/380 (6%)

Query: 203 LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQD 262
           LPYHGFESDVWSCG+IL+ALLTGRLPFDE+DGNIR LLLKVQSG+FEMPD DEIS EAQD
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 263 LIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLDHNDGTVDRT 322
           LIAKILTVDP+ RIK+REILKHPLL+KYPSIKDSKSIRNLPREDTYLNPLD  +G++D +
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129

Query: 323 ILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYENEXXXXXXXXIAKRISSA 382
           I+ NLVVLWHGRD NEI  +L E G NLEKTFYALL RFK+++           +R  ++
Sbjct: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQ---RRSQAS 186

Query: 383 SSSPQR-NIVKSSSRRSINQILVTPKKK-RSSGINVSSAHKRPVSIQKWGEIGGGNNGLI 440
             SP+R N+  S SRRSI    VTPKKK ++  I+ SS+HKRPVS  +     G N    
Sbjct: 187 HISPKRSNMRNSVSRRSITN--VTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHT 244

Query: 441 XXXXXXXXXX------XXXXAILNTPSSSPS--RKRMSIAQ---DAPPMPTSVLRDYNK- 488
                               A++N P++SP+   KR S+      APP+P  +L+DYNK 
Sbjct: 245 PPTSASKRASVNLSSNKRISALIN-PNNSPTPVHKRSSMRDLDASAPPIPMDMLKDYNKS 303

Query: 489 ------RASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATL 542
                 R++R SKR SFLP  KR SIT+K+IATYAK+S+DNDWEYI+KE +RTS+DFATL
Sbjct: 304 APKVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATL 363

Query: 543 IDNIFEHEKYEQIRREKEGL 562
            D IFEHEKYEQIR+EKE L
Sbjct: 364 CDEIFEHEKYEQIRKEKEEL 383

 Score =  278 bits (710), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 205/518 (39%), Positives = 273/518 (52%), Gaps = 67/518 (12%)

Query: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDY 725
            RSVS P +      KR S   L   I  +LN+R  S++TRP SRLDPGI   E   E D+
Sbjct: 457  RSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTSE---EEDF 513

Query: 726  DDEEILSERTLRREKTILETIRRSNFLGSQFDIHXXXXXXXXXXXXXXXXXXQLNRKLPD 785
              +   ++  L  EKTILETIRRS FLGS FDI+                  + +     
Sbjct: 514  GSKNHGAD--LSTEKTILETIRRSKFLGSSFDINKELARERRLKEERAALAKRKD----- 566

Query: 786  RISYHDQRFVSDGTTITSAHDGYDTTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSR 845
                 ++R  S+ TT     +GY++ +L +   +G   +  SEP+K+SEV +P+ TRRSR
Sbjct: 567  -----EERVASNATTANVVGNGYESQTLPKR-KMGSAMEASSEPRKISEVEVPQFTRRSR 620

Query: 846  HLSASSKRFSVLSMYSTMTSYTNLADFM--KSDVQLKPLNDTASSKVTQQPEFMFESTID 903
            H +AS+KR SVLSMYST TS+TNLAD +  K+DVQL   +  ++SK+ Q+ EFMFES   
Sbjct: 621  HFTASNKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTSPPSASKMDQEAEFMFESV-- 678

Query: 904  NVERISSNDNSHISSM-------EAPN-NTVIKLNYADRFYKPVEVIELDDTDNTQPDTE 955
            + E   + D S  S +       +A N    +KLN+ADRF +P       DTD++     
Sbjct: 679  DKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNRPTSPPS-QDTDSS----- 732

Query: 956  EDITKVKLPALPPLEKLNKSPN---GLGIYQHSS--PREDFKHAVRS------------- 997
                 +KLPALPPL+K NK PN   GLG+YQ ++    ED +   +S             
Sbjct: 733  ---AAIKLPALPPLDK-NK-PNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESEITTE 787

Query: 998  ----VTPNENKENEDPAGTTQQKAPLTSVGKEL--GIREPLTDLA----QQGVXXXXXXX 1047
                VT  E          T   APL +V K+     R+PL+D+     ++         
Sbjct: 788  PRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAVEKKANKSFFRKF 847

Query: 1048 XXXXXXEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSS 1107
                  EK   +YD++  T +  T+MF AL KLL  W  YGLK V +SPS+  I GKLSS
Sbjct: 848  SSKGSDEKKSGDYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSS 907

Query: 1108 DNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFAR 1145
            DNILSLRST F + V G   GS V FTKKSGS KTF +
Sbjct: 908  DNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNKTFKK 945

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  412 bits (1060), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/433 (50%), Positives = 289/433 (66%), Gaps = 31/433 (7%)

Query: 6   NSNVTSLKGGR------IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQ 59
           N++ T  K G+      +GPW LG+TLG GS+G+V +A+N++TG++AA+KI+ K      
Sbjct: 44  NASTTVRKTGKKKNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHN 103

Query: 60  GSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNL 119
            +          LPYGIEREI IMKL++HPNV+ LY+VWE   +LY+VLEYVE GELF+ 
Sbjct: 104 NTQLTS------LPYGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDY 157

Query: 120 LIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKLADFGMAAL 178
           LI RG LPE EAV +F+QI+ G+SYCH   I HRDLKPENLLLD K  ++K+ADFGMAAL
Sbjct: 158 LISRGKLPEQEAVHYFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAAL 217

Query: 179 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRK 238
           E+ DKLLETSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF++D  N++K
Sbjct: 218 ETTDKLLETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVKK 275

Query: 239 LLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKS 298
           LLLKVQSG+++MP    IS EA+DLIAKIL VDP+ RI   E+L+HPLL KY   + SKS
Sbjct: 276 LLLKVQSGKYQMPQN--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKS 332

Query: 299 IRNLPREDTYLNPLD-HNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357
             NL   D+  N +   ++  +D +IL NL +LWHG  +  +  KL +QG   EK FY+L
Sbjct: 333 SSNLHALDSTPNIVVLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSL 392

Query: 358 LHRFKYENEXXXXXX-------XXIAKRISSASSSPQRNIVKS-----SSRRSINQILVT 405
           L R++   +               + K  SS + +PQ  ++ +      S+ S+N +  +
Sbjct: 393 LLRYQERQKLPEASQPKPLSSLAPLRKTGSSNADTPQLGVLSAPRIVQKSQFSVNTLAKS 452

Query: 406 PKKKRSSGINVSS 418
           PKK R   +  SS
Sbjct: 453 PKKTREGYVASSS 465

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  402 bits (1033), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 210/418 (50%), Positives = 283/418 (67%), Gaps = 29/418 (6%)

Query: 6   NSNVTSLKGGR------IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQ 59
           N+NV + K  +      +GPW LG+TLG GS+G+V +A+N++TG+++A+KI+ K      
Sbjct: 53  NANVNNTKTSKRRNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKK----- 107

Query: 60  GSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNL 119
              FV SN    LPYGIEREI IMKL++HPNV+ LY+VWE  ++LY+VLEYVE GELF+ 
Sbjct: 108 ---FVKSNQIKQLPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDY 164

Query: 120 LIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLD-HKFNIKLADFGMAAL 178
           L+ +G LPE+EA+ +F+QI+  ++YCH   I HRDLKPENLLLD  K +IK+ADFGMAAL
Sbjct: 165 LVSKGKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAAL 224

Query: 179 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRK 238
           E+ DKLLETSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF++D  N++K
Sbjct: 225 ETSDKLLETSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVKK 282

Query: 239 LLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKS 298
           LLLKVQSG+++MP    +S+EA+DLI++IL VDP+ RI   +IL+H LL KY     SKS
Sbjct: 283 LLLKVQSGKYQMP--QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKS 340

Query: 299 IRNLPREDTYLNPLDH-NDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357
             +L   +   N +   ++  +D TIL NL +LWHG     +V +L + G   EK FY+L
Sbjct: 341 NSDLNLLNRTPNIVSFSSERDIDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSL 400

Query: 358 LHRFKYENEXXXXXXXXI---AKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRSS 412
           L  ++ E +        I     + SSASS    NI        +N +  T KK++ S
Sbjct: 401 LWNYQ-EKQQKSMQKDLIPVPTLKTSSASSVSPLNI-----SSDVNSVTNTAKKQQQS 452

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  404 bits (1037), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/431 (49%), Positives = 276/431 (64%), Gaps = 28/431 (6%)

Query: 6   NSNVTSLKGGR------IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQ 59
           NS+    K G+      +GPW LG+TLG GS+G+V +A+N+Q+G++AA+KI+ K      
Sbjct: 41  NSSTAHTKTGKRKNRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHN 100

Query: 60  GSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNL 119
                       LPYGIEREI IMKL+ HPN++ LY+VWE  ++LY+VLEYVE GELF+ 
Sbjct: 101 QKQVTA------LPYGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDY 154

Query: 120 LIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIKLADFGMAAL 178
           LI RG LPE EA+ +F+QI+ G+SYCH   I HRDLKPENLLLD K   +K+ADFGMAAL
Sbjct: 155 LIARGKLPEQEAIHYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAAL 214

Query: 179 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRK 238
           E+ ++LLETSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF++D  N+RK
Sbjct: 215 ETTNRLLETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVRK 272

Query: 239 LLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKS 298
           LLLKVQ G ++MP    +S EA+DLI+KIL VDP  RI   +IL+HPLL KY +      
Sbjct: 273 LLLKVQHGRYQMP--SNVSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGL 330

Query: 299 IRNLPREDTYLNPLD-HNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357
              L + +     LD H+   +D TIL NL +LWHG  +  +V KL + G   EK FYAL
Sbjct: 331 ACPLEKPEERPKVLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYAL 390

Query: 358 LHRFKY----------ENEXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVTPK 407
           L R++            N          A+  ++  S      V   S+ SIN +LV+PK
Sbjct: 391 LLRYQQRQSVEPTSVPSNMASTNGSGAFARASNNDQSVINAPKVTQKSQFSINSLLVSPK 450

Query: 408 KKRSSGINVSS 418
           K R   +  SS
Sbjct: 451 KTREGYVASSS 461

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  402 bits (1033), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 206/416 (49%), Positives = 276/416 (66%), Gaps = 20/416 (4%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +GPW LG+TLG GS+G+V +A+N++TG++AA+KI+ K +  +  ++   +     LPYGI
Sbjct: 58  VGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAANGNLPYGI 117

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
           EREI IMKL++HPN++ LY+VWE  ++L++VLEYVE GELF+ L+ +G LPE EAV +FR
Sbjct: 118 EREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEAVHYFR 177

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKLADFGMAALESKDKLLETSCGSPHYA 195
           QII G++YCH   I HRDLKPENLL+D K   IK+ADFGMAALE+ +KLLETSCGSPHYA
Sbjct: 178 QIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCGSPHYA 237

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE 255
           +PEIV G  YHG  SDVWSCG+IL+ALLTG LPF++D  NI+KLLLKVQSG++ MP    
Sbjct: 238 SPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFNDD--NIKKLLLKVQSGKYHMP--QN 293

Query: 256 ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI--KDSKSIRNLPREDTYLNPLD 313
           IS EAQDLI+KIL VDP GRI   E+L+HPL+ KY     K +  +  L R    +    
Sbjct: 294 ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKARSKSNSDLHLLSRTPQLVTLQS 353

Query: 314 HNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYENEXXXXXXX 373
             D  +D +IL NL +LWHG     IV +L + G   EK FY+LL +++           
Sbjct: 354 KED--IDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQERQNPSVENDS 411

Query: 374 XIAKRISSASSSPQRNIVK----------SSSRRSINQILVTPKKKRSSGINVSSA 419
            +   +S ++ +P                  S+ SI  + V+PKK +  G  VSS+
Sbjct: 412 FVETTVSVSTGTPTPTPAAEDAVGAPKLLQKSQFSIPSLKVSPKKMK-DGYVVSSS 466

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  401 bits (1030), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/387 (50%), Positives = 270/387 (69%), Gaps = 45/387 (11%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISK-----------SIFNAQGSTFVG 65
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K           ++ N+  S+ V 
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVT 137

Query: 66  SN--DPDVL-----------PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVE 112
           SN   P +            PYGIEREI IMKL++H NV+ L++VWE  ++LY+VLEYV+
Sbjct: 138 SNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVD 197

Query: 113 KGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKLA 171
            GELF+ L+ +G LPE EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK+A
Sbjct: 198 GGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIA 257

Query: 172 DFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE 231
           DFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF++
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND 317

Query: 232 DDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYP 291
           D  NI+KLLLKVQSG+++MP    +S EA+DLI+KIL +DP  RI T+EILKHPL+KKY 
Sbjct: 318 D--NIKKLLLKVQSGKYQMP--SNLSSEARDLISKILVIDPEKRITTQEILKHPLIKKYD 373

Query: 292 SIKDSKSIRNLPREDT----------YLNPLD------HNDGTVDRTILKNLVVLWHGRD 335
            +  +K +R + +++            LN +       H+ G +D +IL++L +LWHG  
Sbjct: 374 DLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHGVS 433

Query: 336 ENEIVMKLNEQGPNLEKTFYALLHRFK 362
              I  KL ++  + EK FY+LL ++K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLQYK 460

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  394 bits (1012), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/354 (55%), Positives = 258/354 (72%), Gaps = 28/354 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           IGPW LG+TLG GS+G+V +A+N++TG++AAVKI+ K+           S+ P+ LPYGI
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKT----------KSSRPNALPYGI 104

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
           EREI IMKL++HPNV+ LY+VWE   +L++VLEYV+ GELF+ L+ RG L E EA+ +FR
Sbjct: 105 EREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIHYFR 164

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAALESKDKLLETSCGSPHYA 195
           QII G +YCH+  I HRDLKPENLLLD K   IK+ADFGMAAL++ +KLLETSCGSPHYA
Sbjct: 165 QIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPHYA 224

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE 255
           +PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF++D  NI++LLLKVQ+G+++MP    
Sbjct: 225 SPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFNDD--NIKRLLLKVQAGKYQMP--QA 280

Query: 256 ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNL-------PREDTY 308
           IS+EAQDLI++IL VDP+ RI   +IL HPL+ KY   K SKS  +L       P+  T 
Sbjct: 281 ISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKSNSDLHILSHTSPQICTI 339

Query: 309 LNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFK 362
            +  D     VD TIL+NL +LWHG  ++ I+ +L E     EKTFY+LL  ++
Sbjct: 340 RSERD-----VDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ 388

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  398 bits (1022), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 195/387 (50%), Positives = 270/387 (69%), Gaps = 45/387 (11%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISK-----------SIFNAQGSTFVG 65
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K           ++ N+  S+ + 
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSMIT 137

Query: 66  SN--DPDVL-----------PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVE 112
           SN   P +            PYGIEREI IMKL++H NV+ L++VWE  ++LY+VLEYV+
Sbjct: 138 SNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEYVD 197

Query: 113 KGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKLA 171
            GELF+ L+ +G LPE EA+ +F+QI+ G+S+CH+  I HRDLKPENLLLD K   IK+A
Sbjct: 198 GGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIKIA 257

Query: 172 DFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE 231
           DFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF++
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND 317

Query: 232 DDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYP 291
           D  NI+KLLLKVQSG+++MP    +S EA+DLI+KIL ++P  RI T+EIL HPL+KKY 
Sbjct: 318 D--NIKKLLLKVQSGKYQMP--MNLSAEARDLISKILVINPEKRITTQEILNHPLIKKYD 373

Query: 292 SIKDSKSIRNLPREDT----------YLNPLD------HNDGTVDRTILKNLVVLWHGRD 335
           ++  +K IR + R++            LN +       H+ G +D +IL++L +LWHG  
Sbjct: 374 NLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHGVS 433

Query: 336 ENEIVMKLNEQGPNLEKTFYALLHRFK 362
              I  KL ++  + EK FY+LL ++K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLQYK 460

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  397 bits (1021), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/387 (50%), Positives = 271/387 (70%), Gaps = 45/387 (11%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISK-----------SIFNAQGSTFVG 65
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K           ++ N+  S+ V 
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSMVT 137

Query: 66  SN--DPDVL-----------PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVE 112
           SN   P ++           PYGIEREI IMKL++H NV+ L++VWE  ++LY+VLEYV+
Sbjct: 138 SNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVD 197

Query: 113 KGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-FNIKLA 171
            GELF+ L+ +G LPE EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK+A
Sbjct: 198 GGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIA 257

Query: 172 DFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE 231
           DFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF++
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND 317

Query: 232 DDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYP 291
           D  NI+KLLLKVQSG+++MP    +S EA+DLI+KIL +DP+ RI T+EILKHPL+KKY 
Sbjct: 318 D--NIKKLLLKVQSGKYQMP--MNLSAEARDLISKILVIDPAKRITTQEILKHPLIKKYD 373

Query: 292 SIKDSKSIRNLPREDT----------YLNPLD------HNDGTVDRTILKNLVVLWHGRD 335
            +  +K +R + R++            LN +       ++   +D +IL++L +LWHG  
Sbjct: 374 DLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHGVS 433

Query: 336 ENEIVMKLNEQGPNLEKTFYALLHRFK 362
              I  KL ++  + EK FY+LL ++K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLQYK 460

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  397 bits (1021), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/387 (50%), Positives = 272/387 (70%), Gaps = 45/387 (11%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISK-----------SIFNAQGSTFVG 65
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K           ++ N+  S+ V 
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSMVT 137

Query: 66  SN--DPDVL-----------PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVE 112
           SN   P ++           PYGIEREI IMKL++H NV+ L++VWE  ++LY+VLEYV+
Sbjct: 138 SNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEYVD 197

Query: 113 KGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-NIKLA 171
            GELF+ L+ RG LPE EA+ +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK+A
Sbjct: 198 GGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIKIA 257

Query: 172 DFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE 231
           DFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG++L+ALLTG LPF++
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFND 317

Query: 232 DDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYP 291
           D  NI+KLLLKVQSG+++MP    +S+EA++LI+KIL +DP  RI T+EIL+HPL+KKY 
Sbjct: 318 D--NIKKLLLKVQSGKYQMP--MNLSLEARNLISKILVIDPEKRITTQEILEHPLIKKYD 373

Query: 292 SIKDSKSIRNLP-------REDTYLNPLD---------HNDGTVDRTILKNLVVLWHGRD 335
           ++  +K +R +        + ++ L+ LD         +    +D +IL++L +LWHG  
Sbjct: 374 NLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEIDESILRSLQILWHGVS 433

Query: 336 ENEIVMKLNEQGPNLEKTFYALLHRFK 362
              I  KL ++  + EK FY+LL R+K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLRYK 460

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  393 bits (1010), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/390 (51%), Positives = 265/390 (67%), Gaps = 48/390 (12%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISK----------------------- 53
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K                       
Sbjct: 76  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSNSS 135

Query: 54  ---SIFNAQGSTFVGSNDPDVL--PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVL 108
              ++ N   + +  +   +V   PYGIEREI IMKL++H NVL LY+VWE  ++LY+VL
Sbjct: 136 QTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYLVL 195

Query: 109 EYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN- 167
           EYV+ GELF+ L+ RG L E EAV +F+QII G+SYCHA  I HRDLKPENLLLD K + 
Sbjct: 196 EYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKNST 255

Query: 168 IKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRL 227
           IK+ADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG L
Sbjct: 256 IKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTGHL 315

Query: 228 PFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           PF++D  +I+KLLLKVQSG+++MP    +S EAQDLIAKILTV+P+ R+ T EIL+HPL+
Sbjct: 316 PFNDD--SIKKLLLKVQSGKYQMP--QNLSKEAQDLIAKILTVNPAKRLTTEEILRHPLI 371

Query: 288 KKYPSIKDSKSIRNL------PREDTYLNPLDHNDGT---------VDRTILKNLVVLWH 332
            KY S+  +K  + L       + +  L+ L++ + T         +D TIL NL +LWH
Sbjct: 372 VKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQILWH 431

Query: 333 GRDENEIVMKLNEQGPNLEKTFYALLHRFK 362
           G     IV KL +   + EK FY+LL ++K
Sbjct: 432 GASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  395 bits (1015), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/387 (51%), Positives = 258/387 (66%), Gaps = 47/387 (12%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG---------------- 60
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K+  + +                 
Sbjct: 70  VGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPDKP 129

Query: 61  -STFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNL 119
            +T     +P    YGIEREI IMKL++HPNV+ LY+VWE  ++LY+VLEYV+ GELF+ 
Sbjct: 130 YTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELFDY 189

Query: 120 LIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAAL 178
           L+ RG LPE EAV +F+QII G++YCHA  I HRDLKPENLLLD K   IK+ADFGMAAL
Sbjct: 190 LVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMAAL 249

Query: 179 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRK 238
           E  DKLL TSCGSPHYA+PEIV G  YHG  +DVWSCG+IL+ALLTG LPF+ D  NI+K
Sbjct: 250 EVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NIKK 307

Query: 239 LLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYP------- 291
           LLLKVQSG + MP   ++S +A+DLI+KIL VDP  R+ T EIL H L+ KY        
Sbjct: 308 LLLKVQSGVYHMP--SDLSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLTNR 365

Query: 292 ------SIKDSKS------IRNLPREDTYL-NPLDHNDGTVDRTILKNLVVLWHGRDENE 338
                 S+   KS      I NL   D  L NP D     +D +IL NL +LWHG  ++ 
Sbjct: 366 NYNNNLSMARDKSNSNLNFINNLSNVDILLQNPCD-----IDTSILSNLQILWHGESKHA 420

Query: 339 IVMKLNEQGPNLEKTFYALLHRFKYEN 365
           I+ KL +   N EK FY+LL ++K +N
Sbjct: 421 IIDKLLQPNMNEEKLFYSLLLKYKQKN 447

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  390 bits (1001), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/381 (52%), Positives = 265/381 (69%), Gaps = 36/381 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKS-IFNAQG-STF----VGSNDPD 70
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K+ IF  Q  ++F      SND  
Sbjct: 89  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSNDES 148

Query: 71  ------------VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFN 118
                       + PYGIEREI IMKL++HPNV+ LY+VWE  ++L++VLEYV+ GELF+
Sbjct: 149 PKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGELFD 208

Query: 119 LLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAA 177
            L+ RG L E EAV +F+QII G+SYCH+  I HRDLKPENLLLD K N IK+ADFGMAA
Sbjct: 209 YLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGMAA 268

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           LE  +KLL TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF++D  +I+
Sbjct: 269 LELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFNDD--SIK 326

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297
           KLLLKVQSG+F+MP    IS+EA+DLI++IL VDP  RI+  +IL HPL++KY   K   
Sbjct: 327 KLLLKVQSGKFQMP--QNISLEAEDLISRILVVDPEKRIQINDILIHPLIRKYEDNKTDS 384

Query: 298 SIRNLPREDTYLNPLDH--ND-----------GTVDRTILKNLVVLWHGRDENEIVMKLN 344
           +  +  ++ +  N   H  ND             +D +ILKNL +LWHG     I+ KL 
Sbjct: 385 NNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELIISKLL 444

Query: 345 EQGPNLEKTFYALLHRFKYEN 365
           +   + EK FY+LL ++K +N
Sbjct: 445 QTPMSEEKLFYSLLLQYKKKN 465

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  390 bits (1001), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 275/416 (66%), Gaps = 58/416 (13%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISK-------------SIFNAQG--- 60
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K             S F+A     
Sbjct: 98  VGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSN 157

Query: 61  ---STFVGS---------NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVL 108
              ST   S         N P+  PYGIEREI IMKL++HPNV+ LY+VWE  ++LY+VL
Sbjct: 158 SNISTLATSPPMNNGSEKNQPN--PYGIEREIVIMKLISHPNVMALYEVWENKSELYLVL 215

Query: 109 EYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF-N 167
           EYV+ GELF+ L+ +G L E EAV +F+QII G+SYCH+  I HRDLKPENLLLD K  +
Sbjct: 216 EYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKS 275

Query: 168 IKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRL 227
           IK+ADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  SDVWSCG+IL+ALLTG L
Sbjct: 276 IKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHL 335

Query: 228 PFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           PF++D  NI+KLLLKVQ+G+F MP    +S EAQDLI++IL +DPS RI T  IL HPL+
Sbjct: 336 PFNDD--NIKKLLLKVQAGKFRMPST--LSPEAQDLISRILVIDPSKRITTDRILNHPLI 391

Query: 288 KKY-PSIKDSKSIRNLPREDTYLNPLDH-----------NDGTVDRTILKNLVVLWHGRD 335
            KY P+ K+  S     + ++ L+ L+H           ND  +D +ILKNL +LWHG  
Sbjct: 392 LKYEPAGKNMVS----GKSNSDLHVLEHISPQPISLTSRND--IDASILKNLQILWHGTS 445

Query: 336 ENEIVMKLNEQGPNLEKTFYALLHRFKYEN-----EXXXXXXXXIAKRISSASSSP 386
              I+ KL +   + EK FY+LL ++K  +     +        + K ISS S +P
Sbjct: 446 RELIIAKLLQTPMSEEKLFYSLLWQYKQRHTIQPIKQKEQTSLPVPKMISSLSHTP 501

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  389 bits (1000), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 254/375 (67%), Gaps = 34/375 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVL---- 72
           +GPW LG+TLG GS+G+V +A+N++ GQ+AA+KI+ K+     G+    SND        
Sbjct: 85  VGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLTTN 144

Query: 73  --------------PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFN 118
                         PYGIEREI IMKL++H NV+ L++VWE   DL++VLEYV+ GELF+
Sbjct: 145 YSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGELFD 204

Query: 119 LLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAA 177
            L+ +G LPE EAV +F+QII G+++CH+  I HRDLKPENLLLD K   IK+ADFGMAA
Sbjct: 205 YLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGMAA 264

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           LE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+IL+ALLTG LPF++D  NIR
Sbjct: 265 LELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDD--NIR 322

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297
           KLLLKVQSG F +P    IS+EAQDLIAKIL V+P  RIK  +ILKHPL+ KY      K
Sbjct: 323 KLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFKVK 380

Query: 298 -------SIRNLPREDTYLNPLD---HNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQG 347
                  S  NL  E   L P +    +   +D +IL+NL +LWHG     I+ KL +  
Sbjct: 381 FNQVPNPSATNLNSEH-MLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAKLLQYP 439

Query: 348 PNLEKTFYALLHRFK 362
            + EK FY+LL ++K
Sbjct: 440 MSAEKIFYSLLWQYK 454

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  386 bits (992), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/356 (54%), Positives = 254/356 (71%), Gaps = 32/356 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           IGPW LG+TLG GS+G+V +A+N++TG++AA+KI+ K+  +  GS          LPYGI
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGS----------LPYGI 104

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
           EREI IMKL++HPNV+ LY+VWE   +L++VLEYV+ GELF+ L+ RG LPE EA+ +FR
Sbjct: 105 EREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFR 164

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAALESKDKLLETSCGSPHYA 195
           QII G +YCH   I HRDLKPENLLLD K   IK+ADFGMAAL++ +KLLETSCGSPHYA
Sbjct: 165 QIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPHYA 224

