Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_1013na 1ON41141121530.0
AFR741Wna 1ON40741311421e-154
SAKL0H24838gna 1ON4104049991e-133
Kwal_33.13025na 1ON4234089931e-132
KLTH0F00594gna 1ON4334019831e-130
ZYRO0D05434gna 1ON4284317425e-94
TDEL0H03670na 1ON4264247287e-92
ABR016C2.494ON43544800.27
Kwal_55.220283.35ON726101790.40
TDEL0A027002.494ON46252732.0
Kwal_0.731.344ON65933713.1
NDAI0I006706.286ON108560696.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1013
         (411 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON} s...   833   0.0  
AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667;...   444   e-154
SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON} cons...   389   e-133
Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON...   387   e-132
KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON...   383   e-130
ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {...   290   5e-94
TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON}              285   7e-92
ABR016C Chr2 complement(422780..424087) [1308 bp, 435 aa] {ON} S...    35   0.27 
Kwal_55.22028 s55 (1079077..1081257) [2181 bp, 726 aa] {ON} YNL3...    35   0.40 
TDEL0A02700 Chr1 (488090..489478) [1389 bp, 462 aa] {ON} Anc_2.4...    33   2.0  
Kwal_0.73 s0 complement(33205..35184) [1980 bp, 659 aa] {ON} YJL...    32   3.1  
NDAI0I00670 Chr9 complement(146095..149352) [3258 bp, 1085 aa] {...    31   6.3  

>Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON}
           similar to Ashbya gossypii AFR741W
          Length = 411

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/411 (96%), Positives = 398/411 (96%)

Query: 1   MNVDDTTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQLEEQRSPP 60
           MNVDDTTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQLEEQRSPP
Sbjct: 1   MNVDDTTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQLEEQRSPP 60

Query: 61  RKVAKVKGXXXXXXXXXXXXXYNRQSRPSGKPIILYGKKDIELELKYCTYHTDVLPEELA 120
           RKVAKVKG             YNRQSRPSGKPIILYGKKDIELELKYCTYHTDVLPEELA
Sbjct: 61  RKVAKVKGQQSLSSFLPLQSLYNRQSRPSGKPIILYGKKDIELELKYCTYHTDVLPEELA 120

Query: 121 NRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRFNDD 180
           NRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRFNDD
Sbjct: 121 NRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRFNDD 180

Query: 181 MVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYIGPH 240
           MVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYIGPH
Sbjct: 181 MVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYIGPH 240

Query: 241 SVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKNHQI 300
           SVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKNHQI
Sbjct: 241 SVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKNHQI 300

Query: 301 SKSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLCTKS 360
           SKSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLCTKS
Sbjct: 301 SKSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLCTKS 360

Query: 361 YTAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEALKFCTK 411
           YTAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEALKFCTK
Sbjct: 361 YTAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEALKFCTK 411

>AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667; No
           homolog in Saccharomyces cerevisiae
          Length = 407

 Score =  444 bits (1142), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/413 (51%), Positives = 285/413 (69%), Gaps = 14/413 (3%)

Query: 1   MNVDDTTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQLEEQRSPP 60
           M   +TTDEKLA L+ + PSA+ E LLD+LV C G++ +A  LL    +    +E+ + P
Sbjct: 1   MEKSETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPA--DEKDARP 58

Query: 61  RKVAKVKGXXXXXXXXXXXXXYNRQSRP----SGKPIILYGKKDIELELKYCTYHTDVLP 116
            K  +++              +  +  P     G+PI+L+GK+DIE  L+YCTYHT+VLP
Sbjct: 59  LKKPRLQ------TQQSLSRYFGLKKSPVPALGGRPIVLHGKRDIEGALRYCTYHTNVLP 112

Query: 117 EELANRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLS-AEEDDYYYNGMRVQTVN 175
             LA RLL+  M ++ +KPNEFYLFG++CV+NCR+ +Y NL  A+    +YNG R+ T+ 
Sbjct: 113 AALAERLLEVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNG-RISTLT 171

Query: 176 RFNDDMVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMT 235
            +N D+   + I+E LVN +L KR  LPFQ   G W+ PV ++NIY KDSDLQWHSDR+T
Sbjct: 172 SYNADLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLT 231

Query: 236 YIGPHSVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLP 295
           YIGPH+++A+L+LGF R  R RRVYP++SQIY++   HNSVLIMHAGCQEEFKHCVPPL 