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE 255
           +PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF++D  NI++LLLKVQ+G+++MP    
Sbjct: 225 SPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFNDD--NIKRLLLKVQAGKYQMP--QS 280

Query: 256 ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLDH- 314
           +S  AQDLI++IL VDP  RI   EIL HPLL KY + K SKS       ++ L+ L H 
Sbjct: 281 VSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKS-------NSDLHILSHS 332

Query: 315 --------NDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFK 362
                   ++  VD TIL+NL +LWHG  +  I+  L +     EKTFY+LL  ++
Sbjct: 333 KPQISTIKSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQ 388

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  379 bits (974), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/396 (50%), Positives = 260/396 (65%), Gaps = 54/396 (13%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSI-----------------FNA- 58
           +GPW LG+TLG GS+G+V +A+N++TGQ+AA+KI+ K                   F+A 
Sbjct: 98  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFSAT 157

Query: 59  ------------QGSTFVGSNDPDVL--PYGIEREITIMKLLNHPNVLRLYDVWETSTDL 104
                        G T   +   +V   PYGIEREI IMKL++H N+L LY+VWE  ++L
Sbjct: 158 MNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKSEL 217

Query: 105 YMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDH 164
           Y+VLEYV+ GELF+ L+ RG L E EAV +F+QI+ G+SYCH+  I HRDLKPENLLLD 
Sbjct: 218 YLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLLDK 277

Query: 165 KF-NIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALL 223
           K  +IK+ADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  SDVWSCG+IL+ALL
Sbjct: 278 KNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFALL 337

Query: 224 TGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283
           TG LPF++D  NI+KLLLKVQSG+F MP    +S EA+DL++KIL V+P  RI T EIL 
Sbjct: 338 TGHLPFNDD--NIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEEILN 393

Query: 284 HPLLKKY----PSIKDSKSIRNLP----REDTYLNPLDHNDGT---------VDRTILKN 326
           HPLL KY      +K   S+  +     + ++ L+ LD ++           +D +I+ N
Sbjct: 394 HPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSIVSN 453

Query: 327 LVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFK 362
           L +LWHG     IV KL +   + EK FY+LL  +K
Sbjct: 454 LQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  378 bits (970), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/403 (48%), Positives = 262/403 (65%), Gaps = 60/403 (14%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSI-FNAQG-STFVGSNDPDVL-- 72
           +GPW LG+TLG GS+G+V +A+N++TG++AA+KI+ K+  FN Q  S    SN+ D+   
Sbjct: 91  VGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLFLS 150

Query: 73  ----------------------------PYGIEREITIMKLLNHPNVLRLYDVWETSTDL 104
                                       PYGIEREI IMKLL+HPNV+ LY+VWE + +L
Sbjct: 151 YSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNNEL 210

Query: 105 YMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDH 164
           Y+VLEYV+ GELF+ L+ +G L E+EAV +F+QII GISYCH+  I HRDLKPENLLLD 
Sbjct: 211 YLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLLDK 270

Query: 165 KFN-IKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALL 223
           K   IK+ADFGMAAL+  ++LL+TSCGSPHYA+PEIV G  Y+G  SD+WSCG+IL+ALL
Sbjct: 271 KRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFALL 330

Query: 224 TGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283
           TG LPF++D  NI+KLL+KVQ+G ++MP    IS EA++LI++IL VDPS RI T +IL 
Sbjct: 331 TGHLPFNDD--NIKKLLIKVQNGRYQMPSY--ISQEAKNLISRILVVDPSKRISTEQILS 386

Query: 284 HPLLKKY---------------------PSIKDSKSIRNLPREDTYLNPLDHNDGTVDRT 322
           HPLL KY                      S  D   + N+P+    +     +D  +D +
Sbjct: 387 HPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVKLRARSD--IDES 444

Query: 323 ILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYEN 365
           ILKNL +LWHG   + I+ KL +   + EK  Y+LL ++K  N
Sbjct: 445 ILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYKQIN 487

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  377 bits (967), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/383 (49%), Positives = 257/383 (67%), Gaps = 41/383 (10%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFN---------AQGSTFVGSN 67
           +GPW LG+TLG GS+G+V +A+N++ G +AA+KI+ K  +N           G    G++
Sbjct: 90  VGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTD 149

Query: 68  DPD---------------VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVE 112
             D               + PYGIEREI IMKL++HPNV+ L +VWE  ++LY+VLEYV+
Sbjct: 150 SKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVD 209

Query: 113 KGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLA 171
            GELF+ L+ +G L E EAV +F QII G+SYCH+  I HRDLKPENLLLD K   IK+A
Sbjct: 210 GGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIA 269

Query: 172 DFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDE 231
           DFGMAALE  +KLLETSCGSPHYA+PEIV G PYHG  SDVWSCG+IL+ALLTG LPF++
Sbjct: 270 DFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFND 329

Query: 232 DDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY- 290
           D  NI+KLLLKVQ+G F++P    ++ +A+DLI +IL  +P  R+   EIL HPL+KKY 
Sbjct: 330 D--NIKKLLLKVQAGRFQLPPY--LTNDAKDLITRILVTNPEKRLTINEILNHPLIKKYR 385

Query: 291 --PSIKDSKSIRNLPREDTYLNPLDHN---------DGTVDRTILKNLVVLWHGRDENEI 339
             P+     ++    + ++ L+ L++N         +  +D++ILK+L +LWHG     +
Sbjct: 386 NPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQILWHGTPRQRL 445

Query: 340 VMKLNEQGPNLEKTFYALLHRFK 362
           V +L  +G   EK FY+LL ++K
Sbjct: 446 VERLLVEGATEEKLFYSLLFQYK 468

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  331 bits (848), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 166/298 (55%), Positives = 217/298 (72%), Gaps = 13/298 (4%)

Query: 74  YGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVR 133
           YGIEREI IMKL++HPNV+ LY+VWE  ++LY++LEYV+ GELF+ L+ RG LPE EA+ 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 134 FFRQIIIGISYCHALGIVHRDLKPENLL-LDHKFNIKLADFGMAALESKDKLLETSCGSP 192
           +F+QII G+SYCH+  I HRDLKPENLL    K +IK+ADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 193 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPD 252
           HYA+PEIV G  YHG  SDVWSCG+IL+ALLTG LPF++D  NI+KLLLKVQ+G+++MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFNDD--NIKKLLLKVQAGKYQMP- 373

Query: 253 KDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY-PSIKDSKSIRNLPREDTYL-- 309
              +S EA+DLI++IL V PS R+ T EIL HPL+ KY  S K    ++     D +L  
Sbjct: 374 -KNLSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 310 -----NPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFK 362
                N   ++   +D +ILKNL +LWHG   + I+ KL ++  + EK FY+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISK 53
           +GPW LG+TLG GS+G+V +A+NV+TGQ+AA+KI+ K
Sbjct: 90  VGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  319 bits (817), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 157/316 (49%), Positives = 215/316 (68%), Gaps = 33/316 (10%)

Query: 74  YGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVR 133
           YGIEREI IMKL++HPNV+ LY+VWE   +LY+VLEYV+ GELF+ L+ +G L E EAVR
Sbjct: 205 YGIEREIVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVR 264

Query: 134 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-IKLADFGMAALESKDKLLETSCGSP 192
           +F+QII G+ YCH+  I HRDLKPENLLLD K   IK+ADFGMAAL+  + LL+TSCGSP
Sbjct: 265 YFKQIIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSP 324

Query: 193 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPD 252
           HYA+PEIV G  Y+G  SDVWSCG+IL+ALLTG LPF++D  +I+KLL+KVQ+G ++MP 
Sbjct: 325 HYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFNDD--SIKKLLIKVQNGRYQMP- 381

Query: 253 KDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY---------------------- 290
            + +S +A+DLI++IL V+P  R+ T +IL+HPL+ KY                      
Sbjct: 382 -NYLSKDAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNN 440

Query: 291 ----PSIKDSKSIRNLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQ 346
                S  D   ++N+P +   +     ND  +D +IL+NL +LW+G     ++ KL + 
Sbjct: 441 LMRGKSNTDLAILQNIPDKTDIIQLRSRND--IDDSILRNLQILWNGVPRETLISKLIQD 498

Query: 347 GPNLEKTFYALLHRFK 362
             + EK  Y+LL ++K
Sbjct: 499 PVSEEKLIYSLLWQYK 514

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  247 bits (630), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 113/120 (94%), Positives = 119/120 (99%)

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGI 142
           MKLL+H NVLRLYDVWET+++LYMVLEYVEKGELFNLL+ERGPLPENEAVRFFRQIIIGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 143 SYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSG 202
           SYCHALGIVHRDLKPENLLLDHKFNIK+ADFGMAALESKDKLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  247 bits (630), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/291 (45%), Positives = 186/291 (63%), Gaps = 23/291 (7%)

Query: 2   GTKDNSNVTSLK-GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---N 57
           G+  ++ V+SL  G R+G + + +TLG GS GKV +A +V TGQ  A+KII+K +    +
Sbjct: 20  GSYVSNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSD 79

Query: 58  AQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
            QG               IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF
Sbjct: 80  MQGR--------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELF 124

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           + +++R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ 
Sbjct: 125 DYIVQRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSN 184

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           + +    L+TSCGSP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I 
Sbjct: 185 IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIP 242

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            L   + +G + +P    +S  A DLI ++L V+P  RI   EI++    K
Sbjct: 243 VLFKNISNGVYTLPKF--LSPGASDLIKRMLIVNPLNRISIHEIMQDEWFK 291

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  244 bits (624), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 127/273 (46%), Positives = 180/273 (65%), Gaps = 22/273 (8%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G RIG + + +TLG GS GKV +A +V T Q  A+KII+K I    + QG          
Sbjct: 36  GSRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGR--------- 86

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  D+ MV+EY +  ELF+ +++R  + ENE
Sbjct: 87  -----IEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENE 140

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A +FF+QII  + YCH   IVHRDLKPENLLLD + N+K+ADFG++ + +    L+TSCG
Sbjct: 141 ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCG 200

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+D  +I  L   + +G + +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDD--SIPVLFKNISNGIYTL 258

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283
           P    +S  A +LI ++L V+P  RI   EI++
Sbjct: 259 PKF--LSPGAANLIKRMLIVNPLNRISMNEIME 289

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  243 bits (620), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 177/278 (63%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G RIG + + +TLG GS GKV +A +V T Q  A+KII+K +    + QG          
Sbjct: 62  GARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGR--------- 112

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                +EREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF  +++R  + ENE
Sbjct: 113 -----VEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENE 166

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A +FF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 167 ARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCG 226

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPFD+D  +I  L   + +G + +
Sbjct: 227 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDD--SIPALFKNISNGIYTL 284

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A +LI K+L V+P  RI   EI+     K
Sbjct: 285 PKF--LSEGAANLIKKMLIVNPLNRISMTEIIHDEWFK 320

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  243 bits (619), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 178/278 (64%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G RIG + + +TLG GS GKV +A +V TGQ  A+KII++ +    + QG          
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLSKSDMQGR--------- 86

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI  ++LL HP+++RLYDV ++  ++ M++EY    ELF+ +++R  + ENE
Sbjct: 87  -----IEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENE 140

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A +FF+QII  + YCH   IVHRDLKPENLLLD  +N+K+ DFG++ + +    L+TSCG
Sbjct: 141 ARKFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCG 200

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPILFKNISNGIYTL 258

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P+   +S  A  LI K+L V+P  RI   EI++    K
Sbjct: 259 PNF--LSDGAASLIKKMLIVNPINRISISEIMQDEWFK 294

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  240 bits (613), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 178/279 (63%), Gaps = 22/279 (7%)

Query: 13  KGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDP 69
           +G  IG + + +TLG GS GKV +A ++ TGQ  A+KII+K +    + QG         
Sbjct: 28  QGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGR-------- 79

Query: 70  DVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPEN 129
                 IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  +PE 
Sbjct: 80  ------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQ 132

Query: 130 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSC 189
           EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSC
Sbjct: 133 EARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 192

Query: 190 GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFE 249
           GSP+YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + 
Sbjct: 193 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPVLFKNISNGVYT 250

Query: 250 MPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           +P+   +S  A  LI K+L V+P  RI   EI++    K
Sbjct: 251 IPNF--LSQGAASLIKKMLIVNPVNRITVHEIMQDEWFK 287

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  241 bits (614), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 178/278 (64%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G  IG + + +TLG GS GKV +A ++ TGQ  A+KII+K +    + QG          
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 90

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + E+E
Sbjct: 91  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDE 144

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 145 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 204

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 205 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPVLFKNINNGVYTI 262

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A  LI K+L V+P  RI  +EI++    K
Sbjct: 263 PKF--LSQGASTLIKKMLIVNPLNRISIQEIMQDEWFK 298

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  241 bits (615), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 177/273 (64%), Gaps = 22/273 (8%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G +IG + + +TLG GS GKV +A ++ TGQ  A+KII+K I    + QG          
Sbjct: 43  GSKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAKSDMQGR--------- 93

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ +V+E+    ELF+ +I+R  + ENE
Sbjct: 94  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENE 147

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 148 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCG 207

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 208 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPVLFKNISNGVYIL 265

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283
           P    +S  A  LI ++L V+P  RI   EI++
Sbjct: 266 PKF--LSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  240 bits (612), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 176/278 (63%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G  IG + + +TLG GS GKV +A +  TGQ  A+KII+K +    + QG          
Sbjct: 48  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------- 98

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + E+E
Sbjct: 99  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEDE 152

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 153 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 212

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 213 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPVLFKNISNGVYSL 270

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A  LI ++L V+P  RI   EI++    K
Sbjct: 271 PKF--LSPGAASLIKRMLIVNPLNRISIHEIMQDDWFK 306

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  240 bits (612), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 127/289 (43%), Positives = 179/289 (61%), Gaps = 22/289 (7%)

Query: 3   TKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQ 59
           T +N   +   G  IG + + +TLG GS GKV +A +  TGQ  A+KII+K +    + Q
Sbjct: 38  TLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQ 97

Query: 60  GSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNL 119
           G               IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ 
Sbjct: 98  GR--------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDY 142

Query: 120 LIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALE 179
           +++R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + 
Sbjct: 143 IVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIM 202

Query: 180 SKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKL 239
           +    L+TSCGSP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L
Sbjct: 203 TDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPVL 260

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
              + +G + +P    +S  A  LI ++L V+P  RI   EI++    K
Sbjct: 261 FKNISNGVYTLPKF--LSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  239 bits (611), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 176/273 (64%), Gaps = 22/273 (8%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G RIG + + +TLG GS GKV +A ++ T Q  A+KII+K +    + QG          
Sbjct: 39  GSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKSDMQGR--------- 89

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ +V+E+    ELF+ +I+R  + E E
Sbjct: 90  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQE 143

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 144 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCG 203

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 204 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPVLFKNISNGVYIL 261

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283
           P    +S+ A +LI K+L V+P  RI   EI K
Sbjct: 262 PKF--LSLGAANLIKKMLIVNPLNRISISEIFK 292

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  239 bits (611), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 175/278 (62%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G  IG + + +TLG GS GKV +A +  TGQ  A+KII+K +    + QG          
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------- 99

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + E E
Sbjct: 100 -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQE 153

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 154 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 213

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 214 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPVLFKNISNGVYTL 271

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A  LI ++L V+P  RI   EI++    K
Sbjct: 272 PKF--LSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  239 bits (609), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 127/278 (45%), Positives = 178/278 (64%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G RIG + + +TLG GS GKV +A +V TGQ  A+KII+K +    + QG          
Sbjct: 33  GQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR--------- 83

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + ENE
Sbjct: 84  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENE 137

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 138 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 197

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 198 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPVLFKNISNGVYSI 255

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A +LI ++L V+P  RI   EI++    K
Sbjct: 256 PKF--LSQGAANLIKRMLIVNPLNRITIHEIMEDEWFK 291

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  239 bits (609), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 141/342 (41%), Positives = 195/342 (57%), Gaps = 52/342 (15%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G RIG + + +TLG GS GKV +A +V TGQ  A+KII+K +    + QG          
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR--------- 86

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + E E
Sbjct: 87  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKE 140

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 141 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 200

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 201 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPVLFKNISNGVYTL 258

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLN 310
           P    +S  A  LI ++L V+P  RI   EI++    K            +LP    YL 
Sbjct: 259 PKF--LSPGAAGLIKRMLIVNPLNRISIHEIMQDEWFK-----------VDLP---DYLI 302

Query: 311 PLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEK 352
           P D                L H + ENE      E GP+ E+
Sbjct: 303 PAD----------------LKHQQPENEEAQTAAENGPHQEE 328

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  238 bits (608), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 178/278 (64%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G +IG + + +TLG GS GKV +A +  T Q  A+KII+K +    + QG          
Sbjct: 24  GSKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGR--------- 74

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY +  ELF+ +++R  + ENE
Sbjct: 75  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENE 128

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
             RFF+QII  + YCH   IVHRDLKPENLLLD  +N+K+ DFG++ + +    L+TSCG
Sbjct: 129 GRRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCG 188

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY LL  RLPF  DD +I  L   + +G + +
Sbjct: 189 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPF--DDESIPTLFKNINNGVYTI 246

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P+   +S  A  LI K+L V+P  RI   +I++ P  K
Sbjct: 247 PNF--LSEGAASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  238 bits (608), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 177/278 (63%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G +IG + + +TLG GS GKV +A +  TGQ  A+KII++ +    + QG          
Sbjct: 38  GSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGR--------- 88

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY +  ELF+ +++R  + E E
Sbjct: 89  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSEQE 142

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 143 ARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 202

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 203 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPVLFKNINNGIYTL 260

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A  LI K+L V+P  RI   EI++    K
Sbjct: 261 PRF--LSEGASSLIKKMLIVNPLNRISIHEIMQDEWFK 296

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  238 bits (607), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 175/278 (62%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G  IG + + +TLG GS GKV +A +  TGQ  A+KII+K +    + QG          
Sbjct: 50  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------- 100

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + E E
Sbjct: 101 -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQE 154

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 155 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 214

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWSCGVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 215 SPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPF--DDESIPVLFKNISNGVYTL 272

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A  LI ++L V+P  RI   EI++    K
Sbjct: 273 PKF--LSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 308

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  239 bits (610), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 182/292 (62%), Gaps = 23/292 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G  IG + + +TLG GS GKV +A ++ TGQ  A+KII+K +    + QG          
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------- 105

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + ENE
Sbjct: 106 -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENE 159

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 160 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 219

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 220 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPVLFKNINNGVYTI 277

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK-KYPSIKDSKSIRN 301
           P    +S  A  LI ++L V+P  RI   EI++    K   P    S+ +RN
Sbjct: 278 PKF--LSQGASSLIKRMLIVNPLNRISISEIMQDEWFKVDLPEYLLSQDLRN 327

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  237 bits (604), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/278 (45%), Positives = 177/278 (63%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G RIG + + +TLG GS GKV +A +V T Q  A+KII+K +    + QG          
Sbjct: 37  GQRIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR--------- 87

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + ENE
Sbjct: 88  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENE 141

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 142 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 201

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 202 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPVLFKNISNGVYSI 259

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A +LI K+L V+P  RI   EI++    K
Sbjct: 260 PKF--LSPGAANLIKKMLIVNPLNRITIHEIMEDQWFK 295

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  236 bits (603), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 176/276 (63%), Gaps = 22/276 (7%)

Query: 16  RIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPDVL 72
           RIG + + +TLG GS GKV +A +V TGQ  A+KII+K +    + QG            
Sbjct: 27  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 75

Query: 73  PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAV 132
              IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + ENEA 
Sbjct: 76  ---IEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEAR 131

Query: 133 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L TSCGSP
Sbjct: 132 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSP 191

Query: 193 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPD 252
           +YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + +P 
Sbjct: 192 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPVLFKNISNGIYTLPK 249

Query: 253 KDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
              +S  A +LI ++L V+P  RI   EI++    K
Sbjct: 250 F--LSPGAANLIKRMLIVNPLNRITIHEIMQDEWFK 283

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  235 bits (599), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 124/276 (44%), Positives = 177/276 (64%), Gaps = 22/276 (7%)

Query: 16  RIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPDVL 72
           RIG + + +TLG GS GKV +A ++ TGQ  A+KII+K +    + QG            
Sbjct: 28  RIGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR----------- 76

Query: 73  PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAV 132
              IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + E+EA 
Sbjct: 77  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEAR 132

Query: 133 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCGSP
Sbjct: 133 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 192

Query: 193 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPD 252
           +YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + +P 
Sbjct: 193 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPVLFKNISNGVYTLPK 250

Query: 253 KDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
              +S  A +LI ++L V+P  RI   EI++    K
Sbjct: 251 F--LSPGASNLIKRMLIVNPLNRITIHEIMQDEWFK 284

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  234 bits (597), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 176/276 (63%), Gaps = 22/276 (7%)

Query: 16  RIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPDVL 72
           RIG + + +TLG GS GKV +A +V TGQ  A+KII+K +    + QG            
Sbjct: 26  RIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR----------- 74

Query: 73  PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAV 132
              IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + E EA 
Sbjct: 75  ---IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREAR 130

Query: 133 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCGSP
Sbjct: 131 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 190

Query: 193 HYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPD 252
           +YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + +P 
Sbjct: 191 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPILFKNISNGIYTLPK 248

Query: 253 KDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
              +S  A +LI ++L V+P  RI   EI++    K
Sbjct: 249 F--LSPGAANLIKRMLIVNPLNRITIHEIMEDEWFK 282

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  232 bits (591), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 175/278 (62%), Gaps = 22/278 (7%)

Query: 14  GGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIF---NAQGSTFVGSNDPD 70
           G  IG + + +TLG GS GKV +A ++ TGQ  A+KII+K +    + QG          
Sbjct: 45  GSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR--------- 95

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                IEREI+ ++LL HP++++LYDV ++  ++ MV+EY    ELF+ +++R  + E E
Sbjct: 96  -----IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEE 149

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPENLLLD   N+K+ADFG++ + +    L+TSCG
Sbjct: 150 ARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 209

Query: 191 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEM 250
           SP+YAAPE++SG  Y G E DVWS GVILY +L  RLPF  DD +I  L   + +G + +
Sbjct: 210 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPF--DDESIPVLFKNISNGVYTL 267

Query: 251 PDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P    +S  A  LI ++L V+P  RI   EI++    K
Sbjct: 268 PKF--LSEGAAGLIKRMLIVNPLNRISILEIMQDDWFK 303

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  215 bits (548), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 117/309 (37%), Positives = 185/309 (59%), Gaps = 26/309 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKS--IFNAQGSTFVGS-------N 67
           +G W   ET+G GS GKV +A+N QT ++ A+KI++++  IF  + S  +         N
Sbjct: 94  LGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIMN 153

Query: 68  DPDVLPYG--IEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGE 115
           + D+L     +E+EI+          + ++L HP++ RL++++  S   YM+ EYV  G+
Sbjct: 154 EKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGGQ 213

Query: 116 LFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGM 175
           L + +I+ G L E+ A  F RQI+  + Y HA  IVHRDLK EN+++    NIK+ DFG+
Sbjct: 214 LLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFGL 273

Query: 176 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN 235
           + L  K K L+T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ N
Sbjct: 274 SNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 333

Query: 236 IRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHP-LLKKYPSIK 294
           +  L  K++ G    P    +SIE   L++ +L VDP  R    +++KH  ++K Y SI 
Sbjct: 334 V--LHEKIKQGRVFYP--QFLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSIP 389

Query: 295 DSKSIRNLP 303
           D+   + +P
Sbjct: 390 DAHLPKRVP 398

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  205 bits (522), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 122/322 (37%), Positives = 174/322 (54%), Gaps = 38/322 (11%)

Query: 13  KGGRIGPWMLGETLGVGSTGKVLMAQNVQTG--------QIAAVKIISKSIFNAQGSTFV 64
           K    GP+++G TLG G  GKV M      G        +  A+K+I +   +   S  V
Sbjct: 35  KCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSISNDKSKEV 94

Query: 65  GSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERG 124
                      I REI  +K L+HPN+++L +V + S  + +VLEY   GE +  + +R 
Sbjct: 95  K----------IYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKRR 144

Query: 125 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDK 183
            L E+ A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++
Sbjct: 145 VLKEHVACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQNE 204

Query: 184 LLETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IR 237
           L+ TSCGSP YAAPE+V S  PY G  +D+WSCG+IL+A+L G LP+D+D  N     I 
Sbjct: 205 LMTTSCGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIA 264

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPS----- 292
           KL   +     + P  + I+   +DL+ +IL  DP  R+  REI  H  LKK+       
Sbjct: 265 KLYYYITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQ 322

Query: 293 ------IKDSKSIRNLPREDTY 308
                 I  SK+I  LP+ + +
Sbjct: 323 PEEWDRISQSKNITRLPKHNKH 344

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  207 bits (528), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 177/288 (61%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++ +TG++ A+KI+   +K+  + + ++    N+ +++ 
Sbjct: 105 LGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIME 164

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++  HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 165 RQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYII 224

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R +   + Y HA  IVHRDLK EN+++ +   IK+ DFG++ +   
Sbjct: 225 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYDT 284

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 285 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 342

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G+ E P    +SIE   L++K+L VDPS R   +++++HP + K
Sbjct: 343 KIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  206 bits (524), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 204/362 (56%), Gaps = 33/362 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDV-- 71
           +G W   ET+G GS GKV +A++ QT +I A+KI+   +K+  + + S     N+ ++  
Sbjct: 161 LGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKAFLHKEQSMPPPKNEQEIAE 220

Query: 72  ----LPYGIER------EITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               L   I R      E ++ ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 221 RQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 280

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y H   IVHRDLK EN+++ +   IK+ DFG++ +   
Sbjct: 281 QHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFGLSNVFDN 340

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS G++LY L+ G++PFD+++ ++  L  
Sbjct: 341 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDENSSV--LHE 398

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRN 301
           K++ G+ E P  + +SIE   L++K++ VDP+ R   R++++HP + +     D   +  
Sbjct: 399 KIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRG---YDFPPLSY 453

Query: 302 LPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEI---VMKLNEQGPNLEKT--FYA 356
           LPR    L P       +D  +L+ +  L    D  E    ++K+  + P LE++  F+ 
Sbjct: 454 LPRR-IPLTP-----EAIDNNVLREMFRLEFIDDVEECQNSLIKIITEEPYLERSRGFWQ 507

Query: 357 LL 358
           L+
Sbjct: 508 LV 509

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  204 bits (518), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 163/291 (56%), Gaps = 29/291 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMA----------QNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
            GP+++G T+G G  GKV +            N+   +  A+K+I +   +   S  +  
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAISKDSSKELK- 124

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
                    I REI  +K L+HPN+++L +V + S  + +VLEY   GE +  +  +  L
Sbjct: 125 ---------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRKKRL 175

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 185
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S ++L+
Sbjct: 176 KETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHNELM 235

Query: 186 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKL 239
           +TSCGSP YAAPE+V S  PY   ++D+WSCG+ILYA+L G LP+D+D GN     I +L
Sbjct: 236 KTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDISRL 295

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
              +     + P  D I+   +DL+ KIL  DP  RI  ++I KH  LK +
Sbjct: 296 YYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  205 bits (522), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 170/283 (60%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++ +T +I A+KI+   +K+  + + S    +ND +++ 
Sbjct: 142 LGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIME 201

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 202 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 261

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A RF R I   + Y HA  IVHRDLK EN+++     IKL DFG++ L   
Sbjct: 262 QHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYDN 321

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 322 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 379

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+ E      +SIE   L++K+L VDP  R   ++++ H
Sbjct: 380 KIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  204 bits (519), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 166/288 (57%), Gaps = 24/288 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYG- 75
           +G W   ET+G GS GKV +A+N +T ++ A+KI++++        +   ++   +P   
Sbjct: 68  LGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLSE 127

Query: 76  ---IER----------------EITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGEL 116
              IER                E ++ ++L HP++ RLY++   S   YM+ EYV  G+L
Sbjct: 128 KEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQL 187

Query: 117 FNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA 176
            + +I+ G L E+ A  F RQI   + Y H+  IVHRDLK EN+++    NIKL DFG++
Sbjct: 188 LDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGLS 247

Query: 177 ALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNI 236
            L  K   L+T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ N+
Sbjct: 248 NLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNV 307

Query: 237 RKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
             L  K++ G+   P    +SIE   L++K+L VDP  R    +++ H
Sbjct: 308 --LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  198 bits (503), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 171/290 (58%), Gaps = 23/290 (7%)

Query: 13  KGGRIGPWMLGETLGVGSTGKVLMA----QNVQTGQIAAVKIISKSIFNAQGS------- 61
           K  R G + LG+TLG G  GKV +      N+ T   +  K+ + S    Q +       
Sbjct: 52  KQPRFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRD 111

Query: 62  TFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
           T   S + ++  Y   REI  +K+L HPN+++L +V + S  + +VLEY   GE +  + 
Sbjct: 112 TLSASKESEIKLY---REINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIK 168

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
            +  L E++A   F Q+I G+SY H+ G+VHRDLK ENLLLD   N+ + DFG     +K
Sbjct: 169 FKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFGFVNEVTK 228

Query: 182 -DKLLETSCGSPHYAAPEIVSGL-PYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR-- 237
            +KL+ T CGSP YAAPE+V+ + PY+  ++D+WSCGVILYA+L G LP+D+D  NI   
Sbjct: 229 TNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDDPKNINGT 288

Query: 238 ---KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
              KL   +++   + P  + I++  +DL+ ++L +DP+ R+  + IL+H
Sbjct: 289 DIVKLYKYIENQPLKFP--EYINMVPRDLLRRMLEIDPAKRMSMKHILQH 336

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  199 bits (507), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/293 (40%), Positives = 165/293 (56%), Gaps = 27/293 (9%)

Query: 16  RIGPWMLGETLGVGSTGKVLMAQNVQTGQIA--------AVKIISKSIFNAQGSTFVGSN 67
           R G ++LG TLG G  GKV +  +  +   +        A+K+I +  +  +GS      
Sbjct: 42  RFGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRD-YVKKGS------ 94

Query: 68  DPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP 127
           D ++    I REI  +KLL HPN++RL +V + S  + +VLE+   GE +  L  +  L 
Sbjct: 95  DKEI---KIYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRLK 151

Query: 128 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLE 186
           E  A + F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ + DFG        ++L++
Sbjct: 152 EPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELMK 211

Query: 187 TSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLL 240
            SCGSP YAAPE+V S  PY   + D+WSCG+ILYA+L G LP+D+D  N     I KL 
Sbjct: 212 RSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLY 271

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
             +     + P    IS  A+DLI KILT +PS RI    I KH  LK + S 
Sbjct: 272 QYITKTALKFP--AYISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  203 bits (517), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 177/293 (60%), Gaps = 22/293 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIIS---KSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++ QT +I A+KI++   K+  + + S      + +VL 
Sbjct: 159 LGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVLE 218

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 219 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 278

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +  +
Sbjct: 279 QHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFDR 338

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 339 KKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 396

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK---YP 291
           K++ G+ + P  + +SIE   L++K+L VDP  R   +++++HP + +   YP
Sbjct: 397 KIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  202 bits (515), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 104/283 (36%), Positives = 170/283 (60%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T ++ AVKI+   +K+  + +       N+ DVL 
Sbjct: 115 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G + E++A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 235 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+++ ++  L  
Sbjct: 295 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+ E P    +SIE   L++K+L VDP  R   +++++H
Sbjct: 353 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  200 bits (508), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 162/288 (56%), Gaps = 34/288 (11%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQI-----AAVKIISKSIFNAQGSTFVGSNDPDV 71
            GP+ +G TLG G  GKV +     T ++      A+K+I +                 +
Sbjct: 37  FGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDA---------------I 81

Query: 72  LPYG-----IEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
           L Y      I REI  +K L HPN+++L +V + S  + +VLE+   GE +  + ++  L
Sbjct: 82  LNYSEKETKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRL 141

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 185
            E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG       +++L+
Sbjct: 142 KETPACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELM 201

Query: 186 ETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDED----DG-NIRKL 239
           +TSCGSP YAAPE +V+  PY   ++DVWSCG+ILYA+L G LP+D+D    DG +I KL
Sbjct: 202 KTSCGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKL 261

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
            L +     + P+   I+   +DL+ KIL  DP+ R+  R I KH  L
Sbjct: 262 YLYITKTALKFPEY--INPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  200 bits (509), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 163/294 (55%), Gaps = 29/294 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMA-----QNVQTGQI-----AAVKIISKSIFNAQGSTFVGS 66
            GP++LG TLG G  GKV +       N  T         AVK+I +   +      V  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKEVK- 96

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
                    I REI  +K L+HPN+++L +V + S  + +VLEY   GE +  + ++  L
Sbjct: 97  ---------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 185
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+
Sbjct: 148 KETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 186 ETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKL 239
           +TSCGSP YAAPE +VS  PY   ++D+WSCGVILYA+L G LP+D+D  N     I +L
Sbjct: 208 KTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRL 267

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
              + S   + P  D I    +DL+ +IL  DP  RI  ++I KH  LK + S 
Sbjct: 268 YNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  202 bits (514), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 110/315 (34%), Positives = 183/315 (58%), Gaps = 23/315 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++ +T ++ A+KI+   +KS    + S     ++ + L 
Sbjct: 151 LGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEASLPPPKSEEEALE 210

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 211 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLDYII 270

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y H   IVHRDLK EN+++    +IK+ DFG++ L   
Sbjct: 271 QHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNLYDS 330

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E D+WS GV+LY L  G++PFD+++ ++  L  
Sbjct: 331 KKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LHE 388

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRN 301
           K++ G+ + P    +SIE   L++K+L VDP  R   ++I+ HP + +     D+K+   
Sbjct: 389 KIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTRG---FDTKAPSY 443

Query: 302 LP-REDTYLNPLDHN 315
           LP R    ++ ++HN
Sbjct: 444 LPLRVPMSIDMINHN 458

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  200 bits (509), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 167/286 (58%), Gaps = 24/286 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTG-----QIAAVKIISKSIFNAQGSTFVGSNDPDV 71
            GP+++G TLG G  GKV +  +  TG     +  A+K+I +        T   ++D +V
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRD-------TVPKNSDKEV 93

Query: 72  LPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEA 131
               I REI  +K L HPN++RL +V + S  + +VLEY   GE +  + ++  L E+ A
Sbjct: 94  ---KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLKEHAA 150

Query: 132 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 190
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG       K++L++TSCG
Sbjct: 151 CRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMKTSCG 210

Query: 191 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLLLKVQ 244
           SP YAAPE +V+  PY   ++D+WSCGVI+YA+L G LP+D+D  N     I KL   + 
Sbjct: 211 SPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYIT 270

Query: 245 SGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
               + P+   I+   +DL+ +IL  +P  R+  R++ +H  L+ +
Sbjct: 271 KTPLKFPEY--INPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  199 bits (505), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 169/286 (59%), Gaps = 24/286 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLM--AQNVQTGQIA---AVKIISKSIFNAQGSTFVGSNDPDV 71
            GP++LG TLG G  G+V +  ++N    +++   A+K+I +        T   ++D ++
Sbjct: 41  FGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRD-------TIPKNSDKEI 93

Query: 72  LPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEA 131
               I REI  +K L+HPN+++L +V + S  + +VLEY   GE +  + ++  L E  A
Sbjct: 94  ---KIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEAVA 150

Query: 132 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 190
            R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      +  +L++TSCG
Sbjct: 151 CRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMKTSCG 210

Query: 191 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDED----DGN-IRKLLLKVQ 244
           SP YAAPE +VS  PY   ++D+WSCGVILYA+L G LP+D+D    DGN I KL   + 
Sbjct: 211 SPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQYIT 270

Query: 245 SGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
               + P+   I+   +DL+ +IL  DP  RI  R I KH  +K +
Sbjct: 271 RTPLKFPEY--ITPLPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  199 bits (506), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/287 (39%), Positives = 165/287 (57%), Gaps = 25/287 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLM------AQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPD 70
            GP+++G TLG G  GKV +      + +++  +  A+K+I +          V      
Sbjct: 36  FGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRRDSIPKNSEKEVK----- 90

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
                I REI  +K L+HPN+++L +V + S  + +VLEY   GE +  +  +  L E  
Sbjct: 91  -----IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKEAI 145

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSC 189
           A R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ + DFG      S ++L++TSC
Sbjct: 146 ACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHNELMKTSC 205

Query: 190 GSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDED----DGN-IRKLLLKV 243
           GSP YAAPE +VS  PY   +SDVWSCGVILYA+L G LP+D+D    DGN I +L   +
Sbjct: 206 GSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYI 265

Query: 244 QSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
                + P  + I+  ++DL+ +IL  DP  RI  R I KH  LK +
Sbjct: 266 TRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  195 bits (496), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 164/289 (56%), Gaps = 27/289 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMA-----QN---VQTGQIAAVKIISKSIFNAQGSTFVGSND 68
            GP+ LG T+G G  GKV        QN   +  G+  A+K+I +        T     D
Sbjct: 52  FGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRD-------TLAEKKD 104

Query: 69  PDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPE 128
            ++  Y   REI  +KLL+HPN+++L DV + S  + +VLEY   GE +  L  +  L E
Sbjct: 105 QELKVY---REINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRKKRLKE 161

Query: 129 NEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLET 187
             A   F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ + DFG    + + +KL++T
Sbjct: 162 PLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNNKLMKT 221

Query: 188 SCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDED----DG-NIRKLLL 241
            CGSP YAAPE+V S  PY   ++D+WS GVILYA+L G LP+D+D    DG NI +L  
Sbjct: 222 PCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMRLYE 281

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
            +     + PD   I   A+DLI KIL + P  R+   ++ +H  LK +
Sbjct: 282 YITKNNLKFPDY--IEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  201 bits (510), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 104/283 (36%), Positives = 170/283 (60%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T ++ AVKI+   +K+  + +       N+ DVL 
Sbjct: 128 LGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 187

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 188 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 247

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G + E++A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 248 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 307

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+++ ++  L  
Sbjct: 308 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 365

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+ E P    +SIE   L++K+L VDP  R   +++++H
Sbjct: 366 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  199 bits (505), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 167/287 (58%), Gaps = 25/287 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLM------AQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPD 70
            GP+++G TLG G  GKV M      + ++   +  A+K+I +        T   +++ +
Sbjct: 37  FGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRD-------TIPKNSEKE 89

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
           V  Y   REI  +K LNHPN++RL +V + S  + +VLEY   GE +  + ++  L E+ 
Sbjct: 90  VKIY---REINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESA 146

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSC 189
           A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG       +++L++TSC
Sbjct: 147 ACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSC 206

Query: 190 GSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDED----DG-NIRKLLLKV 243
           GSP YAAPE +V+  PY   ++D+WSCGVI+YA+L G LP+D+D    DG +I KL   +
Sbjct: 207 GSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYI 266

Query: 244 QSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
                + P  D I+   +DL+  IL  DP  RI   + L H  L+ +
Sbjct: 267 TRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  200 bits (509), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 173/286 (60%), Gaps = 19/286 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++ QT +I A+KI+   +K+  + + S     N+ ++L 
Sbjct: 98  LGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQSLAPPKNENEMLE 157

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 158 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 217

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R +   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 218 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFDT 277

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E D+WS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 278 RKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV--LHE 335

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           K++ G+ E P  + +SIE   L++K+L VDP  R    ++++HP +
Sbjct: 336 KIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  199 bits (505), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 29/291 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLM----------AQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
            GP+++G TLG G  GKV +          +  +   +  A+K+I +   +   S  +  
Sbjct: 45  FGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIK- 103

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
                    I REI  +K L HPN+++L +V + S  + +VLEY   GE +  +  +  L
Sbjct: 104 ---------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRL 154

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA-LESKDKLL 185
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG  +   S  +L+
Sbjct: 155 KEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELM 214

Query: 186 ETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKL 239
           +TSCGSP YAAPE +VS  PY   ++D+WSCGVILYA+L G LP+D+D GN     I +L
Sbjct: 215 KTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRL 274

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
              +     + P  D I+   +DL+ +IL  DP  RI  + I KH  LK +
Sbjct: 275 YHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  200 bits (508), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 104/283 (36%), Positives = 171/283 (60%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++ +T ++ AVKI+   +K+  + +       N+ DVL 
Sbjct: 115 LGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G + E++A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 235 QHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+++ ++  L  
Sbjct: 295 RKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+ E P    +SIE   L++K+L VDP  R   +++++H
Sbjct: 353 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  200 bits (508), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 170/288 (59%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV + ++ QT ++  +KI+   SK+  + Q S     N+ ++L 
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQHSLPPPKNENELLE 163

Query: 74  YG--IEREI----------TIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI          ++ ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 164 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++ +   IK+ DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNIFDS 283

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E D+WS G++LY L+ G++PFD+++ +I  L  
Sbjct: 284 KKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G+ + P    +SI+A  L+ +++ VDP  R   + +  HP + +
Sbjct: 342 KIKKGKVDYP--SHLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  197 bits (502), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 167/287 (58%), Gaps = 25/287 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMA------QNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPD 70
            GP+++G TLG G  GKV +        ++   +  A+K+I +        T   +++ +
Sbjct: 37  FGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRD-------TIPKNSEKE 89

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
           +  Y   REI  +K LNHPN++RL +V + S  + +VLEY   GE +  + ++  L E  
Sbjct: 90  IKIY---REINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGP 146

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSC 189
           A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG       +++L++TSC
Sbjct: 147 ACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSC 206

Query: 190 GSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDED----DG-NIRKLLLKV 243
           GSP YAAPE +V+  PY   ++DVWSCGVILYA+L G LP+D+D    DG +I KL   +
Sbjct: 207 GSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYI 266

Query: 244 QSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
                + P  D I+   +DL+ +IL  DP  RI   + LKH  L+ +
Sbjct: 267 TRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  197 bits (502), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 29/291 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLM----------AQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
            GP++LG TLG G  GKV +          A   +  +  AVK+I +   +      V  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKKEVK- 96

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
                    I REI  +K L+HPN+++L +V + S  + +VLEY   GE +  + ++  L
Sbjct: 97  ---------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 185
            E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+
Sbjct: 148 KETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 186 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKL 239
           +TSCGSP YAAPE+V S  PY   ++D+WSCGVILYA+L G LP+D+D  N     I +L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRL 267

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
              + S   + P  D I    +DL+ +IL  DP  R+  ++I KH  L  +
Sbjct: 268 YNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSH 316

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  199 bits (506), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 170/283 (60%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T ++ AVKI+   +K+  + +       N+ DVL 
Sbjct: 117 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 176

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 177 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 236

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G + E++A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 237 QHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDS 296

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+++ ++  L  
Sbjct: 297 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 354

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+ E P    +SIE   L++K+L VDP  R   +++++H
Sbjct: 355 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  199 bits (507), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 170/288 (59%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV + ++ QT ++  +KI+   SK+  + Q S     N+ +VL 
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVLE 163

Query: 74  YG--IEREI----------TIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI          ++ ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 164 RQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y H+  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 283

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E D+WS G++LY L+ G++PFD+++ +I  L  
Sbjct: 284 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G+ + P    +SIEA  L+ K++ VDP  R   + ++ HP + +
Sbjct: 342 KIKKGKVDYP--SHLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  197 bits (501), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 162/291 (55%), Gaps = 29/291 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMA----------QNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
            GP++LG TLG G  GKV +             ++  +  AVK+I +   +      V  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKKEVK- 96

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
                    I REI  +K L+HPN+++L +V + S  + +VLEY   GE +  + +R  L
Sbjct: 97  ---------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQKRRRL 147

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 185
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+
Sbjct: 148 KEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 186 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKL 239
           +TSCGSP YAAPE+V S  PY   ++D+WSCGVILYA+L G LP+D+D  N     I +L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRL 267

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
              +     + PD   I    +DL+ +IL  DP  RI  ++I KH  LK +
Sbjct: 268 YNYISLTPLKFPDY--ILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  199 bits (505), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 169/288 (58%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVL- 72
           +G W   ET+G GS GKV +A++  T +I A+KI+   +KS  + Q       ++ + L 
Sbjct: 76  LGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQMTPPKSEQEALE 135

Query: 73  -PYGIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 136 RKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 195

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E  A +F R I   + Y H   IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 196 QHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNMYDP 255

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 256 KKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV--LHE 313

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G+ E P    +SIE   L++K+L VDPS R   ++++ H  +++
Sbjct: 314 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  199 bits (505), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 170/288 (59%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV + ++ QT +I  +KI+   SK+  + Q S     N+ ++L 
Sbjct: 96  LGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEILE 155

Query: 74  YG--IEREI----------TIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI          ++ ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 156 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 215

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 216 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 275

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E D+WS G++LY L+ G++PFD+++ +I  L  
Sbjct: 276 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 333

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G+ + P    +SIE   L+ +++ VDP  R   + +++HP + +
Sbjct: 334 KIKKGKVDYP--SHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  197 bits (500), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 164/294 (55%), Gaps = 29/294 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMA--QNVQTG--------QIAAVKIISKSIFNAQGSTFVGS 66
            GP++LG TLG G  GKV +   +N            +  A+K+I +   +      V  
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVK- 96

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
                    I REI  +K L+HPN+++L +V + S  + +VLEY   GE +  + ++  L
Sbjct: 97  ---------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRL 147

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 185
            E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      S+++L+
Sbjct: 148 KEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELM 207

Query: 186 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKL 239
           +TSCGSP YAAPE+V S  PY   ++D+WSCGVILYA+L G LP+D+D  N     I +L
Sbjct: 208 KTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRL 267

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
              + S   + P  D I    +DL+ ++L  DP  RI  ++I KH  LK + S 
Sbjct: 268 YNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  198 bits (504), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 170/288 (59%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV + ++ QT ++  +KI+   SK+  + Q +     N+ ++L 
Sbjct: 103 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEILE 162

Query: 74  YG--IEREI----------TIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI          ++ ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 163 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 222

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 223 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 282

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E D+WS G++LY L+ G++PFD+++ +I  L  
Sbjct: 283 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 340

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G+ + P    +SIEA  L+ +++ +DP  R   + ++ HP + +
Sbjct: 341 KIKKGKVDYP--SHLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  196 bits (499), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 112/279 (40%), Positives = 153/279 (54%), Gaps = 25/279 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T Q   +K   KS             DP+V+    
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS-------------DPNVV---- 81

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  ++P + +LY+V  T T ++M LEY    EL++ L+ +  LP  E    F 
Sbjct: 82  -REVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFA 140

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI   + Y H L  VHRDLK EN+LLD   N KL DFG         +LET CG+  Y A
Sbjct: 141 QITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMA 200

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE- 255
           PE++   PY GF+ D+WS GVILY LL G LPFDEDD      LL  Q    + P  DE 
Sbjct: 201 PEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVIDER 255

Query: 256 ISI-EAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
           I+I EAQ+LI ++L+ DP+ R  T  IL HP L+ Y ++
Sbjct: 256 ITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  193 bits (490), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 163/291 (56%), Gaps = 29/291 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMA----------QNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
            GP+++G TLG G  GKV +           Q     +  A+K+I +        T V +
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRD-------TIVKN 93

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
           ++ ++    I REI  +K L HPNV+RL +V + S  + +VLEY   GE +  +  +  L
Sbjct: 94  SEKEI---KIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRL 150

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 185
            E+ A R F Q+I G++Y H+  +VHRDLK ENLLLD   N+ + DFG        ++ +
Sbjct: 151 KESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYM 210

Query: 186 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKL 239
           +TSCGSP YAAPE+V S  PY   ++DVWSCG+ILYA+L G LP+D+D  N     I KL
Sbjct: 211 KTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKL 270

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
              +     + P+   I+   +DL+ KIL  DP+ R+  + I +H  LK +
Sbjct: 271 YQYITRTPLKFPEY--ITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  197 bits (502), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 172/288 (59%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T +I A+KI+   +K+  + + +     ++ ++L 
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQNLPPPKSEQEILQ 165

Query: 74  YG--IEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 166 RQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 225

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 226 QHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVYDP 285

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD++  ++  L  
Sbjct: 286 RKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV--LHE 343

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G  E P  + +SIE   L++K+L VDP  R   +++++HP + +
Sbjct: 344 KIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNR 389

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  197 bits (502), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 170/283 (60%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKS---IFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T ++ A+KI++++     + + S      + ++L 
Sbjct: 75  LGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRATNAFLHKEQSLPPPKKEEEILE 134

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 135 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 194

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L  K
Sbjct: 195 QHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNLFDK 254

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 255 SKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 312

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+ E P    +SIE   L++K+L VDP  R   +++++H
Sbjct: 313 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  194 bits (493), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 166/301 (55%), Gaps = 39/301 (12%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIA--------------------AVKIISKSIF 56
            GP+++G TLG G  GKV +A +    Q                      A+K+I +   
Sbjct: 45  FGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFI 104

Query: 57  NAQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGEL 116
                    + DP      I REI  +K L+HPN+++L +V + S  + +VLEY   GE 
Sbjct: 105 ---------TKDPSK-ETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEF 154

Query: 117 FNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA 176
           +  +  +  L EN A R F Q+I  + Y H+ G+VHRDLK ENLLLD++ N+ + DFG  
Sbjct: 155 YKFIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFV 214

Query: 177 -ALESKDKLLETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDED-- 232
                ++ +++TSCGSP YAAPE +VS  PY   ++D WSCG+IL+A+L G LP+D+D  
Sbjct: 215 NEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPK 274

Query: 233 --DG-NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
             DG +I +L   + +   + P  + I+   +DL+ KIL +DP  RI  R I KHP L+ 
Sbjct: 275 NPDGHDISRLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLES 332

Query: 290 Y 290
           +
Sbjct: 333 H 333

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  194 bits (493), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/290 (38%), Positives = 161/290 (55%), Gaps = 24/290 (8%)

Query: 13  KGGRIGPWMLGETLGVGSTGKVLMAQN-----VQTGQIAAVKIISKSIFNAQGSTFVGSN 67
           K    GP+++G TLG G  GKV +         +  +  A+K+I +        T     
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRD-------TIKKDA 91

Query: 68  DPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP 127
           D +V  Y   REI  +K L HPN++ L +V + S  + +VLE+V  GE +  +  +  L 
Sbjct: 92  DKEVKIY---REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLK 148

Query: 128 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKD-KLLE 186
           E+ A R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ + DFG      KD +L+ 
Sbjct: 149 ESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELMN 208

Query: 187 TSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLL 240
           TSCGSP YAAPE +VS  PY   ++DVWSCGVILYA+L G LP+D+D  N     I +L 
Sbjct: 209 TSCGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLY 268

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
             +     + P+   I+   +DL+ +IL  +P  R+  R I +H  LK +
Sbjct: 269 QYITQTPLKFPEY--ITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  195 bits (495), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 162/287 (56%), Gaps = 25/287 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMA------QNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPD 70
            GP+ +G TLG G  GKV +        N +  +  A+K+I +          V +++ +
Sbjct: 41  FGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRD-------KIVKNSEKE 93

Query: 71  VLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENE 130
           +    I REI  +K L HPN+++L +V + S  + +VLEY   GE +  +  +  L E  
Sbjct: 94  I---KIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLKETA 150

Query: 131 AVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDK-LLETSC 189
             R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ + DFG      KD  L++TSC
Sbjct: 151 GCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMKTSC 210

Query: 190 GSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLLLKV 243
           GSP YAAPE+V S  PY   ++D+WSCG+ILYA+L G LP+D+D  N     I +L   +
Sbjct: 211 GSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFI 270

Query: 244 QSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
                + P+   IS   +DL+ ++L  DP  R+  R+I +H  L+ +
Sbjct: 271 TRTSLKFPEY--ISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  193 bits (490), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 164/289 (56%), Gaps = 24/289 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMA-----QNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDV 71
            GP+++G TLG G  GKV +      ++    +  A+K+I +        + +   + ++
Sbjct: 31  FGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRRD-------SILQDREKEI 83

Query: 72  LPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEA 131
               I REI  +K L HPN++RL +V + S  + +VLEY   GE +  + ++  L E  A
Sbjct: 84  ---KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEPIA 140

Query: 132 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCG 190
            + F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG        ++L++TSCG
Sbjct: 141 CKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMKTSCG 200

Query: 191 SPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLLLKVQ 244
           SP YAAPE +V+  PY   ++DVWSCG+IL+A+L G LP+D+D  N     I KL   + 
Sbjct: 201 SPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNYIT 260

Query: 245 SGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
           +   + P    IS   +DL+ KIL  +P+ R+  REI  H  LK + S 
Sbjct: 261 TSPLKFPSY--ISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  196 bits (497), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 119/304 (39%), Positives = 172/304 (56%), Gaps = 31/304 (10%)

Query: 3   TKDNSNVTSLKG-GR-----IGPWMLGETLGVGSTGKVLMA------QNVQTGQIAAVKI 50
           T  +SN+   KG GR      GP+++G TLG G  GKV +        + Q  +  A+K+
Sbjct: 49  TSYSSNIPENKGNGRRKHITFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKL 108

Query: 51  ISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEY 110
           I +          V  ++ ++    I REI  +K L HPN++RL +V + S  + +VLEY
Sbjct: 109 IRRD-------AIVKGSEKEI---KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEY 158

Query: 111 VEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKL 170
              GE +  + ++  L E+ A   F Q++ G+ Y H  G+VHRDLK ENLLLD   N+ +
Sbjct: 159 ASGGEFYKYIQKKRRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLII 218

Query: 171 ADFGMAALESK-DKLLETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLP 228
            DFG     SK  +L++TSCGSP YAAPE+V S  PY   ++D+WSCG+IL+A+L G LP
Sbjct: 219 TDFGFVNEFSKFSELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLP 278

Query: 229 FDED----DGN-IRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283
           +D+D    DGN I KL   + +   + P  + IS  A+DL+  IL   P  R   ++ILK
Sbjct: 279 WDDDPKNPDGNDIAKLYKYITTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQILK 336

Query: 284 HPLL 287
           H  L
Sbjct: 337 HQWL 340

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  196 bits (497), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 168/283 (59%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T +I A+K++   +K   + + +      + ++L 
Sbjct: 180 LGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRATKGFLHKEQTLPPPQTEQEILE 239

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 240 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 299

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y H+  IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 300 QHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYDT 359

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            + L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 360 TRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 417

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+ + P    +SIE   L++K+L VDP  R   R++++H
Sbjct: 418 KIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  191 bits (486), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 162/288 (56%), Gaps = 28/288 (9%)

Query: 16  RIGPWMLGETLGVGSTGKVLMA---QNVQTGQI------AAVKIISKSIFNAQGSTFVGS 66
           + GP+++G TLG G  GKV M     +  +G+I       A+K+I +  F  +GS     
Sbjct: 34  KFGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRD-FIKKGSE---- 88

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
                    I REI  +K L HPN++RL +V + S  + +VLEY   GE +  +  +  L
Sbjct: 89  -----KEMKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRL 143

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLL 185
            E  A R F Q+I G+SY H+ GIVHRDLK ENLLLD   N+ + DFG      + ++L+
Sbjct: 144 KEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELM 203

Query: 186 ETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKL 239
           +TSCGSP YAAPE+V +  PY   ++D+WSCG+ILY +L G LP+D+D  N     I +L
Sbjct: 204 KTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRL 263

Query: 240 LLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
              +     + P+   I+   +DL+  IL  +P  R+ +R I KH  L
Sbjct: 264 YHYITKTPLKFPEY--ITPLPRDLLRHILVSNPVRRMSSRHIKKHEWL 309

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  193 bits (490), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 107/284 (37%), Positives = 156/284 (54%), Gaps = 22/284 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLM----AQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVL 72
            GP+++G TLG G  GKV +    ++  +  +  A+K++ +          V        
Sbjct: 62  FGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTIPKHSEKEVK------- 114

Query: 73  PYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAV 132
              I REI  +K LNHPN++RL +V + S  + +VL+Y   GE +  + ++  L E  A 
Sbjct: 115 ---IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPAC 171

Query: 133 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSP 192
           R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ + DFG      K+ L++TSCGSP
Sbjct: 172 RLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTSCGSP 231

Query: 193 HYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLLLKVQSG 246
            YAAPE +V+  PY   ++DVWSCGVILYA+L G LP+D+D  N     I KL   +   
Sbjct: 232 CYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKS 291

Query: 247 EFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
             + P+   I    +DL+ +IL  +P  R+   EI  H  L+ +
Sbjct: 292 ALKFPEY--IKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  193 bits (491), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 167/295 (56%), Gaps = 31/295 (10%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLP--- 73
           +G W   ET+G GS GKV +A++  T ++ A+KI++++       +F+       LP   
Sbjct: 112 LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT-----KSFIHKQQQQQLPPPS 166

Query: 74  ---------YGIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKG 114
                      +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G
Sbjct: 167 NEEELMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 226

Query: 115 ELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFG 174
           +L + +I+ G L E  A +F R I   + Y H   IVHRDLK EN+++     I++ DFG
Sbjct: 227 QLLDYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFG 286

Query: 175 MAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDG 234
           ++ L    K L T CGS ++AAPE++   PY G E D+WS GV+LY L+ G++PFD+++ 
Sbjct: 287 LSNLYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENA 346

Query: 235 NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           ++  L  K++ G+ E P    +SI+   L++K+L VDP  R   ++++ H  ++K
Sbjct: 347 SV--LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  193 bits (491), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 170/288 (59%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T ++ A+KI+   +K++ + +          +VL 
Sbjct: 181 LGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQPPPRTQEEVLE 240

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 241 RERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 300

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E  A +F R I   + Y H   IVHRDLK EN+++     IK+ DFG++ + + 
Sbjct: 301 QHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNMFNP 360

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 361 KKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 418

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G+ E P    +SIE   L++K+L VDPS R   ++++ H  +++
Sbjct: 419 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQR 464

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  192 bits (489), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 165/288 (57%), Gaps = 19/288 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T ++ A+KI+   +KS  + Q        + +++ 
Sbjct: 95  LGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELME 154

Query: 74  YGIE------------REITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
              +            RE ++ ++L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 155 RKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 214

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E  A +F R I   + Y H   IVHRDLK EN+++     IK+ DFG++ L   
Sbjct: 215 QHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYDN 274

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
            K L T CGS ++AAPE++   PY G E D+WS GV++Y L+ G++PFD+++ ++  L  
Sbjct: 275 KKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV--LHE 332

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           K++ G+ E P    +SIE   L++K+L VDP  R   +++  H  +++
Sbjct: 333 KIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  192 bits (488), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 165/292 (56%), Gaps = 25/292 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T ++ A+KI+   +KS  + Q     G   P    
Sbjct: 51  LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQ--QLQGLPPPATEE 108

Query: 74  YGIE----------------REITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
             +E                RE ++ ++L HP++ RL+++   S   YM+ EYV  G+L 
Sbjct: 109 ELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 168

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           + +I+ G L E  A +F R I   + Y H   IVHRDLK EN+++     I++ DFG++ 
Sbjct: 169 DYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLSN 228

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           +    K L T CGS ++AAPE++   PY G E D+WS GV+LY L+ G++PFD+++ ++ 
Sbjct: 229 MYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV- 287

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
            L  K++ G+ E P    +SI+   L++K+L VDP  R   ++++ H  ++K
Sbjct: 288 -LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  190 bits (482), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 114/332 (34%), Positives = 173/332 (52%), Gaps = 55/332 (16%)

Query: 17  IGPWMLGETLGVGSTGKVLM-------------------------AQNVQTGQIAAVKII 51
            GP+++G T+G G  GKV +                         A  ++  +  A+K+I
Sbjct: 58  FGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKLI 117

Query: 52  SKSIFNAQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYV 111
            +            S DP      I REI  +K L HPN+++L +V + S  + +VLEY 
Sbjct: 118 RRDTI---------SKDPR-REIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVLEYA 167

Query: 112 EKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLA 171
             GE +  +  +  L E  A + F Q+I G++Y H+ G++HRDLK EN+LLD   N+ + 
Sbjct: 168 SGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENLIIT 227

Query: 172 DFGMA-ALESKDKLLETSCGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPF 229
           DFG      + ++L++TSCGSP YAAPE+V S  PY   + D+WSCG+IL+A+L G LP+
Sbjct: 228 DFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGYLPW 287

Query: 230 DED-----DGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           D+D       NI KL   + +   + P  + I+   +DL+ +IL  DP  R+  R ILKH
Sbjct: 288 DDDPENPSGENIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYILKH 345

Query: 285 PLLK-----------KYPSIKDSKSIRNLPRE 305
             LK           ++ +I  S+SI  LP+ 
Sbjct: 346 QWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  192 bits (488), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 166/283 (58%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDVLP 73
           +G W   ET+G GS GKV +A++  T +I A+KII   +K+  + +       N+ + L 
Sbjct: 137 LGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLPPPQNEQEALE 196

Query: 74  Y--GIEREIT----------IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               +E+EI+          + + L HP++ RL+++   S   YM+ EYV  G+L + +I
Sbjct: 197 RQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 256

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ +   
Sbjct: 257 QHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMFDP 316

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
              L T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PFD+++ ++  L  
Sbjct: 317 RTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 374

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+ + P    +SIE   L++K+L VDP  R   +++++H
Sbjct: 375 KIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  187 bits (475), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 156/290 (53%), Gaps = 24/290 (8%)

Query: 13  KGGRIGPWMLGETLGVGSTGKVLMAQNV-----QTGQIAAVKIISKSIFNAQGSTFVGSN 67
           K    GP+++G TLG G  GKV +         +  +  A+K+I +          V   
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKKDADKEVK-- 96

Query: 68  DPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP 127
                   I REI  +K L HPN++ L +V + S  + +VLE+V  GE +  +  +  L 
Sbjct: 97  --------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLK 148

Query: 128 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLE 186
           E+ A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG        ++L+ 
Sbjct: 149 ESSACRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMR 208

Query: 187 TSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLL 240
           TSCGSP YAAPE +VS   Y   ++DVWSCGVILYA+L G LP+D+D  N     I +L 
Sbjct: 209 TSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLY 268

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
             +     + P+   I+   +DL+ +IL  +P  R+  R I +H  LK +
Sbjct: 269 QYITQTPLKFPEY--ITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPH 316

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  188 bits (478), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 160/294 (54%), Gaps = 34/294 (11%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIE-- 77
           W   ET+G GS GKV +A+N  + ++ A+KI+ +       +T    +    LP   +  
Sbjct: 67  WDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHR-------ATKAYMHKAQQLPPPADEN 119

Query: 78  --------------------REITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117
                               RE ++ ++L HPNV +LY++   S   YM  E++  G+L 
Sbjct: 120 EAKERQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLL 179

Query: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177
           + +I+ G L EN A +  R I+  + Y HA  IVHRDLK EN++L     IKL DFG++ 
Sbjct: 180 DYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSN 239

Query: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237
           +    K L+T CGS ++AAPE++   PY G E DVWS GV+LY L+ G++PF  DD N  
Sbjct: 240 MYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPF--DDENSS 297

Query: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHP-LLKKY 290
            L  K++ G+   P    +SI+   L++KIL VDP  R   ++++ H  +LK Y
Sbjct: 298 ALHEKIKKGKVTYP--QFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLKGY 349

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  187 bits (475), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 160/290 (55%), Gaps = 24/290 (8%)

Query: 13  KGGRIGPWMLGETLGVGSTGKVLMAQNVQTG-----QIAAVKIISKSIFNAQGSTFVGSN 67
           K    GP+++G TLG G  GKV +  +  +      +  A+K+I +        T     
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRD-------TIKKDA 91

Query: 68  DPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP 127
           D +V  Y   REI  +K L HPN++ L +V + S  + +VLE+V  GE +  +  +  L 
Sbjct: 92  DKEVKIY---REINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLK 148

Query: 128 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLE 186
           E+ A R F Q+I G++Y H  G+VHRDLK ENLL+D   N+ + DFG        ++L+ 
Sbjct: 149 ESSACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELMR 208

Query: 187 TSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLL 240
           TSCGSP YAAPE +VS   Y   ++DVWSCGVILYA+L G LP+D+D  N     I +L 
Sbjct: 209 TSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLY 268

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
             +     + P+   I+   +DL+ +IL  +P  R+  R I +H  LK +
Sbjct: 269 QYITQTPLKFPEY--ITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  188 bits (478), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 162/288 (56%), Gaps = 25/288 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIA-------AVKIISKSIFNAQGSTFVGSNDP 69
            GP++L  TLG G  GKV +  +  + Q +       A+K+I +S    +GS      + 
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSILPKGS------NK 134

Query: 70  DVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPEN 129
           ++  Y   REI  +K L HPN+++L DV + S  + +VLEY   GE +  +  +  L E 
Sbjct: 135 EIKVY---REINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEI 191

Query: 130 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETS 188
            A + F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG        ++L+ T 
Sbjct: 192 NASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQTNELMLTP 251

Query: 189 CGSPHYAAPEIV-SGLPYHGFESDVWSCGVILYALLTGRLPFDED----DGN-IRKLLLK 242
           CGSP YAAPE+V S  PY   ++D+WSCG+ILYA+L G LP+D+D    DGN I +L   
Sbjct: 252 CGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGNDIARLYYY 311

Query: 243 VQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
           + +   + P  + I    +DL+ KIL  +   RI  R I+ H  LK +
Sbjct: 312 ITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  184 bits (467), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 158/289 (54%), Gaps = 30/289 (10%)

Query: 17  IGPWMLGETLGVGSTGKVLMA--QNVQTGQIA---------AVKIISKSIFNAQGSTFVG 65
            GP+++G TLG G  GKV M   + V  G +          A+K+I +        T V 
Sbjct: 47  FGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRD-------TIVR 99

Query: 66  SNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGP 125
           ++D +   Y   REI  +K L HPN++ L ++ + S  + +VLEY   GE +  +  +  
Sbjct: 100 NSDKETKIY---REINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQRKRR 156

Query: 126 LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKL 184
           L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ + DFG      +++ L
Sbjct: 157 LKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSNENVL 216

Query: 185 LETSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRK 238
           ++TSCGSP YAAPE +VS   Y G + D+WSCGVILYA+L G LP+D+D  N     I K
Sbjct: 217 MKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISK 276

Query: 239 LLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           L   + +   + P  D ++   +DL+ +IL  DP  R     I  H  L
Sbjct: 277 LYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  187 bits (474), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 159/290 (54%), Gaps = 34/290 (11%)

Query: 17  IGPWMLGETLGVGSTGKVLM----AQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVL 72
            GP+++G TLG G  GKV +    A+     +  A+K+I +                D +
Sbjct: 42  FGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR----------------DTV 85

Query: 73  PYGIEREITI------MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
           P   E+EI I      +KLL+HPN++RL +V + S  + +VL+Y   GE +  + ++  L
Sbjct: 86  PKNSEKEIKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRL 145

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
            E  A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ + DFG      K+ L+ 
Sbjct: 146 KEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMR 205

Query: 187 TSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLL 240
           TSCGSP YAAPE +VS  PY   ++DVWSCGVILYA+L G LP+D+D  N     I KL 
Sbjct: 206 TSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLY 265

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
             +     + P+   I    +DL+ +IL  +P  R+   +I +H  L+ +
Sbjct: 266 QYITHTSLKFPEY--IKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/290 (36%), Positives = 159/290 (54%), Gaps = 24/290 (8%)

Query: 13  KGGRIGPWMLGETLGVGSTGKVLM-----AQNVQTGQIAAVKIISKSIFNAQGSTFVGSN 67
           K    GP+++G TLG G  GKV +     + + +  +  A+K+I +          +   
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIK-- 96

Query: 68  DPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP 127
                   I REI  +K L HPN++ L +V + S  + +VLE+V  GE +  +  +  L 
Sbjct: 97  --------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLK 148

Query: 128 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLE 186
           E+ A R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ + DFG        ++L++
Sbjct: 149 ESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMK 208

Query: 187 TSCGSPHYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGN-----IRKLL 240
           TSCGSP YAAPE +VS   Y   ++DVWSCGVILYA+L G LP+D+D  N     I +L 
Sbjct: 209 TSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLY 268

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
             +     + P+   I+   +DL+ +IL  +P  RI  + I +H  LK +
Sbjct: 269 KYITQTPLKFPEY--ITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  186 bits (472), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 159/283 (56%), Gaps = 21/283 (7%)

Query: 10  TSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDP 69
           TS     +G + + + +G GS GKV +AQ+  T      K++ KS            NDP
Sbjct: 28  TSCGLKEVGNYKILDQIGEGSFGKVYLAQHRPT----HTKVVLKS---------SDKNDP 74

Query: 70  DVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPEN 129
           +++     RE+   +  ++P + +LY+V  T T ++M LEY    EL++ ++    +P +
Sbjct: 75  NIV-----REVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTD 129

Query: 130 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSC 189
           E V+ F QI+ G+ Y H+L  VHRDLK EN+LLD   + KL DFG          LET C
Sbjct: 130 ECVQLFAQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETIC 189

Query: 190 GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFE 249
           G+  Y APE++    Y GF+ D+WS GVILY ++ G +PFDEDD    +  +  Q+ +  
Sbjct: 190 GTTVYMAPELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL- 248

Query: 250 MPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPS 292
             +++ ++ +A+DLI ++L  +P+ R    +ILKHP L+ + S
Sbjct: 249 --NENIVTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  185 bits (470), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 158/283 (55%), Gaps = 19/283 (6%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII---SKSIFNAQGSTFVGSNDPDV-- 71
           +G W    T+G GS GKV +A++     + AVKI+   +K+    Q S     +  D+  
Sbjct: 115 LGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQSAPAPQSKADIKE 174

Query: 72  ----LPYGIER------EITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLI 121
               L   I R      E ++ ++L+H N+ +LY +   S   YM+ EYV  G+L + +I
Sbjct: 175 RERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLDYII 234

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
           + G L E  A  F R I  G++Y HA  +VHRDLK EN++L     IK+ DFG++ L   
Sbjct: 235 QHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNLFDP 294

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLL 241
              L T CGS ++AAPE++   PY G E D+WS GVILY L+ G++PFD+++ N   L  
Sbjct: 295 RAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSN--ALHE 352

Query: 242 KVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKH 284
           K++ G+   P    +SIE   L+ K+LTV+P  R   +EI+ H
Sbjct: 353 KIKRGKVSYPAT--LSIECISLLTKMLTVNPKRRATLKEIVTH 393

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/299 (35%), Positives = 158/299 (52%), Gaps = 21/299 (7%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           S  TS +   +G + + + +G GS GKV +A +  T +   +K   KS            
Sbjct: 24  SQFTSDELSEVGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKS------------ 71

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
            DP+++     RE+   +  + P + +LY+V  T T ++M LEY    EL+  L+    +
Sbjct: 72  -DPNLV-----REVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRI 125

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
           P +E  + F QI+  + Y H+L  VHRDLK EN+LLD   N KL DFG          LE
Sbjct: 126 PLDECAKLFAQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLE 185

Query: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246
           T CG+  Y APE++    Y GF+ D+WS GVILY ++ G +PFDEDD    K  +     
Sbjct: 186 TICGTTVYMAPELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VN 242

Query: 247 EFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPRE 305
           +F   + + +S EA+DLI ++L   PS R    +IL HP L+ Y  I  S++ + + R+
Sbjct: 243 DFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  181 bits (460), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 109/313 (34%), Positives = 170/313 (54%), Gaps = 28/313 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T     +K  +KS             DP+++    
Sbjct: 35  VGNYKILDQIGEGSFGKVYLASHRLTHCKVVLKTSNKS-------------DPNIV---- 77

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  ++P + +LY+V  T + ++M  EY    +L++ ++    +P +  +  F 
Sbjct: 78  -REVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACIELFT 136

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  + Y H+L  VHRDLK EN+LLD   N KL DFG          LET CG+  Y A
Sbjct: 137 QIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTTVYMA 196

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE- 255
           PE++    Y GF+ D+WS GVILY +L G +PFDEDD    K   K+ +   EMP  ++ 
Sbjct: 197 PELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDET--KTEWKIMN---EMPVFNDT 251

Query: 256 -ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLDH 314
            +S +A+DL+ K+L+ DP+ R   +EIL HP L+ Y S+   K+ R L ++    N   H
Sbjct: 252 ILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRKQ---RNGTIH 308

Query: 315 NDGTVDRTILKNL 327
               ++R +LKNL
Sbjct: 309 FHSKLERKLLKNL 321

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  181 bits (460), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 99/276 (35%), Positives = 153/276 (55%), Gaps = 21/276 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           IG + + + +G GS GKV +A +  T Q   +K  +K             NDP+V+    
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNK-------------NDPNVV---- 76

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  + P++ +LY+V  T + ++M LEY    EL+  L+ +  +   E+ + F 
Sbjct: 77  -REVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKLFA 135

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  + Y H+L  VHRDLK EN+LLD K   K+ DFG     +   +LET CG+  Y A
Sbjct: 136 QIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVYMA 195

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PE++    Y GF+ D+WS GVILY ++ G +PFDE+D    K  +     E    + D +
Sbjct: 196 PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKI---INEEPFYNDDVV 252

Query: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPS 292
           S +A+DLI+++L  DPS R +  ++L HP L+ Y S
Sbjct: 253 SKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  180 bits (457), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 158/286 (55%), Gaps = 25/286 (8%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           S + S +   +G + + + +G GS GKV +A +  T +   +K   K+            
Sbjct: 26  SQLNSNELNEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLKSSDKT------------ 73

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
            DP+V+     REI   +  + P + +LY+V  T T ++MV+EY    EL++ L+ +  +
Sbjct: 74  -DPNVV-----REIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRI 127

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
             +E+ R F QI+  + Y H+L  VHRDLK EN+LLD   N KL DFG     SK+  LE
Sbjct: 128 SLDESARIFAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLE 187

Query: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246
           T CG+  Y APE++    Y G++ D+W+ G++LY ++ G +PFDEDD   +K  LK+ S 
Sbjct: 188 TICGTTVYMAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDP--KKTELKIISA 245

Query: 247 EFEMPDKDE--ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
               PD D    + ++ DL+ ++L+ DPS R    +IL HP L  Y
Sbjct: 246 S---PDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  178 bits (452), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 111/315 (35%), Positives = 166/315 (52%), Gaps = 32/315 (10%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T +   +K   K             NDP+V+    
Sbjct: 34  VGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDK-------------NDPNVV---- 76

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  ++  + RLY+V  T T ++M LEY    EL+  L+    +  +E  R F 
Sbjct: 77  -REVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRLFA 135

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  I Y H+L  VHRDLK EN+LLD K N KL DFG          L+T CG+  Y A
Sbjct: 136 QIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTVYMA 195

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPD--KD 254
           PE+     Y GF+ D+W+ GVILY ++ G +PFDEDD    K   K+ +   EMP+  +D
Sbjct: 196 PELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDE--AKTKWKIVN---EMPEINED 250

Query: 255 EISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY--PSIKDSKSIRNLPREDTYLNPL 312
            +S +A+DLI ++L  DP+ R    +IL HP L+ Y  P ++ ++ I    R  +     
Sbjct: 251 LVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIPLMEKTQKILRKQRRGSV---- 306

Query: 313 DHNDGTVDRTILKNL 327
            H    ++R +LK L
Sbjct: 307 -HFHSKLERKLLKRL 320

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  178 bits (451), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 151/279 (54%), Gaps = 25/279 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + +   +G GS GKV +A ++ T +   +K  +KS             DP+V+    
Sbjct: 34  VGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKS-------------DPNVV---- 76

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +    P + +LY++  T T ++M LEY    EL+  L+    +P +E  R F 
Sbjct: 77  -REVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRLFA 135

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI   + Y H+L  VHRDLK EN+LLD   N KL DFG     +   +LET CG+  Y A
Sbjct: 136 QISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVYMA 195

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE- 255
           PE++    Y GF+ DVWS GVILY LL G +PFDE+    +    K+ +   EMP  D  
Sbjct: 196 PELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFDST 250

Query: 256 -ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
            +  +A DL++K+L  DP  R   +E+L+HP L+ Y ++
Sbjct: 251 LLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  177 bits (450), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 157/284 (55%), Gaps = 22/284 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMA---QNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLP 73
            GP+++G TLG G  GKV +     N    +  A+K+I +        T   +++ +V  
Sbjct: 53  FGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRD-------TIPKNSEKEV-- 103

Query: 74  YGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVR 133
             I REI  +K L HPN++ L +V + S  + +VL Y   GE +  + ++  L E  A R
Sbjct: 104 -KIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACR 162

Query: 134 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMA-ALESKDKLLETSCGSP 192
            F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ + DFG      S++ L++TSCGSP
Sbjct: 163 LFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSP 222

Query: 193 HYAAPE-IVSGLPYHGFESDVWSCGVILYALLTGRL-----PFDEDDGNIRKLLLKVQSG 246
            YAAPE +V+   Y   ++DVWSCGVILYA+L G L     P + D  +I KL   +   
Sbjct: 223 CYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKT 282

Query: 247 EFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
             + P+   I+   +D++ +IL  DPS RI    ILKH  L+ +
Sbjct: 283 SLKFPEY--INPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  177 bits (448), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 149/274 (54%), Gaps = 21/274 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T Q   +K+ SK             NDP+V+    
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK-------------NDPNVV---- 76

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  ++ ++ +LY+V  T   ++M LEY    EL+  L+ +  +P  E    F 
Sbjct: 77  -REVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELFS 135

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  + Y H++  VHRDLK EN+LLD K + KL DFG     +   +LET CG+  Y A
Sbjct: 136 QIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVYMA 195

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PE++   PY G++ D WS G+ILY ++ G +PFDE D    K  +   +  +   D D I
Sbjct: 196 PELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTY---DNDYI 252

Query: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
               ++LI+++L  DP+ R    ++L+HP L+ Y
Sbjct: 253 DSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 152/275 (55%), Gaps = 23/275 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + E +G GS GKV +A +  T +   +K   K             NDP+++    
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIKSSVK-------------NDPNIV---- 85

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +   +  + +LY++  T + ++M LEY    EL++ +++   +P  E ++ F 
Sbjct: 86  -REVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQLFS 144

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL-LETSCGSPHYA 195
           QI+  + Y H+L  VHRDLK EN+LLD   N KL DFG    E  +K+ LET CG+  Y 
Sbjct: 145 QIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTR-ECMEKVNLETICGTTVYM 203

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE 255
           APE+    PY GF+ D+WS GVILY +L+G +PFDEDD    K  +  +  E+   +   
Sbjct: 204 APELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NSKF 260

Query: 256 ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290
           ++ E +DL+ K+L  D + R   REIL+H  L+ Y
Sbjct: 261 MTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPY 295

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  176 bits (446), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 112/347 (32%), Positives = 179/347 (51%), Gaps = 27/347 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T Q   +K+ SK             NDP+V+    
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSK-------------NDPNVV---- 76

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  ++  + +LY+V  T   ++M LEY    EL+  L+ +  +P +E    F 
Sbjct: 77  -REVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSHLFS 135

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  + Y H++  VHRDLK EN+LLD K   KL DFG     +   +LET CG+  Y A
Sbjct: 136 QIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTVYMA 195

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PE++   PY G++ D WS G+ILY ++ G +PFDE+D +I+     V +  F   D + I
Sbjct: 196 PELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DDNFI 252

Query: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLDHND 316
               +DLI ++L  DPS R    ++L+HP +  + S    K+ + + R+        H  
Sbjct: 253 DANGKDLIMQLLQKDPSQRPSLTQVLQHPFMFPHGSSILEKTDKTIKRQS---QGCKHFH 309

Query: 317 GTVDRTILKNLVVLWHGRDENEIVMKLNEQGPN-LEKTFYALLHRFK 362
             ++R +LK L     G D   I   +N++  + L  T+  LL + K
Sbjct: 310 SKLERRLLKKLK--QSGFDTQAIKQSVNKKKCDALAGTWQLLLEKEK 354

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  176 bits (445), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 150/276 (54%), Gaps = 25/276 (9%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T +   +K  SK+             DP+V+    
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSKT-------------DPNVV---- 76

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  +HP + +LY++  T T ++M LEY    EL++ L+    +P +E  R F 
Sbjct: 77  -REVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRLFA 135

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  + Y H+L  VHRDLK EN+LLD + N KLADFG     +    LET CG+  Y A
Sbjct: 136 QIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVYMA 195

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PE++    Y GF+ D+WS GVILY L+ G +PFDE+D    +   K+ + E   PD +E 
Sbjct: 196 PELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEEDET--RTEWKIINEE---PDYNEK 250

Query: 257 SIEAQ--DLIAKILTVDPSGRIKTREILKHPLLKKY 290
              A   +LI  +L  DP  R    EILKH  L+ Y
Sbjct: 251 IFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  175 bits (443), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/400 (31%), Positives = 201/400 (50%), Gaps = 36/400 (9%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           S  +S +   IG + + + +G GS GKV +A +  T Q   +K  +K             
Sbjct: 24  SQFSSDELSEIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNK------------- 70

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
            DP+V+     RE+   +  + P + +LY+V  T + ++MVLEY    EL+  L++   L
Sbjct: 71  RDPNVV-----REVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRL 125

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
              E+ + F QI   + Y H L  VHRDLK EN+LLD   + KL DFG     +    LE
Sbjct: 126 SLEESKKLFSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLE 185

Query: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246
           T CG+  Y APE++    Y GF+ D+WS G+ILY ++ G +PFDEDD    K  LK+ + 
Sbjct: 186 TICGTTVYMAPELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDDD--IKTKLKIVND 243

Query: 247 EFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPRED 306
           E +  +++ IS +A DLI  +L  +P+ RI   ++L HP L+ +  +   K+ + L ++ 
Sbjct: 244 ELDF-NQEWISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDKVLLKQ- 301

Query: 307 TYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPN-LEKTFYALLHRFKYEN 365
                  H     ++ +LK L     G D   I   +N++  + L   ++ LL R++  +
Sbjct: 302 --RGGHVHFHSKHEKRLLKRLKQC--GFDTGSIKNSVNKRKCDSLSGLWFLLLERYELSD 357

Query: 366 EXXXXXXXXIAKRISSASSSPQRNIVKSSSRRSINQILVT 405
                    + KR  S  S   R + +SS    ++ ILVT
Sbjct: 358 -------AKVPKRSKSVMSV--RKVFESSVNMVMDDILVT 388

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  166 bits (420), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 146/275 (53%), Gaps = 24/275 (8%)

Query: 22  LGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIER--- 78
           +G  LG G  GKV   ++ ++G I A+K++ K+               D+L Y +ER   
Sbjct: 115 IGLKLGKGKFGKVFCVRHKESGFICALKVMQKT---------------DILQYKLERQFI 159

Query: 79  -EITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQ 137
            E+ I   LNHPN+ +LY  +     +Y+++EY+  GEL+  L   GP     A  +  Q
Sbjct: 160 REVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHGPFENAVATNYVYQ 219

Query: 138 IIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAP 197
           I   I Y H   I+HRD+KPEN+L+     +KL DFG + +  K     T CG+  Y +P
Sbjct: 220 IASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLRRRTFCGTIDYLSP 279

Query: 198 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEIS 257
           EIV    Y     D+W+ G++ Y LL G  PF+E+  ++     +++ G+   P   +++
Sbjct: 280 EIVDYKEY-DHNVDIWALGIVAYELLVGSPPFEENTKDLT--YERIRRGDIVFP--KQVT 334

Query: 258 IEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPS 292
            EA+D I +IL ++P  R+  +EI+ HP + KY S
Sbjct: 335 PEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  174 bits (442), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 151/277 (54%), Gaps = 21/277 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T Q   +K  +KS             DP+V+    
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS-------------DPNVV---- 76

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +   +P + +LY+V  T T ++M LEY    EL++ L+ +  +P +E  R F 
Sbjct: 77  -REVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFA 135

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  + Y H+L  VHRDLK EN+LLD      L DFG     +    LET CG+  Y A
Sbjct: 136 QIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVYMA 195

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PE++    Y G++ D WS G+ILY +L G +PFDEDD    +  LK+   E  + D +  
Sbjct: 196 PELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD--TVRTGLKIMHEEPAVLD-EYT 252

Query: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
           S +A+DLI ++L  + + R    E+L+HP L+ Y ++
Sbjct: 253 SPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  166 bits (419), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 103/274 (37%), Positives = 154/274 (56%), Gaps = 17/274 (6%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+ + TG+  AVKI+ K           G+N    + Y    E
Sbjct: 52  YIFGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALK-------GNNVQLQMLYD---E 101

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ L+HPN++   D +E+    Y+V +    GELF+ +I++G   E +AV    Q+I
Sbjct: 102 LAILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQLI 161

Query: 140 IGISYCHALGIVHRDLKPENLL-LDHKFNIKL--ADFGMAA-LESKDKLLETSCGSPHYA 195
             +SY H+  IVHRDLKPEN+L LD+  N +L  ADFG+A  L+S D L+    GS  Y 
Sbjct: 162 SAVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGYV 221

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL+G   F  +  +G + +        +F  P  
Sbjct: 222 APEVLTR-EGHGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYW 280

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           D IS EA+D I + LT+DP+ R    E+L+ P +
Sbjct: 281 DNISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  171 bits (432), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 155/288 (53%), Gaps = 33/288 (11%)

Query: 21  MLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREI 80
           ++ E +G G+   V  A    TG+  AVKIISK          +G+ D      G+ RE+
Sbjct: 199 IIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-------KVIGNMD------GVTREL 245

Query: 81  TIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIII 140
            +++ LNHP ++RL   +E +   YMV+E+V  G+L + +   G + E+      RQI+ 
Sbjct: 246 EVLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILT 305

Query: 141 GISYCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPE 198
            + Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE
Sbjct: 306 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 365

Query: 199 IVSGLPYHG----FES--------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQS 245
           ++ G         +E         D+WS G ++Y +LTG LPF    G+ +  L K +  
Sbjct: 366 VIRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGR 422

Query: 246 GEF-EMPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYP 291
           G + E P KD  IS EA+D I  +L VDPS R+   + L HP +K  P
Sbjct: 423 GSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  170 bits (431), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 151/279 (54%), Gaps = 25/279 (8%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T Q   +K   K              DP+V+    
Sbjct: 34  VGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKTGEK-------------KDPNVV---- 76

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+++  +P +E  + F 
Sbjct: 77  -REVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKLFA 135

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  + Y H+L  VHRDLK EN+LLD +    L DFG     +    LET CG+  Y A
Sbjct: 136 QIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVYMA 195

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPD--KD 254
           PE++    Y G++ D WS G+ILY +L G +PFDE+D  +    LK+ +   EMP     
Sbjct: 196 PELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPIVDA 250

Query: 255 EISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
             ++ A+DLI K+L   PS R    ++L+HP L+ Y +I
Sbjct: 251 YTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  161 bits (408), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/271 (33%), Positives = 146/271 (53%), Gaps = 22/271 (8%)

Query: 22  LGETLGVGSTGKVLMAQNVQTGQIAAVKIISKS---IFNAQGSTFVGSNDPDVLPYGIER 78
           +G  LG G  GKV   ++  +G I A+K+++K     FN Q                 +R
Sbjct: 120 IGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQ--------------FKR 165

Query: 79  EITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQI 138
           EI I   LNH N+ +LY  +  S ++Y+V+EY+  GEL+ LL + GP+ +  A  +  Q+
Sbjct: 166 EIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDITASNYVYQM 225

Query: 139 IIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPE 198
              ++Y H   I+HRDLKPEN+L+     IKL DFG +     ++  +T CG+  Y +PE
Sbjct: 226 TDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCGTIDYLSPE 285

Query: 199 IVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISI 258
           ++S   Y     DVW+ G++ Y L+ G  PF+ED     +   ++   + + P    +S 
Sbjct: 286 LISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAKSDLKFP--PNVSS 340

Query: 259 EAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           EA+DLI  +L V PS R   ++++ HP ++K
Sbjct: 341 EARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  162 bits (411), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 151/276 (54%), Gaps = 21/276 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G TLG GS G V  A+ + TG+  AVKI+ K     +          DV    +  E
Sbjct: 46  YIFGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGK----------DVQLQMLYDE 95

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN+++  D +E+    Y+V +    GELF+ ++++G   E +AVR   QI+
Sbjct: 96  LSILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQIL 155

Query: 140 IGISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPENLL L  K +  + L DFG+A  L ++D+L+  + GS  Y 
Sbjct: 156 KAVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYV 215

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGE----FEMP 251
           APE+++    HG   D+WS GV+ Y LL G  PF  +  ++   L +  SG     F  P
Sbjct: 216 APEVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHKP 272

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
               IS +A+D I + LTV P  R    E+L H  +
Sbjct: 273 YWSSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  162 bits (410), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 148/270 (54%), Gaps = 17/270 (6%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG GS G V  A+ V +G+  A+KI+ K     +          DV    +  E
Sbjct: 46  YIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGK----------DVELQMLYDE 95

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN+++  D +E+    Y+V +    GELF+ ++++G   E +AVR   QI+
Sbjct: 96  LSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQIL 155

Query: 140 IGISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPENLL         + L DFG+A  L++ D+L+  + GS  Y 
Sbjct: 156 KAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYV 215

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+V+    HG   D+WS GV+ Y LL G  PF  +  +G + +  +      F  P  
Sbjct: 216 APEVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYW 274

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILK 283
             IS EA+D I + LTV+P  R    E+L+
Sbjct: 275 SNISNEAKDFILRALTVNPHDRPTATELLQ 304

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  162 bits (410), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 150/276 (54%), Gaps = 21/276 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+N +TG+  AVKI+ K              D          E
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYD----------E 86

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ L+HPN++   D +E+    Y++ +  + GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEIL 146

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+S ++LL    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYV 206

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGE----FEMP 251
           APE+++    HG   D+WS GVI Y LL G   F  +   ++  L +  +GE    F  P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFHRP 263

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
             D +S +A+  I K L +DPS R    E+L+ P +
Sbjct: 264 YWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  169 bits (428), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 152/290 (52%), Gaps = 27/290 (9%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           S  TS +   +G + + + +G GS GKV +A +  T +   +K   K             
Sbjct: 28  SQFTSDELTEVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK------------- 74

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
           NDP+++     RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+    +
Sbjct: 75  NDPNIV-----REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRI 129

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
              E    F QI   + Y H++  VHRDLK EN+LLD   N KL DFG          LE
Sbjct: 130 SLLECGELFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLE 189

Query: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246
           T CG+  Y APE++    Y GF+ D WS GVILY L+TG LPFD+DD    K  +  +  
Sbjct: 190 TVCGTTVYMAPELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEP 249

Query: 247 EFE---MPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
           +++   +PD      +A+DLI+++L  +P  R    ++L+HP L+ Y S+
Sbjct: 250 KYDPKLIPD------DAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  169 bits (427), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 151/287 (52%), Gaps = 21/287 (7%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           S  TS +   +G + + + +G GS GKV +A +  T +   +K   K             
Sbjct: 28  SQFTSDELTEVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK------------- 74

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
           NDP+++     RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+    +
Sbjct: 75  NDPNIV-----REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRI 129

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
              E    F QI   + Y H++  VHRDLK EN+LLD   N KL DFG          LE
Sbjct: 130 SLLECGELFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLE 189

Query: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246
           T CG+  Y APE++    Y GF+ D+WS GVILY L+TG LPFD+DD    K  +  +  
Sbjct: 190 TVCGTTVYMAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEP 249

Query: 247 EFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
           ++   D   I  +A+DLI+++L  +P  R    ++L+HP L+ Y S+
Sbjct: 250 KY---DAKVIPDDARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSV 293

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  160 bits (405), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 89/261 (34%), Positives = 145/261 (55%), Gaps = 26/261 (9%)

Query: 34  VLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIER----EITIMKLLNHP 89
           V   ++++TG I A+KI+ KS               ++L Y + +    EI I   LNH 
Sbjct: 140 VYCCRHIKTGFICAIKIMDKS---------------EILTYNVTKQFRNEIEIQSNLNHE 184

Query: 90  NVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALG 149
           N+ +LY  +  S  +Y+++EY+  GEL+++L + GP  +  A  F  Q+   I Y H   
Sbjct: 185 NLTKLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLHKKR 244

Query: 150 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 209
           I+HRDLKPEN+L+D    IK+ DFG +         +T CG+  Y +PE+++   Y G  
Sbjct: 245 IIHRDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYDGL- 303

Query: 210 SDVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEFEMPDKDEISIEAQDLIAKIL 268
            DVW+ G+I Y L+ G  PF+ED    ++L  K +++ +   P    +S +A++LI+ +L
Sbjct: 304 IDVWALGIIAYELIVGTPPFEEDT---KELTYKRIKNCDLNFP--AHVSQDAKNLISSLL 358

Query: 269 TVDPSGRIKTREILKHPLLKK 289
            ++PS RI   ++LKHP + K
Sbjct: 359 KLNPSERITLTDVLKHPWINK 379

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  168 bits (425), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 155/288 (53%), Gaps = 33/288 (11%)

Query: 21  MLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREI 80
           ++ E +G G+   V  A    TG+  AVKIISK          +G+ D      G+ RE+
Sbjct: 199 IIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-------KVIGNMD------GVTREL 245

Query: 81  TIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIII 140
            +++ LNHP ++RL   +E +   YMV+E+V  G+L + +   G + E+      RQI+ 
Sbjct: 246 EVLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILA 305

Query: 141 GISYCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPE 198
            + Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE
Sbjct: 306 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 365

Query: 199 IVSGL-----PYHGFES-------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQS 245
           ++ G      P    E        D+WS G ++Y +LTG LPF    G+ +  L K +  
Sbjct: 366 VIRGKDSSVSPDECEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGR 422

Query: 246 GEF-EMPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYP 291
           G + E P KD  IS EA+D I  +L VDP+ R+   + L HP +K  P
Sbjct: 423 GSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIKMNP 470

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  168 bits (425), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 155/288 (53%), Gaps = 33/288 (11%)

Query: 21  MLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREI 80
           ++ E +G G+   V  A    TG+  AVKIISK          +G+ D      G+ RE+
Sbjct: 199 IIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-------KVIGNMD------GVTREL 245

Query: 81  TIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIII 140
            +++ LNHP ++RL   +E +   YMV+E+V  G+L + +   G + E+      RQI+ 
Sbjct: 246 EVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILT 305

Query: 141 GISYCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPE 198
            I Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE
Sbjct: 306 AIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 365

Query: 199 IVSG----LPYHGFES--------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQS 245
           ++ G    +    +E         D+WS G ++Y +LTG LPF    G+ +  L K +  
Sbjct: 366 VIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGR 422

Query: 246 GEF-EMPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYP 291
           G + E P KD  IS EA+D I  +L VDP+ R    + L HP +K  P
Sbjct: 423 GSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSP 470

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  168 bits (426), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 157/301 (52%), Gaps = 25/301 (8%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           S  TS +   +G + + + +G GS GKV +A +  T +   +K   K             
Sbjct: 28  SQFTSDELTEVGNYKILKQVGEGSFGKVYLALHRPTHRKVCLKTSDK------------- 74

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
           NDP+++     RE+   +  + P + +LY+V  T T ++M LEY    EL++ L+    +
Sbjct: 75  NDPNIV-----REVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRI 129

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
              E    F QI   + Y H++  VHRDLK EN+LLD   N KL DFG          LE
Sbjct: 130 SLLECAELFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLE 189

Query: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246
           T CG+  Y APE++    Y GF+ D+WS GVILY L+TG LPFD+DD    K   K+ + 
Sbjct: 190 TVCGTTVYMAPELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDDE--VKTKWKIVN- 246

Query: 247 EFEMPDKDEISI--EAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPR 304
             E P+ D   I  +A+DLI+++L  +P  R    ++L H  L+ Y S+   ++ + L R
Sbjct: 247 --EEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSR 304

Query: 305 E 305
           +
Sbjct: 305 Q 305

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  166 bits (421), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 158/293 (53%), Gaps = 33/293 (11%)

Query: 21  MLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREI 80
           ++ E +G G+   V  A    TG+  AVKIISK          +G+ D      G+ RE+
Sbjct: 199 IIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR-------KVIGNMD------GVTREL 245

Query: 81  TIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIII 140
            +++ L+HP ++RL   +E +   YMV+E+V  G+L + +   G + E+      RQI+ 
Sbjct: 246 EVLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILE 305

Query: 141 GISYCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPE 198
            + Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE
Sbjct: 306 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 365

Query: 199 IVSG----LPYHGFES--------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQS 245
           ++ G    +    +E         D+WS G ++Y +LTG LPF    G+ +  L K +  
Sbjct: 366 VIRGKDSSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGR 422

Query: 246 GEF-EMPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDS 296
           G + E P KD  IS EA+D I  +L VDP+ R+   + L HP +K  P +  S
Sbjct: 423 GSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  159 bits (403), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 150/274 (54%), Gaps = 17/274 (6%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+ + + +  AVKI+ K+               DV    +  E
Sbjct: 38  YIFGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNALKGN----------DVQLQMLYDE 87

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN++   D +E+    Y+V +    GELF+ +I++G   E +AV    Q++
Sbjct: 88  LSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLL 147

Query: 140 IGISYCHALGIVHRDLKPENLL-LD--HKFNIKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPEN+L LD   +  + +ADFG+A  L+S D L+    GS  Y 
Sbjct: 148 DAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYV 207

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL+G  PF  +  +G + +        +F  P  
Sbjct: 208 APEVLTK-EGHGKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYW 266

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           D IS EA+D I K LT+DP  R    E++  P +
Sbjct: 267 DSISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  167 bits (422), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 147/277 (53%), Gaps = 21/277 (7%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T +   +K   K             NDP+++    
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK-------------NDPNIV---- 80

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+    L   E    F 
Sbjct: 81  -REVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGELFA 139

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI   + Y H++  VHRDLK EN+LLD   N KL DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PE++    Y GF+ D+WS GVILY L+TG LPFD+DD    K  +  +  ++   D   I
Sbjct: 200 PELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKY---DSKFI 256

Query: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
             +A+DLI+++L  +P  R    ++L+HP L+ Y S+
Sbjct: 257 PDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  166 bits (419), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 152/277 (54%), Gaps = 28/277 (10%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A   +TG+  AVKII+K          +G+ D      G+ RE+ ++
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKR-------KVMGNMD------GVTRELEVL 238

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + LNHP ++ L   +E     Y+V+E+V  G+L + +   G + E+      RQ++  + 
Sbjct: 239 RRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVK 298

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y HA+GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVIS 358

Query: 202 GLPYHGFES-------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEF-EMPD 252
           G      E        D+WS G ++Y +LTG LPF    G+ ++ L K + +G + E P 
Sbjct: 359 GKNSEEKEGNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYHEGPL 415

Query: 253 KD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           KD  IS +A+D I   L V+P  R+   + LKHP ++
Sbjct: 416 KDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  160 bits (404), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 150/276 (54%), Gaps = 21/276 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+N +TG+  AVKI+ K              D          E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------E 86

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ L+HPN++   D +E+    Y++ +  + GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+S ++L+    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYV 206

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGE----FEMP 251
           APE+++    HG   D+WS GVI Y LL G   F  +   ++  L +  +GE    F  P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRFHRP 263

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
             D +S +A+  I K L +DPS R    ++L+ P +
Sbjct: 264 YWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  159 bits (403), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 158/289 (54%), Gaps = 27/289 (9%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           SN+ S    +   + +G  LG G  GKV   ++ Q+G I+A+K++ K             
Sbjct: 162 SNINSKNKLQFSDFEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKK------------ 209

Query: 67  NDPDVLPYGIE----REITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF-NLLI 121
              +++ Y  E    RE+ +   LNHPN+++++  ++    +Y+++EY+  GEL+ +L  
Sbjct: 210 ---EIVSYNAEKQFKREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKN 266

Query: 122 ERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK 181
             GP  +  A  +  QI   + Y H+  I+HRD+KPEN++L     IKLADFG +     
Sbjct: 267 NNGPFNDILASNYIYQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPP 326

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNI-RKLL 240
           +   +T CG+  Y APE+V+   Y  +  D+W+ G++ Y L+ G  PF+E+  ++  K +
Sbjct: 327 NLRRKTICGTIDYLAPELVTFKEY-DYNVDIWALGILTYELIVGNPPFEEETKDLTYKRI 385

Query: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           + V   +   P    +S++A+DLI ++L  DPS R+   +++KHP + K
Sbjct: 386 INV---DLNFP--QTVSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  159 bits (403), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 160/300 (53%), Gaps = 25/300 (8%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG GS G V  A+ + TG+  AVKI+ K     QG+        +V    +  E
Sbjct: 38  YIFGKTLGAGSFGVVRQARRISTGEDVAVKILLKKAL--QGN--------EVHLQMLYDE 87

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HP+++   D +E+    Y+V +    GELF+ ++ RG   EN+AV+   Q++
Sbjct: 88  LSILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLL 147

Query: 140 IGISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMA-ALESKDKLLETSCGSPHYA 195
             + Y H+  +VHRDLKPEN+L        ++ +ADFG+A  L++ D ++  + GS  Y 
Sbjct: 148 DAVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGYV 207

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++ +  HG   D+WS GVI Y LL+G   F  +  +G + +         F  P  
Sbjct: 208 APEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYW 266

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK--------YPSIKDSKSIRNLPRE 305
           D+IS EA+  I   LT++P  R    ++L HP +           PS+++    R   RE
Sbjct: 267 DKISDEAKKFILSALTIEPEERPTAEQLLSHPWITSTMSHDADLLPSVREGFDARKKFRE 326

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 159/289 (55%), Gaps = 20/289 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISK-SIFNAQGSTFVGSNDPDVLPYGIEREIT 81
           G  LG G   +    ++ ++G+I A K ++K SI   +    + S            EI 
Sbjct: 95  GHFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKTEKTKKKLLS------------EIQ 141

Query: 82  IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG 141
           I K + HPN++   D +E  T++Y++LE    G L +L+ +R  L E E VRFF   I G
Sbjct: 142 IHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQICG 200

Query: 142 -ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEI 199
            + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + ++  + T CG+P+Y APE+
Sbjct: 201 AVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEV 260

Query: 200 VSG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISI 258
           + G    H FE D+WS GV++YALL G+ PF   D N+  +  ++++ ++  P    +S 
Sbjct: 261 LMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKYVSS 318

Query: 259 EAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDT 307
           EA+ LIA IL VDP  R   REI+     +     K ++ +  L  +DT
Sbjct: 319 EAKTLIADILCVDPVERPSIREIIDDVWFRGIFPPKITEDVMELTPKDT 367

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  165 bits (418), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 151/280 (53%), Gaps = 31/280 (11%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKII+K          +G+ D      G+ RE+ ++
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKR-------KVMGNLD------GVTRELEVL 237

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           K LNHP ++ L   +E +   YMV+E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 238 KRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEAVK 297

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 298 YIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 357

Query: 202 GLPYHGFES----------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEF-E 249
               +  E           D+WS G ++Y +LTG LPF    G+ ++ L K +  G + E
Sbjct: 358 SSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHE 414

Query: 250 MPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            P KD  IS EA+D I  +L VDPS R+     L+HP +K
Sbjct: 415 GPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  159 bits (402), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 147/271 (54%), Gaps = 21/271 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG GS G V  A+ + TG   AVKI+ K                DV    +  E
Sbjct: 46  YIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGN----------DVQLQMLYDE 95

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ LNHPN+++  D +E+    Y+V +    GELF+ ++++G   E +AV+   QI+
Sbjct: 96  LMILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQIL 155

Query: 140 IGISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPENLL LD   N  + L DFG+A  L++   L+  + GS  Y 
Sbjct: 156 KAVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGYV 215

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGE----FEMP 251
           APE+++    HG   D+WS GVI Y LL G  PF  +  ++   L +  SG+    F  P
Sbjct: 216 APEVLTS-NGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHKP 272

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREIL 282
             + IS EA+  I ++LT+ P  R    ++L
Sbjct: 273 YWNNISKEAKLFILRVLTISPKKRPTATDLL 303

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  159 bits (402), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/274 (35%), Positives = 147/274 (53%), Gaps = 21/274 (7%)

Query: 22  LGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREIT 81
            G+T+G G+ G V  A  + TG+  AVKII K                D+    +  E+ 
Sbjct: 43  FGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEGN----------DIQLQMLYDELA 92

Query: 82  IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG 141
           I++ L HPN++     +E+   +Y+V +    GELF+ +++RG   E +AV    QI+  
Sbjct: 93  ILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVVQILKA 152

Query: 142 ISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMAA-LESKDKLLETSCGSPHYAAP 197
           + Y H+  +VHRDLKPEN+L      K  I +ADFG+A  LE +  L+  + GS  Y AP
Sbjct: 153 VEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSLGYVAP 212

Query: 198 EIV--SGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           E++  SG   HG   D+WS G+I Y LL G  PF  ++ DG + +++   +   F  P  
Sbjct: 213 EVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFHSPYW 269

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           DEIS EA+  I + +T+DP  R    E+LK P +
Sbjct: 270 DEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  165 bits (417), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/276 (34%), Positives = 148/276 (53%), Gaps = 26/276 (9%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A   +TG+  AVKIISK          VG  D      G+ RE+ ++
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKR-------KVVGVMD------GVARELEVL 238

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + L+HP ++ L   +E     Y+V+E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 239 QRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 298

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVIS 358

Query: 202 GLPYHGFES-------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEF-EMPDK 253
           G      E        D+WS G ++Y +LTG LPF     N   L  ++ +G + E P K
Sbjct: 359 GKNSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSGSTQN--DLYKQITAGSYHEGPLK 416

Query: 254 D-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           D  IS +A+D I   L VDP  R+   + L+HP +K
Sbjct: 417 DYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  158 bits (400), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 99/276 (35%), Positives = 150/276 (54%), Gaps = 21/276 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG GS G V  A+ + TG+  AVKI+ K              D          E
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALKGNCVQIEMLYD----------E 87

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN++     +E+    Y+  +    GELF+ ++ RG   E +AVR   Q++
Sbjct: 88  LSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIVQLL 147

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMA-ALESKDKLLETSCGSPHYA 195
            GI Y H+  IVHRDLKPEN+L   K +   + +ADFG+A  L+S D L+  + GS  Y 
Sbjct: 148 QGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSLGYV 207

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG----EFEMP 251
           APE+++ +  HG   D+WS GVI Y LL G  PF  +  ++   L +  SG    +F  P
Sbjct: 208 APEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKFHRP 264

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
             D IS EA++ I + L ++PS R    E+L+ P +
Sbjct: 265 YWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  163 bits (413), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 157/285 (55%), Gaps = 19/285 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++   G+I A K ++K    ++ +              +  EI I
Sbjct: 82  GHFLGEGGFARCFQIKD-DGGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 129

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR-QIIIG 141
            K + H N+++  D +E  T++Y++LE    G L +LL  R  L E E VRFF  QI+  
Sbjct: 130 HKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQIVGA 188

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 189 VKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 248

Query: 201 SGLPY-HGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
           +G    H +E D+WSCGV++YALL G+ PF   + NI  +  +++ G+F  P    IS E
Sbjct: 249 TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKFISPE 306

Query: 260 AQDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLP 303
           A  LI  IL++DP  R    EI+ +   +  +PS  D+  + + P
Sbjct: 307 ALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  160 bits (404), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 156/309 (50%), Gaps = 39/309 (12%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++LG+ LG G    V  A+N  TG+  AVKI     F+ Q       ND          E
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKI-----FHPQ------QNDDQKKNKQFREE 241

Query: 80  ITIMKLLNHPNVLRLYD-----VWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRF 134
            TI+  ++HPN++ L D     + +T    Y+VLE ++ GELF+ ++++  LP+ E+   
Sbjct: 242 TTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKAI 301

Query: 135 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKLADFGM 175
           F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +K+ADFG+
Sbjct: 302 FKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGL 361

Query: 176 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDG- 234
           A    + +   T CG+P Y APE++    Y   + D+WS GVILY  L G  PF +  G 
Sbjct: 362 AKFTGEMQFTNTLCGTPSYVAPEVLVKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLGP 420

Query: 235 -NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
            ++++ ++  +   F  P  DEI   A  LI+ +L +DP  R        HP L     +
Sbjct: 421 PSLKEQIMSAKYA-FYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLDSVSHL 479

Query: 294 KDSKSIRNL 302
             S +++ L
Sbjct: 480 DVSHNLKRL 488

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 155/282 (54%), Gaps = 32/282 (11%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKII+K          +G+ D      G+ RE+T++
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKR-------KVMGNLD------GVTRELTVL 252

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + L+HP+++ L   +E   + YMV+E+V  G+L + +   GP+ E+      RQI+  + 
Sbjct: 253 QKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEAVK 312

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     + T CG+  Y APE+V+
Sbjct: 313 YIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEVVN 372

Query: 202 G--------LP-----YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEF 248
           G        +P     ++    D+WS G ++Y +LTG LPF       ++L  ++    +
Sbjct: 373 GRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGKASY 430

Query: 249 -EMPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            E+P KD  IS +A+D I  +L VDP+ R+     L+HP ++
Sbjct: 431 HEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  164 bits (416), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 153/286 (53%), Gaps = 37/286 (12%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKIISK          +GSN       G+ RE+ ++
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKR-------KVMGSNMD-----GVSRELEVL 253

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + L+HP ++RL   +E   + YM++E+V  G+L + +   G + E+      RQI+  I 
Sbjct: 254 QRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAIK 313

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H++GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APEI+S
Sbjct: 314 YIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEIIS 373

Query: 202 GL----------------PYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQ 244
           G                  Y     D+WS G ++Y +LTG LPF    G+ +K L K + 
Sbjct: 374 GKNDGELRENADANSERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQKQLYKQIS 429

Query: 245 SGEF-EMPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            G + E P KD  IS EA+D I  +L V P+ R+   + L+HP +K
Sbjct: 430 RGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 149/276 (53%), Gaps = 21/276 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+N +TG+  AVKI+ K              D          E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------E 86

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ L+HPN++   D +E+    Y++ +  + GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+S ++L+    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYV 206

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGE----FEMP 251
           APE+++    HG   D+WS GVI Y LL G   F  +   ++  L +  +GE    F  P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRFHRP 263

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
             D +S +A+  I K L +DP+ R    ++L  P +
Sbjct: 264 YWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  157 bits (397), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 154/300 (51%), Gaps = 25/300 (8%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+   T +  AVKI+ K                DV    +  E
Sbjct: 45  YVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGN----------DVQLQMLYDE 94

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I+++L HPN++   D +E+    Y+V +    GELF+ ++ +G   E +AV    QI+
Sbjct: 95  LSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQIL 154

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMA-ALESKDKLLETSCGSPHYA 195
             + Y H+  +VHRDLKPEN+L   K +   + +ADFG+A  L+  D L+  + GS  Y 
Sbjct: 155 SAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYV 214

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDED--DGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI+Y LL G   F  +  DG + +         F  P  
Sbjct: 215 APEVLTN-NGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYW 273

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK--------YPSIKDSKSIRNLPRE 305
           D IS EA++ I + LT+DP+ R    E++K P +          YP I+    +R   R+
Sbjct: 274 DNISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKLRD 333

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 153/293 (52%), Gaps = 32/293 (10%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKII+K          VG+ D      G+ RE+ ++
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKR-------KVVGNMD------GVSRELEVL 238

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + LNHP ++ L   +E   + YMV+E++  G+L + +   G + E       RQI+  I 
Sbjct: 239 QKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQ 298

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++    +++T CG+  Y APE++ 
Sbjct: 299 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVIG 358

Query: 202 GLP-------------YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEF 248
           G                +    D+WS G +++ +LTG LPF        +L  +++ G +
Sbjct: 359 GFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF--SGSTQEQLYEQIRKGSY 416

Query: 249 -EMPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSI 299
            E P KD  IS EA+D I  +L VD S R+   + L HP +K+  S  D+ S+
Sbjct: 417 HEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/265 (35%), Positives = 150/265 (56%), Gaps = 18/265 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G++ A K ++K    ++ +              +  EI I
Sbjct: 76  GMFLGEGGFARCFQMKD-DSGKVFAAKTVAKISIKSEKTR-----------KKLLSEIQI 123

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR-QIIIG 141
            K + HPN+++  D +E  T++Y++LE    G L +LL +R  L E E VRFF  QI+  
Sbjct: 124 HKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQIVGA 182

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           I Y H+  I+HRDLK  N+  D  FN+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 183 IKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVL 242

Query: 201 SGLPY-HGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
           +G    H FE D+WS GV++YALL G+ PF   + N   +  +++  +F  P    IS E
Sbjct: 243 TGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNT--IYERIKVCDFSFPKDKPISSE 300

Query: 260 AQDLIAKILTVDPSGRIKTREILKH 284
           A+ LI  IL++DP  R    EI+++
Sbjct: 301 AKVLIKDILSLDPLERPSLAEIMEY 325

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  157 bits (397), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/281 (35%), Positives = 152/281 (54%), Gaps = 18/281 (6%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++   TLG GS G V  A+ + + +  AVKI+ K      G       +P      I  E
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGL-----EP------IYDE 113

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ L+HPN+++  D +ET +  Y+V +    GELF+ ++  G   E +AV    QI+
Sbjct: 114 LNIIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQIL 173

Query: 140 IGISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMA-ALESKDKLLETSCGSPHYA 195
             + Y H+  I+HRDLKPENLL LD   +  I LADFG+A  LE+ D ++    GS  Y 
Sbjct: 174 KAVEYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYV 233

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDED--DGNIRKLLLKVQSGEFEMPDK 253
           APE+ +    HG  SD+WS GVI Y LL G  PF  +  DG + ++       +F+ P  
Sbjct: 234 APEVFTS-DGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYW 292

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIK 294
           D IS  A++ I +IL +DP+ R    E+L  P ++   S++
Sbjct: 293 DGISELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  162 bits (409), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 157/285 (55%), Gaps = 19/285 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K    ++ +              +  EI I
Sbjct: 82  GHFLGEGGFARCFQIKD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 129

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG- 141
            K + H N+++  D +E  T++Y++LE    G L +LL  R  L E E VRFF   I+G 
Sbjct: 130 HKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQIVGA 188

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           + Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 189 VKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 248

Query: 201 SGLPY-HGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
           +G    H +E D+WSCGV++YALL G+ PF   + NI  +  +++ G++  P    IS E
Sbjct: 249 TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKCISQE 306

Query: 260 AQDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLP 303
           A  LI  IL++DP  R    EI+ +   +  +P   D+  + + P
Sbjct: 307 ALTLIRDILSIDPLERPSLDEIIDYVWFRGIFPPRIDASVLSSAP 351

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 150/265 (56%), Gaps = 18/265 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K    ++ +              +  EI I
Sbjct: 76  GMFLGEGGFARCFQMKD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 123

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR-QIIIG 141
            K + HPN+++  D +E  T++Y++LE    G L +LL +R  L E E VRFF  QI+  
Sbjct: 124 HKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQIVGA 182

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           I Y H+  I+HRDLK  N+  D  FN+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 183 IKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVL 242

Query: 201 SGLPY-HGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
           +G    H FE DVWS GV++YALL G+ PF   + N   +  +++  +F  P    IS E
Sbjct: 243 TGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNT--IYERIKVCDFNFPRDKPISSE 300

Query: 260 AQDLIAKILTVDPSGRIKTREILKH 284
           A+ LI  IL++DP  R    EI+++
Sbjct: 301 AKVLIKDILSLDPLERPSLTEIMEY 325

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  156 bits (395), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 105/339 (30%), Positives = 170/339 (50%), Gaps = 33/339 (9%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+ + +G+  AVKI+ K     Q        D          E
Sbjct: 46  YIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYD----------E 95

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ LNHPN++R  D +E+    Y+V +    GELF+ ++E+G   E +AV   +QI+
Sbjct: 96  LSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQIL 155

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 195
            G+ Y H   IVHRDLKPEN+L  +K +   + + DFG+A  L+  ++L+  + GS  Y 
Sbjct: 156 QGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYV 215

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL G  PF  +  DG I +         F  P  
Sbjct: 216 APEVLTS-SGHGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYW 274

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK--------YPSIKDSKSIRNLPRE 305
           + +S  A++ I   LTV P  R    +++    +           P I+     R   R+
Sbjct: 275 NNVSKTAKEFILWALTVSPKRRPTATDLINDIWITSTEKSTTDLLPEIRKGFDARKEFRD 334

Query: 306 DTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLN 344
              +  L++         +K L VL+  +DE++  +++N
Sbjct: 335 AVEIVKLNNR--------IKKLKVLYENQDESDTDIEVN 365

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  156 bits (395), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 149/274 (54%), Gaps = 17/274 (6%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G TLG GS G V  A+ + T +  A+KI+ K           G+N    + Y    E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-------GNNVQLQMLY---EE 96

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN++   D +E+    Y+V +    GELF+ ++ RG   E +AV    QI+
Sbjct: 97  LSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQIL 156

Query: 140 IGISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMA-ALESKDKLLETSCGSPHYA 195
             + Y H+  +VHRDLKPEN+L +D   N  + +ADFG+A  L+ K+ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL G  PF  +  +G + +         F MP  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPYW 275

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           D IS++A+  I K L +DP+ R    E+L  P +
Sbjct: 276 DSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  154 bits (390), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 139/260 (53%), Gaps = 24/260 (9%)

Query: 34  VLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIE----REITIMKLLNHP 89
           V   ++ +TG I A+K + KS               +++ Y ++    RE+ I   L HP
Sbjct: 137 VYCVKHKRTGFICALKAMKKS---------------EIVQYNVQKQFRREVEIQSSLKHP 181

Query: 90  NVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALG 149
           N+ RLY  +     +Y+++EY+  GEL+  L   GP  +  A  F  Q+   ++Y H+  
Sbjct: 182 NLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKN 241

Query: 150 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 209
           I+HRD+KPEN+LL  +  +KL DFG +     +   +T CG+  Y +PE++    Y   +
Sbjct: 242 ILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDN-K 300

Query: 210 SDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILT 269
            DVW+ GV+ Y LL G  PF+ED   +     ++   +   P  D++S  A+DLI+++L 
Sbjct: 301 VDVWALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLRFP--DQVSPHARDLISRLLE 356

Query: 270 VDPSGRIKTREILKHPLLKK 289
            DP  RI  +++ +HP +KK
Sbjct: 357 YDPQNRIPLKDVKRHPWIKK 376

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  161 bits (408), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 95/280 (33%), Positives = 154/280 (55%), Gaps = 32/280 (11%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  A KIISK          +G+ D      G+ RE+ ++
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKR-------KVMGNMD------GVTRELEVL 243

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + LNHP ++RL   +E     Y+++E+V  G+L + +   G + E+      RQ++ G+ 
Sbjct: 244 RKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEGVK 303

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE+++
Sbjct: 304 YIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIA 363

Query: 202 GLP----------YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEF-E 249
           G            Y     D+WS G ++Y +LTG LPF    G+ ++ L K +++G + E
Sbjct: 364 GKANAEENEKRNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGSYHE 419

Query: 250 MPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            P KD  IS EA+D I  +L V+P+ R   ++ L+HP +K
Sbjct: 420 GPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  155 bits (393), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 156/300 (52%), Gaps = 25/300 (8%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G TLG GS G V  A+ + T +  A+KI+ K           G+N    + Y    E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-------GNNIQLQMLY---EE 96

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN++   D +E+    Y+V +    GELF+ ++ RG   E +AV    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQIL 156

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMA-ALESKDKLLETSCGSPHYA 195
             + Y H+  +VHRDLKPEN+L   K +   + +ADFG+A  L+ K+ L+  + GS  Y 
Sbjct: 157 GAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL G  PF  +  +G + +         F MP  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYW 275

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK--------YPSIKDSKSIRNLPRE 305
           D IS++A+  I K L ++P+ R    E+L  P +           P +K   S+R   R+
Sbjct: 276 DNISVDAKRFILKALILNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLRD 335

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  155 bits (392), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 154/284 (54%), Gaps = 21/284 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+ + T +  AVKI+ K                DV    +  E
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKGN----------DVQLQLLYDE 89

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ L+HPN+++  D +E+    Y+V +    GELF+ ++ +G   E +AV+   QI+
Sbjct: 90  LKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVTQIL 149

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPEN+L     +   + LADFG+A  L+S D+L+  + GS  Y 
Sbjct: 150 SAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSLGYV 209

Query: 196 APEIV--SGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMP 251
           APE++  SG   HG   D+WS GV+ Y LL+G  PF  +  +G + +     +  +F  P
Sbjct: 210 APEVLTTSG---HGKPCDIWSLGVVTYTLLSGYSPFIAESVEGFLEECTEGSKPVKFHKP 266

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKD 295
             D IS +A++ I + L + PS R    E+L+ P +    S K+
Sbjct: 267 YWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 157/291 (53%), Gaps = 19/291 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K    ++ +              +  EI I
Sbjct: 85  GHFLGEGGFARCFQIKD-DSGKIFAAKTVAKLSIKSEKTR-----------KKLLSEIQI 132

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG- 141
            K + H NV++  D +E  T++Y++LE    G L +LL +R  L E E VRFF   I G 
Sbjct: 133 HKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQICGA 191

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 192 IKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 251

Query: 201 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
            G    H +E D+WS GV+LYALL G+ PF   D N   +  +++  +F  P +  IS E
Sbjct: 252 MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNT--IYERIKCCDFSFPKEKHISNE 309

Query: 260 AQDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLPREDTYL 309
           A+ LI  +L++DP  R    EI+ +   +  +P   +S  +  +P  D  L
Sbjct: 310 AKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTL 360

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  159 bits (402), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 156/287 (54%), Gaps = 17/287 (5%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K    ++ +              +  EI I
Sbjct: 80  GHFLGEGGFARCFQMKD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 127

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGI 142
            K + HPN+++  D +E  T++Y++LE    G L +LL +R  L E E   F  QI+  I
Sbjct: 128 HKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQIVGAI 187

Query: 143 SYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIVS 201
            Y H   ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE+++
Sbjct: 188 KYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLA 247

Query: 202 G-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEA 260
           G    H +E D+WS GV++YALL G+ PF   + NI  +  +++SG++  P +   S E 
Sbjct: 248 GKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPTSKEV 305

Query: 261 QDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLPRED 306
             LI  IL++DP  R    EI+ +   +  +P+  +   + ++P  D
Sbjct: 306 MVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYD 352

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  154 bits (390), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 151/276 (54%), Gaps = 21/276 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+N +TG+  AVKI+ K              D          E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGNKIQLEALYD----------E 86

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ L+HPN++   D +E++   Y++ +  + GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+S ++L+  + GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLGYV 206

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGE----FEMP 251
           APE+++    HG   D+WS GVI Y LL G   F  +   +   L +  +G+    F  P
Sbjct: 207 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFHRP 263

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
             D +S +A+  I K L ++P+ R    E+L+ P +
Sbjct: 264 YWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  160 bits (404), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 156/293 (53%), Gaps = 19/293 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G+ LG G   +    ++ ++G+I A K ++K     + +              +  EI I
Sbjct: 145 GQFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKTEKTR-----------RKLLSEIQI 192

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR-QIIIG 141
            K + H N+++  D +E   ++Y++L     G L  LL +R  L E E VRFF  QI   
Sbjct: 193 HKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFTVQICGA 251

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 252 IKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 311

Query: 201 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
            G    H +E D+WS GV+++ALL G+ PF   D N   +  ++++ E+  P    IS E
Sbjct: 312 LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPINKSISQE 369

Query: 260 AQDLIAKILTVDPSGRIKTREILKHPLLK-KYPSIKDSKSIRNLPREDTYLNP 311
           A+ LI  IL  DP  R    EI+++   +  +PS+  +     +P  D +L P
Sbjct: 370 AKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTP 422

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  159 bits (401), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 159/300 (53%), Gaps = 29/300 (9%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K+   ++ +              +  EI I
Sbjct: 85  GHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTR-----------KKLLSEIQI 132

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG- 141
            K + HPN+++  D +E  +++Y++LE    G L  LL  R  L E E VRFF   I G 
Sbjct: 133 HKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQICGA 191

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAPE 198
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ES+ K   T CG+P+Y APE
Sbjct: 192 IKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPE 249

Query: 199 IVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEIS 257
           ++ G    H FE D+WS GV+LYALL G+ PF   D N   +  +++  +F  P    IS
Sbjct: 250 VLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKPIS 307

Query: 258 IEAQDLIAKILTVDPSGRIKTREILKHPLLKKY--PSI-----KDSKSIRNLPREDTYLN 310
            E + LI  IL++DP  R    EI+ +   +    PSI      ++ +  N+P E + +N
Sbjct: 308 DEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASNFDNIPEEQSLIN 367

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score =  153 bits (386), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 139/263 (52%), Gaps = 25/263 (9%)

Query: 34  VLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIE----REITIMKLLNHP 89
           V   ++ QTG I A+K + K                +++ Y +E    RE+ I   L HP
Sbjct: 154 VYCVKHKQTGFICALKAMKKK---------------EIIQYNVEKQFRREVEIQSSLKHP 198

Query: 90  NVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALG 149
           N+ RLY  +     +Y+++EY+  GEL+  L   GP  +  A  F  Q+   + Y H+  
Sbjct: 199 NLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDIVASHFVYQMADALDYMHSKH 258

Query: 150 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 209
           I+HRD+KPEN+LL  +  +KL DFG +     +    T CG+  Y +PE++    Y   +
Sbjct: 259 IIHRDIKPENILLGFQNTLKLTDFGWSVTNLNNSRRRTLCGTMDYLSPELIKSREYDN-K 317

Query: 210 SDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILT 269
            DVW+ GV+ Y LL G  PF ED   +     +++  + + P  D IS +A+D+I+K+L 
Sbjct: 318 VDVWALGVLTYELLVGTPPFLEDSKEM--TYKRIKRRDLKFP--DHISSQARDIISKLLE 373

Query: 270 VDPSGRIKTREILKHP-LLKKYP 291
            +P+ RI  R++ KHP +LK  P
Sbjct: 374 YEPNARIALRDVKKHPWILKNRP 396

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  151 bits (381), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 144/259 (55%), Gaps = 26/259 (10%)

Query: 34  VLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIE----REITIMKLLNHP 89
           V   ++ +TG I A+K++ K+               +++ Y ++    RE+ I   LNHP
Sbjct: 105 VYCVRHKETGFICALKVMDKA---------------EIVQYNLQKQFRREVEIQTSLNHP 149

Query: 90  NVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALG 149
           N+ +LY  +     +Y+++EY+  GEL+ LL   GP  +  A RF  QI   ++Y H   
Sbjct: 150 NLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQ 209

Query: 150 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 209
           I+HRDLKPEN+L+     IKL DFG + +  +    +T CG+  Y +PE++    Y   +
Sbjct: 210 IIHRDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-K 268

Query: 210 SDVWSCGVILYALLTGRLPFDEDDGNI-RKLLLKVQSGEFEMPDKDEISIEAQDLIAKIL 268
            DVW+ GV+ Y L+ G  PF+ED   +  K +LK    + + P  + +S + +DLI+K+L
Sbjct: 269 VDVWALGVLTYELIVGSPPFEEDTKELTYKRILK---NDIKFP--ETVSHDVKDLISKLL 323

Query: 269 TVDPSGRIKTREILKHPLL 287
             +PS RI  R+++KHP +
Sbjct: 324 KYNPSERISMRDVMKHPWI 342

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 150/280 (53%), Gaps = 32/280 (11%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A   +TG+  AVKIISK          +G+ D      G+ RE+ ++
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKR-------KVMGNID------GVTRELEVL 238

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + LNHP ++RL   +E     Y+++E+V  G+L + +   G + E+      +Q++  + 
Sbjct: 239 RRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLEAVK 298

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H +GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++S
Sbjct: 299 YIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVIS 358

Query: 202 GL----------PYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEF-E 249
           G            Y     D+WS G ++Y +LTG LPF    G+ +  L K +  G + E
Sbjct: 359 GKNSEDKSQNKNKYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSYHE 414

Query: 250 MPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            P KD  IS EA++ I  +L V+P  R+   + L HP +K
Sbjct: 415 GPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  153 bits (387), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 148/275 (53%), Gaps = 17/275 (6%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG GS G V  A+ + T +  AVKII K                DV    +  E
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGN----------DVQLQMLYDE 96

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN+++  D +E+    Y+V +    GELF+ +++RG   E +AV+   Q++
Sbjct: 97  LSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIIIQML 156

Query: 140 IGISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMAA-LESKDKLLETSCGSPHYA 195
             I Y H+  IVHRDLKPEN+L         + +ADFG+A  L+  D L+  + GS  Y 
Sbjct: 157 KAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSLGYV 216

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDED--DGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL G   F  +  +G + +    +   +F  P  
Sbjct: 217 APEVLT-TNGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHEPYW 275

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           + +S EA++ I K LT++P  R    E+L  P +K
Sbjct: 276 NNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score =  151 bits (382), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 151/286 (52%), Gaps = 26/286 (9%)

Query: 9   VTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSND 68
           ++ L+  ++  + +G+ LG G  G+V   +++++G + A+K + K               
Sbjct: 98  LSKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKK-------------- 143

Query: 69  PDVLPYGIE----REITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERG 124
            D++ Y IE    RE+ I   L HPN+ +LY  +     +Y+++EY+  GEL+  L  R 
Sbjct: 144 -DIIQYNIEKQFRREVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRS 202

Query: 125 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 184
              +  A  +  Q+   + Y H   I+HRD+KPEN+++     IKL DFG + +  K   
Sbjct: 203 HFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGSK 262

Query: 185 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNI-RKLLLKV 243
            +T CG+  Y +PE++    Y+  + DVW+ GV+ Y LL G  PF+E+   +  K +LK 
Sbjct: 263 RKTLCGTVDYLSPELIRSREYNE-KVDVWALGVLTYELLVGSPPFEEESKELTYKRILKR 321

Query: 244 QSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
                 +   D +  EA+ LI+++L  DP  RI  +E+ KHP ++K
Sbjct: 322 N-----LIFPDHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEK 362

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 149/275 (54%), Gaps = 27/275 (9%)

Query: 26  LGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMKL 85
           +G G+   V  A    TG+  AVKII K     +               G++RE+ +++ 
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD-------------GVKRELDVLQK 244

Query: 86  LNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYC 145
           LNHP +++L D +E + + YM++E+V  G+L + +   G + E+      RQ++  + Y 
Sbjct: 245 LNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYM 304

Query: 146 HALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSG- 202
           H  GI HRDLKP+N+++  D    IK+ DFG+A +++++  L T CG+  Y APE++ G 
Sbjct: 305 HDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDGK 364

Query: 203 -------LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEF-EMPDKD 254
                     +    D+WS G ++Y +LTG LPF     N  +L  +++ G + E P KD
Sbjct: 365 NAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPLKD 422

Query: 255 -EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
             IS EA++ I  +L VDP  R+   + L+HP +K
Sbjct: 423 YRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  153 bits (387), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 101/300 (33%), Positives = 157/300 (52%), Gaps = 25/300 (8%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G TLG GS G V  A+ + T +  A+KI+ K           G+N    + Y    E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-------GNNVQLQMLY---EE 96

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN++   D +E+    Y+V +    GELF+ ++ RG   E +AV    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQIL 156

Query: 140 IGISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMA-ALESKDKLLETSCGSPHYA 195
             + Y H+  +VHRDLKPEN+L +D   N  + +ADFG+A  L+ K+ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL G  PF  +  +G + +         F +P  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPYW 275

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK--------YPSIKDSKSIRNLPRE 305
           D ISI+A+  I K L ++P+ R    E+L  P +           P +K   S+R   R+
Sbjct: 276 DNISIDAKRFILKALRLNPTERPTATELLDDPWITSKRIGTSNILPDVKKGFSLRKKLRD 335

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 152/279 (54%), Gaps = 20/279 (7%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K    ++ +              +  EI I
Sbjct: 98  GHFLGEGGFARCFQIRD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 145

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG- 141
            K + H N+++  D +E  T++Y++LE    G L +LL +R  L E E VRFF   I G 
Sbjct: 146 HKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQICGA 204

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           I Y H+  ++HRDLK  N+  D K+N+K+ DFG+AA  + D+  + T CG+P+Y APE++
Sbjct: 205 IKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIAPEVL 264

Query: 201 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
            G    H +E D+WS GV++YAL+ GR PF   D N   +  +++  +F  P    IS E
Sbjct: 265 MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNT--IYERIKCRDFSFPKDKLISSE 322

Query: 260 AQDLIAKILTVDPSGRIKTREILKHPLLKKY--PSIKDS 296
           A+ LI  IL++DP  R    EI+ +   +    PS K+S
Sbjct: 323 AKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKES 361

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  159 bits (402), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 139/286 (48%), Gaps = 45/286 (15%)

Query: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76
           +G + + + +G GS GKV +A +  T +   +K   K             NDP+++    
Sbjct: 38  VGNYRILKQIGEGSFGKVYLALHRPTHRKVVLKTSDK-------------NDPNIV---- 80

Query: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136
            RE+   +  ++P + ++Y++  T T ++M LEY    EL++ L+    +P  E    F 
Sbjct: 81  -REVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTELFA 139

Query: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196
           QI+  + Y H+L  VHRDLK EN+LLD     KL DFG          LET CG+  Y A
Sbjct: 140 QIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTVYMA 199

Query: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256
           PE++    Y GF+ D+W+ GVILY ++ G +PFDEDD               E+  K +I
Sbjct: 200 PELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD---------------EVKTKWKI 244

Query: 257 SIEAQDLIAKILTVD------------PSGRIKTREILKHPLLKKY 290
             E  D    I + D            P+ R   REILKH  LK Y
Sbjct: 245 VNEDPDFTNNISSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPY 290

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 147/274 (53%), Gaps = 17/274 (6%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+ + T +  AVKI+ K              D          E
Sbjct: 32  YIFGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKALEGNSVQLQMLYD----------E 81

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ LNHPN++   D +ET    ++V +    GELF+ ++++G   E +A++   QI+
Sbjct: 82  LSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTEEDAIKILVQIL 141

Query: 140 IGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMAA-LESKDKLLETSCGSPHYA 195
             + Y H+  IVHRDLKPENLL   + +   + LADFG+A  L+S D+L+  + GS  Y 
Sbjct: 142 GAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDELIFKAAGSLGYV 201

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDED--DGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL G   F  +  +G + +     +   F  P  
Sbjct: 202 APEVLTS-DGHGKPCDIWSIGVITYTLLCGYSAFAAESVEGFLDECTQNDKPVVFHKPYW 260

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           D +S +A+  I + LT+DP+ R     +L+ P +
Sbjct: 261 DNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  155 bits (391), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 146/294 (49%), Gaps = 39/294 (13%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+ LG G    V  A+N +TG+  AVKI     F+ Q       ND D        E
Sbjct: 198 YLAGKELGTGHYAIVKEARNKETGETVAVKI-----FHPQ------QNDDDKRTKKFTEE 246

Query: 80  ITIMKLLNHPNVLRLYD-----VWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRF 134
             I+  + HPN+++L D     V +T    Y+VLE +  GELF  ++ +  L E+E    
Sbjct: 247 TKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKAL 306

Query: 135 FRQIIIGISYCHALGIVHRDLKPENLLL-----------------DHKFNI--KLADFGM 175
           FRQ++ G+ Y H+  I+HRD+KPEN+LL                 D + +I  K+ADFG+
Sbjct: 307 FRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGL 366

Query: 176 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDG- 234
           A    + K   T CG+P Y APE++    Y     D+WS GV+LY  L G  PF E    
Sbjct: 367 AKFTGEMKFTNTLCGTPSYVAPEVLVKTGYTS-RVDMWSAGVLLYVCLCGFPPFSEQLAP 425

Query: 235 -NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
            ++++ +L+ +   F  P  D I      LI+ +L V+P+ R    + L HP  
Sbjct: 426 PSMKEQILQGKFA-FYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWF 478

>KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa]
           {ON} Anc_8.279 YLR096W
          Length = 539

 Score =  155 bits (392), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 103/306 (33%), Positives = 166/306 (54%), Gaps = 30/306 (9%)

Query: 1   MGTKDNSNVTSLK---GGRI--GPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKII--SK 53
           +G    ++VT+ +   GGRI  G W+   TLG G+ G V +A++  +GQI AVKI    +
Sbjct: 31  LGIPQRTDVTASEENSGGRIQLGEWIFSRTLGKGAKGTVKLAKHRASGQICAVKITIRYQ 90

Query: 54  SIFNAQGSTFVGSNDPDV-----LPYGIE------REITIMKLLNHPNVLRLYDVWETST 102
           S+   + +T    N  DV         I+      +E  + ++L HP++ + Y + E   
Sbjct: 91  SVILNKCNT---QNIEDVKCSKEFKTAIQHDRRTMQEFQLSRVLRHPHICKFYKMEEMRY 147

Query: 103 DLYMVLEYVEKGELFNLLIERGPLPENEAVR--FFRQIIIGISYCHALGIVHRDLKPENL 160
             YM LEY++   L   +  +     NE +   F  QI+  ++Y H+  IVHRDLK EN+
Sbjct: 148 HYYMFLEYIQGCTLLEYVSSQNAKKLNEEIARDFAGQILNALAYLHSNNIVHRDLKMENI 207

Query: 161 LL-DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL 219
           ++ +    IKL DFG+     ++  L   CGS +YAAPE++    Y G E D+WS GV+L
Sbjct: 208 MVTNEDKTIKLIDFGLGCFYDQNSTLNDYCGSLYYAAPEVLKRDYYIGPEVDIWSFGVVL 267

Query: 220 YALLTGRLPFDEDDGNIRKLLLK-VQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKT 278
           Y ++TG+LPF    G  +  L+K + SG+ + P+   +S++   L+++IL +D S R   
Sbjct: 268 YIMVTGKLPF---KGRSKGRLMKHILSGQVKFPNF--LSMDVISLLSRILEIDLSFRFSL 322

Query: 279 REILKH 284
            +I+KH
Sbjct: 323 SDIIKH 328

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  157 bits (398), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 160/300 (53%), Gaps = 29/300 (9%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K+   ++ +              +  EI I
Sbjct: 85  GHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTR-----------KKLLSEIQI 132

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR-QIIIG 141
            K ++HPN+++  D +E  +++Y++LE    G L  LL  R  L E E VRFF  QI   
Sbjct: 133 HKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQICGA 191

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAPE 198
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ES+ K   T CG+P+Y APE
Sbjct: 192 IKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPE 249

Query: 199 IVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEIS 257
           ++ G    H FE D+WS GV+LYALL G+ PF   D N   +  +++  +F  P    IS
Sbjct: 250 VLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPRDKPIS 307

Query: 258 IEAQDLIAKILTVDPSGRIKTREILKHPLLKKY--PSI-----KDSKSIRNLPREDTYLN 310
            E + LI  IL++DP  R    EI+ +   +    PSI      ++ +  ++P E + +N
Sbjct: 308 DEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDIPEEQSLVN 367

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  157 bits (398), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 157/298 (52%), Gaps = 24/298 (8%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++ ++G+I A K ++K    ++ +              +  EI I
Sbjct: 94  GHFLGEGGFARCFQIKD-ESGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 141

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGI 142
            K + H NV++  D +E  T++Y++LE    G L  LL +R  + E E   F  QI   I
Sbjct: 142 HKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQICGAI 201

Query: 143 SYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIVS 201
            Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++ 
Sbjct: 202 KYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLM 261

Query: 202 G-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEA 260
           G    H +E D+WS GV++YALL G+ PF   D N+  +  ++++ +F  P    IS EA
Sbjct: 262 GKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYISNEA 319

Query: 261 QDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLPR-------EDTYLN 310
           + LI  IL+ DP  R    EI+ +   +  +PS   S  +   P        E++Y+N
Sbjct: 320 KTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSCTLSTVMSEDPNYEQIISAEESYIN 377

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  152 bits (383), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 155/286 (54%), Gaps = 24/286 (8%)

Query: 7   SNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGS 66
           S VT  K G +  + +  TLG GS G+V + ++V  G+  A+K++ K     +      +
Sbjct: 81  STVTKGKYG-LQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQI-IKMKQIEHT 138

Query: 67  NDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPL 126
           ND          E  ++KL+ HP ++RL+  ++ S +L+MV++Y+E GELF+LL +    
Sbjct: 139 ND----------ERRMLKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRF 188

Query: 127 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE 186
           P   A  +  ++++ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A   S   +  
Sbjct: 189 PNPVAKFYAAEVVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFAKEVS--SVTW 246

Query: 187 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSG 246
           T CG+P Y APE+++  PY+    D WS GV++Y +L G  PF   D    K   K+  G
Sbjct: 247 TLCGTPDYIAPEVIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQG 303

Query: 247 EFEMPDKDEISIEAQDLIAKILTVDPSGRI-----KTREILKHPLL 287
           +   P       +  DL+ +++T D + R+      +R++  HP  
Sbjct: 304 KINFPQG--FHPDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  159 bits (401), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 118/189 (62%), Gaps = 4/189 (2%)

Query: 101 STDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENL 160
           S   YM+ EYV  G+L + +I+ G L E  A +F R I   + Y H   IVHRDLK EN+
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENI 64

Query: 161 LLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILY 220
           ++     IK+ DFG++ + +  K L T CGS ++AAPE++   PY G E DVWS GV+L+
Sbjct: 65  MISTSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLF 124

Query: 221 ALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTRE 280
            L+ G++PFD+++ ++  L  K++ G+ E P    +SIE   L++K+L VDP+ R   ++
Sbjct: 125 VLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQ 180

Query: 281 ILKHPLLKK 289
           ++ H  +++
Sbjct: 181 VVNHQWMQR 189

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  153 bits (386), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 146/272 (53%), Gaps = 23/272 (8%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+N    +  AVKI+ K                      +  E
Sbjct: 54  YIFGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALKGDELNM------------LYDE 101

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           + I++ L+HP++++  D +E+    Y+V +    GELF+ ++++G   E +AV+   Q++
Sbjct: 102 LMILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQML 161

Query: 140 IGISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMA-ALESKDKLLETSCGSPHYA 195
             I Y H+  +VHRDLKPEN+L         + ++DFG+A  L S+D L+  + GS  Y 
Sbjct: 162 EAIEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGYV 221

Query: 196 APEIV--SGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMP 251
           APE++  SG   HG   D+WS GVI Y LL G  PF  +  +G + ++        F  P
Sbjct: 222 APEVLTTSG---HGKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKP 278

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILK 283
             + IS+EA++ I K LT+DPS R    E+L+
Sbjct: 279 YWNSISVEAKEFILKALTLDPSERPTATELLQ 310

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  152 bits (385), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 156/300 (52%), Gaps = 25/300 (8%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G TLG GS G V  A+ + T +  A+KI+ K           G+N    + Y    E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-------GNNVQLQMLY---EE 96

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN++   D +E+    Y+V +    GELF+ ++ RG   E +AV    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQIL 156

Query: 140 IGISYCHALGIVHRDLKPENLL-LDHKFN--IKLADFGMA-ALESKDKLLETSCGSPHYA 195
             + Y H+  +VHRDLKPEN+L +D   N  + +ADFG+A  L+ ++ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYV 216

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL G  PF  +  +G + +         F MP  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYW 275

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK--------YPSIKDSKSIRNLPRE 305
           D ISI+ +  I K L ++P+ R    E+L  P +           P +K   S+R   R+
Sbjct: 276 DNISIDVKRFILKALRLNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLRD 335

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  154 bits (388), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 148/294 (50%), Gaps = 39/294 (13%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++LG+ LG G    V  A+N +TGQ  AVKI     F+AQ       ND          E
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKI-----FHAQ------QNDDQKKNKQFREE 248

Query: 80  ITIMKLLNHPNVLRLYD-----VWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRF 134
             I+  + HPN++ L D     + ++    Y+VLE ++ GELF  ++ +  L ++E+   
Sbjct: 249 TNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 135 FRQIIIGISYCHALGIVHRDLKPENLLL-------------------DHKFNIKLADFGM 175
           F+Q++ G+ Y H   I+HRD+KPEN+LL                   +    +K+ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGL 368

Query: 176 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDG- 234
           A    + +   T CG+P Y APE+++   Y   + D+WS GVILY  L G  PF +  G 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLGP 427

Query: 235 -NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
            ++++ +L+ +   F  P  D+I      LI+ +L ++P  R    E L HP  
Sbjct: 428 PSLKEQILQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF 480

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  150 bits (379), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 146/268 (54%), Gaps = 23/268 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K     +      +ND          E  ++K
Sbjct: 68  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQI-VKMKQIEHTND----------ERRMLK 116

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L+ HP ++R++  ++ S +L+MV++Y+E GELF+LL +    P   A  +  ++++ + Y
Sbjct: 117 LVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVVLALEY 176

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H   I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+++  P
Sbjct: 177 LHFNNIIYRDLKPENILLDRNGHIKITDFGFA--KEVTTVTWTLCGTPDYIAPEVIATKP 234

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G+++Y +L G  PF   D    K   K+  G    P     + +  DL+
Sbjct: 235 YNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYPSF--FNSDVVDLL 289

Query: 265 AKILTVDPSGRI-----KTREILKHPLL 287
           +K++T D + RI      T+EI  HP  
Sbjct: 290 SKLITADLTRRIGNLQNGTQEIKSHPWF 317

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/267 (35%), Positives = 146/267 (54%), Gaps = 22/267 (8%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K+   ++ +              +  EI I
Sbjct: 85  GHFLGEGGFARCFQIKD-DSGEIFAAKTVAKASIKSEKTR-----------KKLLSEIQI 132

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG- 141
            K ++HPN+++  D +E  +++Y++LE    G L  LL  R  L E E VRFF   I G 
Sbjct: 133 HKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQICGA 191

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAPE 198
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ES+ K   T CG+P+Y APE
Sbjct: 192 IKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPE 249

Query: 199 IVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEIS 257
           ++ G    H FE D+WS GV+LYALL G+ PF   D N   +  +++  +F  P    IS
Sbjct: 250 VLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKPIS 307

Query: 258 IEAQDLIAKILTVDPSGRIKTREILKH 284
            E + LI  IL++DP  R    EI+ +
Sbjct: 308 DEGKILIRDILSLDPIERPSLTEIMDY 334

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score =  150 bits (378), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 141/272 (51%), Gaps = 28/272 (10%)

Query: 22  LGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIE---- 77
           +G+ LG G  GKV   ++ +TG I A+K + K                +++ Y I+    
Sbjct: 102 IGKILGKGKFGKVYCVKHRETGLICALKAMEKK---------------EIVQYTIQKQFR 146

Query: 78  REITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQ 137
           RE+ I     H N+ +LY  +     +Y+++EYV  GEL+  L   GPL E  A  F  Q
Sbjct: 147 REVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQ 206

Query: 138 IIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAP 197
           +   + Y H+  I+HRD+KPEN+L+     IKL DFG +      +  +T CG+  Y +P
Sbjct: 207 MANALDYMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKTLCGTIDYLSP 266

Query: 198 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNI--RKLLLKVQSGEFEMPDKDE 255
           E++    Y+  + DVW+ GV+ Y LL G  PF+ED   +  R++L      + + P    
Sbjct: 267 ELIKSREYNN-KVDVWALGVLTYELLVGSPPFEEDTKEMTYRRIL----RCDLKFP--LN 319

Query: 256 ISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
           +S +A+DLI ++L  +PS RI   E+  H  +
Sbjct: 320 VSPQARDLIVRLLQFEPSKRIPLSEVKSHAWI 351

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  158 bits (399), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 152/279 (54%), Gaps = 30/279 (10%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKIISK          +G+ D      G+ RE+ ++
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISKR-------KVMGNMD------GVTRELEVL 247

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + L+HP ++RL   +E     Y+++E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 248 RKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 307

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H+  I HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APEI+S
Sbjct: 308 YIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEIIS 367

Query: 202 G---------LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEF-EM 250
           G            +    D+WS G ++Y +LTG LPF    G+ ++ L K V++G + E 
Sbjct: 368 GSNNLEENEERNEYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGSYHEG 424

Query: 251 PDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P KD  IS EA++ I  +L V+P+ R+     L+HP +K
Sbjct: 425 PLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 156/291 (53%), Gaps = 19/291 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +     N  +G+I A K ++K    ++ +              +  EI I
Sbjct: 86  GHFLGEGGFARCFQF-NDDSGKIFAAKTVAKLSIKSEKTR-----------RKLLSEIQI 133

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG- 141
            K + + N+++  D +E  T++Y++LE    G L +LL +R  L E E VRFF   I G 
Sbjct: 134 HKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQICGA 192

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 193 IKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 252

Query: 201 SGLPY-HGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
            G    H +E D+WS GV+LYALL G+ PF   D N   +  +++  +F  P    IS E
Sbjct: 253 MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNT--IYERIKCCDFTFPKDKYISPE 310

Query: 260 AQDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLPREDTYL 309
           A+ LI  +L++DP  R    EI+ +   +  +P   +S  + N+P  D  L
Sbjct: 311 AKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL 361

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  157 bits (397), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 147/277 (53%), Gaps = 28/277 (10%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKIISK          +G+ +      G+ RE+ ++
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKR-------KVMGNME------GVSRELEVL 245

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + L+HP ++RL   +E     YMV+E+V  G+L + +   G + E       RQI+  + 
Sbjct: 246 QQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVK 305

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 306 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIG 365

Query: 202 GLPYHGFES-------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEF-EMPD 252
           G      E        D+WS G ++Y +LTG LPF    G+ ++ L K +  G + E P 
Sbjct: 366 GKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEGPL 422

Query: 253 KD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           KD  IS EA+  I  +L V+P  R+     L+HP +K
Sbjct: 423 KDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 157/300 (52%), Gaps = 29/300 (9%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G I A K ++K+   ++ +              +  EI I
Sbjct: 85  GHFLGEGGFARCFQIKD-DSGDIFAAKTVAKASIKSEKTR-----------KKLLSEIQI 132

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG- 141
            K + HPN+++  D +E  +++Y++LE    G L  LL  R  L E E VRFF   I G 
Sbjct: 133 HKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFTTQICGA 191

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAPE 198
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+   ES+ K   T CG+P+Y APE
Sbjct: 192 IKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPE 249

Query: 199 IVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEIS 257
           ++ G    H FE D+WS GV+LYALL G+ PF   D N   +  +++  +F  P    IS
Sbjct: 250 VLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKPIS 307

Query: 258 IEAQDLIAKILTVDPSGRIKTREILKHPLLKKY--PSI-----KDSKSIRNLPREDTYLN 310
            E + LI  IL++DP  R    EI+ +   +    PSI      +  +  N+P E + +N
Sbjct: 308 DEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEVPNFGNIPEEQSLVN 367

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/269 (33%), Positives = 149/269 (55%), Gaps = 19/269 (7%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+TLG G+ G V  A+N +  Q  A+KI+ K             N+  +L      E
Sbjct: 56  YIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKG--------NELQML----YDE 103

Query: 80  ITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQII 139
           ++I++ L+HPN+++  D +E+    Y+V +    GELF+ ++++G   E +AV+   Q++
Sbjct: 104 LSILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQML 163

Query: 140 IGISYCHALGIVHRDLKPENLL-LD--HKFNIKLADFGMA-ALESKDKLLETSCGSPHYA 195
             + Y H+  +VHRDLKPEN+L LD   +  + ++DFG+A  L S+ +L+  + GS  Y 
Sbjct: 164 TAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYV 223

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPF--DEDDGNIRKLLLKVQSGEFEMPDK 253
           APE+++    HG   D+WS GVI Y LL G  PF  +  +G + ++        F  P  
Sbjct: 224 APEVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYW 282

Query: 254 DEISIEAQDLIAKILTVDPSGRIKTREIL 282
           + IS EA+  I + LT+ P+ R    E+L
Sbjct: 283 NNISKEAKQFILRALTLTPARRPTAAELL 311

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  152 bits (385), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 148/294 (50%), Gaps = 39/294 (13%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++ G+ LG G    V  A N +TGQIAAVKI     F+ Q       ND          E
Sbjct: 189 YIAGKELGTGHYAVVKEAINKETGQIAAVKI-----FHPQ------QNDDQKKTKQFRDE 237

Query: 80  ITIMKLLNHPNVLRLYD-----VWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRF 134
             I+  + H N+++L D     V ++    Y+VLE +  GELF+ ++ +  L ++E    
Sbjct: 238 TKILMRIQHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFDRIVRKTKLEQDETRAI 297

Query: 135 FRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------FNIKLADFGM 175
           F+Q++ G+ Y H+  I+HRD+KPEN+LL  +                     +K+ADFG+
Sbjct: 298 FKQLLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPWDRDEIDIKVKIADFGL 357

Query: 176 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDG- 234
           A    + K   T CG+P Y APE+++   Y   + D+WS GV+LY  L G  PF E    
Sbjct: 358 AKFTGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLLYVCLCGFPPFSEQLSP 416

Query: 235 -NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
            ++++ +L+ +   F  P  DEI   A  LI+ +L V+P+ R    + + HP  
Sbjct: 417 PSMKEQILQGKYA-FYSPYWDEIDDSALHLISNLLVVNPAQRFSVNDTINHPWF 469

>Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON}
           YDL101C (REAL)
          Length = 514

 Score =  153 bits (386), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/303 (31%), Positives = 155/303 (51%), Gaps = 42/303 (13%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++LG+ LG G    V  A+N +TGQ  AVKI     F+AQ       ND          E
Sbjct: 201 YLLGKELGAGHYALVKEAKNKKTGQQVAVKI-----FHAQ------QNDDQKKNKQFREE 249

Query: 80  ITIMKLLNHPNVLRLYD-----VWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRF 134
             I+  ++HPN++ L D     + ++    Y+VLE ++ GELF  ++ +  L ++E+   
Sbjct: 250 TNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLGQDESRAL 309

Query: 135 FRQIIIGISYCHALGIVHRDLKPENLLL-------------------DHKFNIKLADFGM 175
           F+Q++ G+ Y H   I+HRD+KPEN+LL                   +    +K+ADFG+
Sbjct: 310 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQVQLGPWDEDEIDIQVKIADFGL 369

Query: 176 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDG- 234
           A    + +   T CG+P Y APE+++   Y   + D+WS GVILY  L G  PF +  G 
Sbjct: 370 AKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLGP 428

Query: 235 -NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPL---LKKY 290
            ++++ +++ +   F  P  D+I      LI+ +L ++P  R    E + HP    LKK+
Sbjct: 429 PSLKEQIMQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEAMNHPWFKDLKKH 487

Query: 291 PSI 293
            S+
Sbjct: 488 NSV 490

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 153/285 (53%), Gaps = 19/285 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++  +G+I A K ++K     + +              +  EI I
Sbjct: 104 GHFLGEGGFARCFQIKD-DSGKIFAAKTVAKLSIKTEKTR-----------KKLLSEIQI 151

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR-QIIIG 141
            K + H N+++  D +E  T++Y++LE    G L  LL +R  L E E VRFF  QI  G
Sbjct: 152 HKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQICGG 210

Query: 142 ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIV 200
           I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 211 IKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 270

Query: 201 SG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIE 259
            G    H +E D+WS GV++YALL G+ PF   D N   +  +++  +F  P +  IS E
Sbjct: 271 MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNT--IYERIKCCDFVFPKEKYISSE 328

Query: 260 AQDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLP 303
           A+ L+  +L++DP  R    E+L +   +  +P    S  +  +P
Sbjct: 329 ARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVP 373

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  157 bits (396), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/279 (32%), Positives = 147/279 (52%), Gaps = 30/279 (10%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKII+K       S             G+ RE+ I+
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKRKVMGNLS-------------GVTRELEIL 247

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + L+HP ++RL   +E     Y+V+E+V  G+L + +   G + E+      RQI+  ++
Sbjct: 248 RKLDHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVA 307

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H  GI HRD+KP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++S
Sbjct: 308 YMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIS 367

Query: 202 G----------LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEF-EM 250
           G          + Y     D+WS G ++Y +LT  LPF       ++L  ++  G + E 
Sbjct: 368 GKNAATENDDRIEYSSL-VDMWSIGCLVYVILTAHLPF--SGSTQQELYEQINRGSYHEG 424

Query: 251 PDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           P KD  +S EA+D I  ++ VDP+ R+  ++ LKH  +K
Sbjct: 425 PLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  156 bits (394), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 150/284 (52%), Gaps = 30/284 (10%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKII+K          +G+ D      G+ RE+ ++
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKR-------KVMGNVD------GVTRELEVL 267

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + LNHP ++ L   +E     Y+++E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H  GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIG 387

Query: 202 GLPYHGFES---------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEF-EM 250
           G    G  +         D+WS G ++Y +LTG LPF    G+ ++ L K + +G + E 
Sbjct: 388 GKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSYHEG 444

Query: 251 PDKDE-ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSI 293
           P KD  IS EA+D I  +L ++P  R+     L+HP L    SI
Sbjct: 445 PLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  152 bits (383), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 149/295 (50%), Gaps = 39/295 (13%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++LG+ LG G    V  A+N +TGQ  AVKI     F+AQ       ND          E
Sbjct: 200 YLLGKELGSGHYALVKEAKNKKTGQQVAVKI-----FHAQ------QNDDQKKNKQFREE 248

Query: 80  ITIMKLLNHPNVLRLYD-----VWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRF 134
             I+  + HPN++ L D     + ++    Y+VLE ++ GELF  ++ +  L ++E+   
Sbjct: 249 TNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 135 FRQIIIGISYCHALGIVHRDLKPENLLL-------------------DHKFNIKLADFGM 175
           F+Q++ G+ Y H   I+HRD+KPEN+LL                   +    +K+ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENVLLNITRRKNSSQVQLGPWDEDEIDIQVKIADFGL 368

Query: 176 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDG- 234
           A    + +   T CG+P Y APE+++   Y   + D+WS GVILY  L G  PF +  G 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLGP 427

Query: 235 -NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            ++++ +L+ +   F  P  D+I      LI+ +L ++P  R    + + HP  K
Sbjct: 428 PSLKEQILQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERYNIDDAMNHPWFK 481

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  149 bits (376), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 141/252 (55%), Gaps = 18/252 (7%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + +++  G+  A+K+I K+    +      +ND          E  ++ 
Sbjct: 103 TLGTGSFGRVHLVRSIHNGRFYALKVIKKNTV-VRLKQIEHTND----------ERRMLS 151

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           ++NHP ++R++  ++ S  ++M+++Y+E GELF+LL      P   A  +  ++ + + Y
Sbjct: 152 VVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYAAEVCLALEY 211

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+L I++RDLKPEN+LLD   +IK+ DFG A       +  T CG+P Y APE+VS  P
Sbjct: 212 LHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSSKP 269

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G+++Y +L+GR PF   D +  K    + S     P    +  + QDL+
Sbjct: 270 YNK-SVDWWSFGILIYEMLSGRTPF--YDRSTIKTYENILSAPLTFPSY--LHEDVQDLL 324

Query: 265 AKILTVDPSGRI 276
            +++T D S R+
Sbjct: 325 NRLITRDLSKRL 336

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  149 bits (376), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 141/261 (54%), Gaps = 26/261 (9%)

Query: 34  VLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIER----EITIMKLLNHP 89
           V   ++ ++G I A+K + KS               +++ Y ++R    E+ I   LNHP
Sbjct: 168 VYCVKHKESGFICALKAMDKS---------------EIIQYNLQRQFRREVEIQTSLNHP 212

Query: 90  NVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALG 149
           N+ +LY  +     +Y+++EY+  GEL+ LL   GP  +  A RF  QI   +++ H  G
Sbjct: 213 NLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFVYQIADALNHLHEKG 272

Query: 150 IVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFE 209
           I+HRDLKPEN+L+     +KL DFG + +  K    +T CG+  Y +PE++    Y    
Sbjct: 273 IIHRDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYLSPEMIRSREYDD-T 331

Query: 210 SDVWSCGVILYALLTGRLPFDEDDGNI-RKLLLKVQSGEFEMPDKDEISIEAQDLIAKIL 268
            DVW+ GV+ Y L+ G  PF+ED   +  K +LK   GE   P    +S + +DLI+++L
Sbjct: 332 VDVWALGVLTYELVAGDPPFEEDSKELTYKRILK---GEIRFP--GTVSQDVRDLISRLL 386

Query: 269 TVDPSGRIKTREILKHPLLKK 289
             DP  RI  +E++ HP + +
Sbjct: 387 KNDPKERILLKEVMVHPWIMR 407

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  149 bits (375), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 86/270 (31%), Positives = 147/270 (54%), Gaps = 23/270 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++   G+  A+K++ K I   +      +ND          E  ++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-VRLKQVEHTND----------ERLMLS 140

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           ++ HP ++R++  ++ S  ++M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+  I++RDLKPEN+LLD   +IK+ DFG A       +  T CG+P Y APE+VS  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 258

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G+++Y +L G  PF   D N  K   K+ + E   P     + + +DL+
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPF--FNEDVKDLL 313

Query: 265 AKILTVDPSGRI-----KTREILKHPLLKK 289
           ++++T D S R+      T ++  HP  K+
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  148 bits (374), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 147/268 (54%), Gaps = 23/268 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K     +      +ND          E  ++K
Sbjct: 75  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV-VKMKQVEHTND----------ERRMLK 123

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L+ HP ++R++  ++ + +++MV++Y+E GELF+LL +    P   A  +  ++I+ + Y
Sbjct: 124 LVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 183

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            HA  I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+++  P
Sbjct: 184 LHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEVITTKP 241

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS GV++Y +L G  PF   D    K   K+  G+   P       +  DL+
Sbjct: 242 YNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYPPY--FHPDVVDLL 296

Query: 265 AKILTVDPSGRI-----KTREILKHPLL 287
           +K++T D + RI      +R+I  HP  
Sbjct: 297 SKLITADLTRRIGNLQSGSRDIKAHPWF 324

>KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit and to YJL164C uniprot|P06244 Saccharomyces
           cerevisiae YJL164C TPK1 putative catalytic subunit of
           cAMP- dependent protein kinase
          Length = 455

 Score =  150 bits (378), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 89/270 (32%), Positives = 147/270 (54%), Gaps = 23/270 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++   G+  A+K++ K+    +      +ND          E  ++ 
Sbjct: 150 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTV-VKLKQVEHTND----------ERNMLS 198

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           +++HP ++R++  ++ S  L+M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 199 IVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 258

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+ GI++RDLKPEN+LLD   +IKL DFG A  +    +  T CG+P Y APE+VS  P
Sbjct: 259 LHSKGIIYRDLKPENILLDKNGHIKLTDFGFA--KYVPDVTYTLCGTPDYIAPEVVSTKP 316

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS GV++Y +L G  PF   D N  K    + +     P       +AQDLI
Sbjct: 317 YNK-SVDWWSFGVLIYEMLAGYTPF--YDSNTIKTYENILNAPVRFPPF--FHSDAQDLI 371

Query: 265 AKILTVDPSGRI-----KTREILKHPLLKK 289
           +K++T D S R+      + ++  HP   +
Sbjct: 372 SKLITRDLSQRLGNLQNGSEDVKNHPWFSE 401

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  147 bits (371), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 143/252 (56%), Gaps = 18/252 (7%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K     +      +ND          E  ++K
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQV-IRMKQIEHTND----------ERRMLK 96

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L++HP ++R++  ++ S +L+MV++Y+E GELF+LL +    P   A  +  ++I+ + Y
Sbjct: 97  LVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 156

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            HA  I++RDLKPEN+LLD   +IK+ DFG A  +  D +  T CG+P Y APE+++  P
Sbjct: 157 LHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATKP 214

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G++++ +L G  PF   D    K   K+  G+   P       +  DL+
Sbjct: 215 YNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPPF--FHPDVVDLL 269

Query: 265 AKILTVDPSGRI 276
           +K++T D + R+
Sbjct: 270 SKLITADLTRRL 281

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  148 bits (373), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 147/268 (54%), Gaps = 23/268 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K     +      +ND          E  ++K
Sbjct: 77  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV-VKMKQVEHTND----------ERRMLK 125

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L+ HP ++R++  ++ + +++MV++Y+E GELF+LL +    P   A  +  ++I+ + Y
Sbjct: 126 LVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 185

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            HA  I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+++  P
Sbjct: 186 LHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEVITTKP 243

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS GV++Y +L G  PF   D    K   K+  G+   P       +  DL+
Sbjct: 244 YNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYPPY--FHPDVVDLL 298

Query: 265 AKILTVDPSGRI-----KTREILKHPLL 287
           +K++T D + RI      +R+I  HP  
Sbjct: 299 SKLITADLTRRIGNLQSGSRDIKAHPWF 326

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 148/280 (52%), Gaps = 32/280 (11%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  AVKII+K          +G+ D      G+ RE+ ++
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKR-------KVMGNMD------GVTRELDVL 243

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + L+HP ++RL   +E     Y+++E+V  G+L + +   G + E+      RQI+  + 
Sbjct: 244 RKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 303

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H  GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 304 YIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 363

Query: 202 G----------LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLK-VQSGEF-E 249
           G          + Y     D+WS G ++Y +LTG LPF    G+ +  L K +  G + E
Sbjct: 364 GKNSAEENEDRIEYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSYHE 419

Query: 250 MPDKD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            P KD  IS EA+D I  +L V P+ R+   + L HP +K
Sbjct: 420 GPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 147/268 (54%), Gaps = 23/268 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K     +      +ND          E  ++K
Sbjct: 76  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV-VKMKQVEHTND----------ERRMLK 124

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L+ HP ++R++  ++ + +++MV++Y+E GELF+LL +    P   A  +  ++I+ + Y
Sbjct: 125 LVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 184

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            HA  I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+++  P
Sbjct: 185 LHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEVITTKP 242

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS GV++Y +L G  PF   D    K   K+  G+   P       +  DL+
Sbjct: 243 YNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYPPY--FHPDVVDLL 297

Query: 265 AKILTVDPSGRI-----KTREILKHPLL 287
           +K++T D + RI      +R+I  HP  
Sbjct: 298 SKLITADLTRRIGNLQSGSRDIKAHPWF 325

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  149 bits (376), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 145/269 (53%), Gaps = 17/269 (6%)

Query: 22  LGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREIT 81
            G+TLG GS G V  A+ + + +  AVKI+ K                 +    + +E++
Sbjct: 33  FGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRENA----------IQLRMLYQELS 82

Query: 82  IMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIG 141
           I+K L+H N++   + +ET   LY+V +    GELF+ +I  G   E++AV+   QI+  
Sbjct: 83  ILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIVQILSA 142

Query: 142 ISYCHALGIVHRDLKPENLLL---DHKFNIKLADFGMAA-LESKDKLLETSCGSPHYAAP 197
           + Y H+  IVHRDLKPENLL    +    + +ADFG+A  L+S ++L+  + GS  Y AP
Sbjct: 143 VEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSLGYVAP 202

Query: 198 EIVSGLPYHGFESDVWSCGVILYALLTGRLPFDED--DGNIRKLLLKVQSGEFEMPDKDE 255
           E+++ +  HG   D+WS GVI Y LL G   F  +  +G + + +   Q  +F+ P  D 
Sbjct: 203 EVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQKPYWDN 261

Query: 256 ISIEAQDLIAKILTVDPSGRIKTREILKH 284
           IS  A++ I K L + P  R    E+LK 
Sbjct: 262 ISQSAKNFILKCLDLTPEQRPTATELLKE 290

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  147 bits (370), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 146/268 (54%), Gaps = 23/268 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K+    +      +ND          E  ++K
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQV-VKMKQIEHTND----------ERRMLK 104

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L+ HP ++R++  ++ S +L+MV++Y+E GELF LL +    P   A  +  ++ + + Y
Sbjct: 105 LVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEY 164

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H   I++RDLKPEN+LLD   +IK+ DFG A  +  + +  T CG+P Y APE+++  P
Sbjct: 165 LHFHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVETVTWTLCGTPDYIAPEVIATKP 222

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS GV++Y +L G  PF   D    K   K+  G+   P     + +  DL+
Sbjct: 223 YNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYPQF--FNSDVIDLL 277

Query: 265 AKILTVDPSGRI-----KTREILKHPLL 287
           +K+LT D + RI       ++I  HP  
Sbjct: 278 SKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 157/302 (51%), Gaps = 28/302 (9%)

Query: 1   MGTKDNSNVTSLKGGRIGP-------WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISK 53
           M   ++ +V SL+   + P       +  G+TLG GS G V  A      +  A+KI+ K
Sbjct: 1   MNELEDPSVVSLESFSLFPSKVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLK 60

Query: 54  SIFNAQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEK 113
                         D          E+TI+K L+HPN++   + +ET   +Y+V +    
Sbjct: 61  KALEGNQVQLQMLYD----------ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATG 110

Query: 114 GELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLL-LDHKFNIKL-- 170
           GELF+ +I++G   E++AV+   QI+  + Y H+  IVHRDLKPENLL L  K + +L  
Sbjct: 111 GELFDRIIKKGRFSEDDAVKILIQILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVI 170

Query: 171 ADFGMAA-LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 229
           ADFG+A  L+  ++L+  + GS  Y APE+++ +  HG   D+WS GVI Y LL+G   F
Sbjct: 171 ADFGIAKELKKGEQLIFKAAGSLGYVAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAF 229

Query: 230 DEDDGNIRKLLLKVQSGE----FEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHP 285
             +   +   L +  SG+    F  P  D IS +A++ I K L ++P  R    E+L  P
Sbjct: 230 VAE--TVEGFLDECTSGDYPVKFHKPYWDNISDDAKNFILKALDLNPQKRPTATELLDDP 287

Query: 286 LL 287
            +
Sbjct: 288 WI 289

>KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {ON}
           Anc_1.182 YJL164C
          Length = 424

 Score =  148 bits (374), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 146/268 (54%), Gaps = 23/268 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++   G+  A+KI+ K +   +      +ND          E  ++ 
Sbjct: 119 TLGTGSFGRVHLIRSNHNGRFYALKILKKRLI-VKLKQVEHTND----------ERLMLS 167

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L++HP ++R++  ++ S  LYMV++YVE GELF+LL +    P   A  +  ++ + + Y
Sbjct: 168 LVSHPFIVRMWGTFQDSVHLYMVMDYVEGGELFSLLRKSQRFPNPVAKFYAAEVCLSLEY 227

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+  I++RDLKPEN+LLD   +IKL DFG A       +  T CG+P Y APE+VS  P
Sbjct: 228 LHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 285

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G+++Y +L G  PF   D N  K    + + + + P       + +DL+
Sbjct: 286 YNK-SVDWWSFGILIYEMLAGHTPF--YDSNTVKTYENILNAKLKFPAF--FHPDVRDLL 340

Query: 265 AKILTVDPSGRI-----KTREILKHPLL 287
           ++++T D S R+      + ++ +HP  
Sbjct: 341 SQLITKDLSNRLGNLQNGSEDVKRHPWF 368

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/264 (32%), Positives = 146/264 (55%), Gaps = 16/264 (6%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G+ LG G   +    ++  +G+I A K ++K    ++ +              +  EI I
Sbjct: 84  GQFLGEGGFARCFQIKD-DSGKIFAAKTVAKISIKSEKTR-----------KKLLSEIQI 131

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGI 142
            K ++H N+++  D +E + ++Y++LE    G L  L+ +R  + E E   F  QI  GI
Sbjct: 132 HKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGI 191

Query: 143 SYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIVS 201
            Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y APE++ 
Sbjct: 192 QYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLM 251

Query: 202 G-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEA 260
           G    H +E D+WS GV+LYALL G+ PF   D N   +  +++   F  P   +IS +A
Sbjct: 252 GKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNT--IYERIKQRNFAYPKDKKISQDA 309

Query: 261 QDLIAKILTVDPSGRIKTREILKH 284
           + LI  IL+++P  R   +EI+ +
Sbjct: 310 KYLIDDILSLNPMERPSIQEIMDY 333

>Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  150 bits (379), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 150/295 (50%), Gaps = 39/295 (13%)

Query: 20  WMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIERE 79
           ++LG+ LG G    V  A+N ++GQ  AVKI     F+AQ       ND          E
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKSGQQVAVKI-----FHAQ------QNDDQKKNKQFREE 248

Query: 80  ITIMKLLNHPNVLRLYD-----VWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRF 134
             I+  ++HPN++ L D     + ++    Y+VLE ++ GELF  ++ +  L ++E+   
Sbjct: 249 TNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 135 FRQIIIGISYCHALGIVHRDLKPENLLL-------------------DHKFNIKLADFGM 175
           F+Q++ G+ Y H   I+HRD+KPEN+LL                   +    +K+ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQAQLGPWDEDEIDIQVKIADFGL 368

Query: 176 AALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDG- 234
           A    + +   T CG+P Y APE+++   Y   + D+WS GVILY  L G  PF +  G 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTKKGYSS-KVDLWSAGVILYVCLCGFPPFSDQLGP 427

Query: 235 -NIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
            ++++ +L+ +   F  P  D+I      LI+ +L ++P  R    E + HP  K
Sbjct: 428 PSLKEQILQAKYA-FYSPYWDKIDDLVLHLISNLLVLNPDERYNIDEAMDHPWFK 481

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 147/270 (54%), Gaps = 23/270 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++   G+  A+K++ K I   +      +ND          E  ++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-VRLKQVEHTND----------ERLMLS 140

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           ++ HP ++R++  ++ +  ++M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+  I++RDLKPEN+LLD   +IK+ DFG A       +  T CG+P Y APE+VS  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 258

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G+++Y +L G  PF   D N  K   K+ + E   P     + + +DL+
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPF--FNEDVKDLL 313

Query: 265 AKILTVDPSGRI-----KTREILKHPLLKK 289
           ++++T D S R+      T ++  HP  K+
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 133/229 (58%), Gaps = 7/229 (3%)

Query: 79  EITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQI 138
           EI I K + H N+++  D +E  T++Y++LE    G L  LL +R  L E E VRFF   
Sbjct: 192 EIQIHKSMKHQNIVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE-VRFFTTQ 250

Query: 139 IIG-ISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAA 196
           I G I Y H+  ++HRDLK  N+  D  +N+K+ DFG+AA+ + D+  + T CG+P+Y A
Sbjct: 251 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKFTVCGTPNYIA 310

Query: 197 PEIVSG-LPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE 255
           PE++ G    H +E DVWS GV++YALL G+ PF   D N   +  +++  +F  P +  
Sbjct: 311 PEVLMGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVN--TIYERIKCCDFIFPKEKP 368

Query: 256 ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLP 303
           IS EA+ L+  +L++DP  R    EI+ +   +  +P    S  +  +P
Sbjct: 369 ISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVP 417

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  148 bits (373), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 148/276 (53%), Gaps = 17/276 (6%)

Query: 18  GPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIE 77
           G +  G+TLG G+ G V  A+ V T +  AVKII K                D+    + 
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKALKGN----------DIQLQMLY 86

Query: 78  REITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQ 137
            E++I++ L+HPN++   D +E+    Y+V +    GELF+ ++ +G   E +AV+   Q
Sbjct: 87  DELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKIVVQ 146

Query: 138 IIIGISYCHALGIVHRDLKPENLLLDHKFN---IKLADFGMA-ALESKDKLLETSCGSPH 193
           I+  I Y H+  +VHRDLKPEN+L     +   I +ADFG+A  L++K+ L+  + GS  
Sbjct: 147 ILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAGSLG 206

Query: 194 YAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDED--DGNIRKLLLKVQSGEFEMP 251
           Y APE+++    HG   D+WS GVI Y LL G   F  +  +G + +        +F  P
Sbjct: 207 YVAPEVLTE-GGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTRSKFPVKFHKP 265

Query: 252 DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLL 287
             D IS EA++ I + LT++P  R    E+L+ P +
Sbjct: 266 YWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 149/277 (53%), Gaps = 27/277 (9%)

Query: 24  ETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIM 83
           E +G G+   V  A    TG+  A KIISK          +G+ D      G++RE+ ++
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKR-------KLMGNWD------GVDRELAVL 236

Query: 84  KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGIS 143
           + L+HP ++RL   +E     Y+++E+V  G+L + +   G + E+      RQ++  ++
Sbjct: 237 RKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVA 296

Query: 144 YCHALGIVHRDLKPENLLL--DHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVS 201
           Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE++ 
Sbjct: 297 YIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 356

Query: 202 GLPYHGFES--------DVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEF-EMPD 252
           G   +  E         D+WS G ++Y +LTG LPF        +L  ++  G + E P 
Sbjct: 357 GKNDNTEEEKNEYSSLVDMWSMGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYHEGPL 414

Query: 253 KD-EISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288
           KD  IS EA+D I  +L V+P+ R    + L+HP ++
Sbjct: 415 KDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {ON}
           Anc_1.182 YJL164C
          Length = 400

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 142/252 (56%), Gaps = 18/252 (7%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K+I   +      +ND          E  ++ 
Sbjct: 95  TLGTGSFGRVHLVRSVHNGRFYALKVLKKNII-VKLKQVEHTND----------ERRMLS 143

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L++HP V+R++  ++ +  ++MV++Y+E GELF+LL +    P   A  +  +I + + Y
Sbjct: 144 LVSHPFVIRMWGTFQDAQQVFMVMDYIEGGELFSLLRKSRRFPNPVAKFYAAEICLALEY 203

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H++ I++RDLKPEN+LLD   ++KL DFG A  +    +  T CG+P Y APE+V+  P
Sbjct: 204 LHSMSIIYRDLKPENILLDKNGHVKLIDFGFA--KYVPDVTYTLCGTPDYIAPEVVNTKP 261

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G+++Y +L G  PF   D N  K    + +   + P     + + QD++
Sbjct: 262 YNK-SVDWWSFGILIYEMLAGYTPF--YDSNTIKTYENILNAPLKFPSY--FNADVQDIL 316

Query: 265 AKILTVDPSGRI 276
            K++  D S R+
Sbjct: 317 VKLINRDLSSRL 328

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 154/287 (53%), Gaps = 17/287 (5%)

Query: 23  GETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITI 82
           G  LG G   +    ++   G++ A K ++K    ++ +              +  EI I
Sbjct: 93  GHFLGEGGFARCFQMKD-DKGKVFAAKTVAKLSIKSEKTR-----------RKLLSEIQI 140

Query: 83  MKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGI 142
            K + HPN+++  D +E  T++Y++LE    G +  LL +R  L E E      QII  I
Sbjct: 141 HKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAI 200

Query: 143 SYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLE-TSCGSPHYAAPEIVS 201
            Y H+  ++HRDLK  N+  D ++N+K+ DFG+AA+ + DK  + T CG+P+Y APE+++
Sbjct: 201 RYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLT 260

Query: 202 GLPY-HGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEA 260
           G    H +E D+WS GV+LYALL G+ PF   +  +  +  +++  +F  P    +S +A
Sbjct: 261 GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKPVSSDA 318

Query: 261 QDLIAKILTVDPSGRIKTREILKHPLLKK-YPSIKDSKSIRNLPRED 306
           ++LI+ +L ++P+ R    EI  +   +  +PS   S   + +P  D
Sbjct: 319 KNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFD 365

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  145 bits (367), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 146/268 (54%), Gaps = 23/268 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K     +      +ND          E  ++K
Sbjct: 49  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQV-VRMKQIEHTND----------ERRMLK 97

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L+ HP ++R++  ++ S +L+MV++Y+E GELF+LL +    P   A  +  ++ +G+ Y
Sbjct: 98  LVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEY 157

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+  I++RDLKPEN+LLD   +IK+ DFG A  +  D +  T CG P Y APE+++  P
Sbjct: 158 LHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGPPDYIAPEVIATKP 215

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS GV+++ +L G  PF   D    K   K+  G+   P       +  DL+
Sbjct: 216 YNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMKTYEKILQGKVVYPTF--FHPDVVDLL 270

Query: 265 AKILTVDPSGRI-----KTREILKHPLL 287
            K++T D + RI      +++I  HP  
Sbjct: 271 GKLITADLTRRIGNLQSGSKDIKCHPWF 298

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  145 bits (367), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 142/252 (56%), Gaps = 18/252 (7%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K     +      +ND          E  ++K
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQV-IRMKQIEHTND----------ERRMLK 96

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L++HP ++R++  ++ S +L+MV++Y+E GELF+LL +    P   A  +  ++I+ + Y
Sbjct: 97  LVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 156

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+  I++RDLKPEN+LLD   +IK+ DFG A  +  D +  T CG+P Y APE+++  P
Sbjct: 157 LHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATKP 214

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G++++ +L G  PF   D    K   K+  G+   P       +  DL+
Sbjct: 215 YNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPPF--FHPDVVDLL 269

Query: 265 AKILTVDPSGRI 276
            K++T D + R+
Sbjct: 270 CKLITSDLTRRL 281

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  145 bits (367), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 139/261 (53%), Gaps = 24/261 (9%)

Query: 33  KVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIE----REITIMKLLNH 88
           +V   ++  TG I A+K++ K                +++ Y ++    RE+ I   LNH
Sbjct: 122 RVYCVRHKVTGFICAMKVMEKQ---------------EIMQYNVQKQFRREVEIQSSLNH 166

Query: 89  PNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHAL 148
            N+ +LY  +     +Y+++EY+  GEL+ LL  +GPL +  A  +  Q+   + Y H  
Sbjct: 167 QNLTKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMADALDYMHQR 226

Query: 149 GIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGF 208
            I+HRD+KPEN+L+     +KL DFG + +  +    +T CG+  Y +PE+++   Y   
Sbjct: 227 NIIHRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPELIASKEYDD- 285

Query: 209 ESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKIL 268
           + DVW+ GV+ + L+    PF+ED   +     ++  G+ + P  + IS +AQDLI K+L
Sbjct: 286 KVDVWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFP--NHISSDAQDLITKLL 341

Query: 269 TVDPSGRIKTREILKHPLLKK 289
             +   RI  RE+ +HP + K
Sbjct: 342 RHNSKDRISLREVKQHPWITK 362

>TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.222
           YPL209C
          Length = 374

 Score =  146 bits (368), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 145/267 (54%), Gaps = 28/267 (10%)

Query: 33  KVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIE----REITIMKLLNH 88
           +V   ++ +TG I A+K + KS               +++ Y ++    RE+ I   L+H
Sbjct: 129 RVYCVKHKKTGFICAMKAMEKS---------------ELVQYNVQKQFRREVEIQSSLSH 173

Query: 89  PNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHAL 148
           PN+ +LY  +     +Y+++EY+  GEL+ +L  RGP  +  A  +  Q+   + + H  
Sbjct: 174 PNLTKLYGFFHDDKRVYLLMEYLVNGELYKVLKARGPFNDIVASHYVYQMADALDFMHQK 233

Query: 149 GIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGF 208
            I+HRD+KPEN+L+     +KL DFG + + ++    +T CG+  Y +PE+++   Y   
Sbjct: 234 NIIHRDVKPENILMGFGNVVKLTDFGWSIISARGVRRKTLCGTIDYLSPELITSREYDD- 292

Query: 209 ESDVWSCGVILYALLTGRLPFDED--DGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAK 266
           + DVW+ GV+ Y L+    PF+ED  D   ++++    SG+ + P  D IS +AQDLI K
Sbjct: 293 KVDVWALGVLTYELIVNSPPFEEDSKDSTYKRIV----SGDLKFP--DTISSDAQDLIRK 346

Query: 267 ILTVDPSGRIKTREILKHPLLKKYPSI 293
           +L      RI  +++ +HP + K+ S 
Sbjct: 347 LLRHKAKDRISLQDVKRHPWILKHKSF 373

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 147/270 (54%), Gaps = 23/270 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++   G+  A+K++ K I   +      +ND          E  ++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-VRLKQVEHTND----------ERLMLS 140

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           ++ HP ++R++  ++ +  ++M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+  I++RDLKPEN+LLD   +IK+ DFG A       +  T CG+P Y APE+VS  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 258

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G+++Y +L G  PF   D N  K   K+ + E   P     + + +DL+
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPF--FNEDVKDLL 313

Query: 265 AKILTVDPSGRI-----KTREILKHPLLKK 289
           ++++T D S R+      T ++  HP  K+
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  146 bits (368), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 146/268 (54%), Gaps = 23/268 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++V  G+  A+K++ K     +      +ND          E  ++K
Sbjct: 78  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQI-VKMKQVEHTND----------ERRMLK 126

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           L+ HP ++R++  ++ + +++MV++Y+E GELF+LL +    P   A  +  ++I+ + Y
Sbjct: 127 LVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 186

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H   I++RDLKPEN+LLD   +IK+ DFG A  +    +  T CG+P Y APE+++  P
Sbjct: 187 LHGHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDYIAPEVITTKP 244

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS GV++Y +L G  PF   D    K   K+  G+   P       +  DL+
Sbjct: 245 YNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYPPY--FHPDVVDLL 299

Query: 265 AKILTVDPSGRI-----KTREILKHPLL 287
           +K++T D + RI      +R+I  HP  
Sbjct: 300 SKLITADLTRRIGNLQSGSRDIKAHPWF 327

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  145 bits (366), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 121/214 (56%), Gaps = 5/214 (2%)

Query: 76  IEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFF 135
           + REI I  +LNHPN+ +LY  +     +Y+V+EY+ +GEL+ LL   GP  +  A  + 
Sbjct: 147 VRREIEIQTILNHPNLTKLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFNDVLASNYV 206

Query: 136 RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYA 195
            QI   + Y H   I+HRD+KPEN+L+     +KL DFG + +  K    +T CG+  Y 
Sbjct: 207 YQIADALDYLHQKHIIHRDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTLCGTIDYL 266

Query: 196 APEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDE 255
           +PEI++   Y     D+W+ GV+ Y L+ G   F+E+   +     ++  GE + P  + 
Sbjct: 267 SPEIITSKEY-DHTVDIWALGVLAYELVVGSPAFEEETKEMT--YKRIVKGELKFP--EH 321

Query: 256 ISIEAQDLIAKILTVDPSGRIKTREILKHPLLKK 289
           +    +DLI +IL ++PS R+  +EI +HP + K
Sbjct: 322 LPNIVRDLIQRILVIEPSKRMSLKEIKRHPWILK 355

>Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C
           (REAL)
          Length = 394

 Score =  145 bits (367), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 147/270 (54%), Gaps = 23/270 (8%)

Query: 25  TLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGIEREITIMK 84
           TLG GS G+V + ++   G+  A+K++ K I   +      +ND          E  ++ 
Sbjct: 89  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIV-VRLKQVEHTND----------ERLMLS 137

Query: 85  LLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISY 144
           ++ HP ++R++  ++ +  ++M+++Y+E GELF+LL +    P   A  +  ++ + + Y
Sbjct: 138 IVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 197

Query: 145 CHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLP 204
            H+  I++RDLKPEN+LLD   ++K+ DFG A       +  T CG+P Y APE+VS  P
Sbjct: 198 LHSKDIIYRDLKPENILLDKNGHVKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKP 255

Query: 205 YHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLI 264
           Y+    D WS G+++Y +L G  PF   D N  K   K+ + E   P     + + +DL+
Sbjct: 256 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPF--FNDDVKDLL 310

Query: 265 AKILTVDPSGRI-----KTREILKHPLLKK 289
           ++++T D S R+      T ++  HP  K+
Sbjct: 311 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 340

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,789,193
Number of extensions: 4825829
Number of successful extensions: 21065
Number of sequences better than 10.0: 2057
Number of HSP's gapped: 17285
Number of HSP's successfully gapped: 2347
Length of query: 1164
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1043
Effective length of database: 39,606,813
Effective search space: 41309905959
Effective search space used: 41309905959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)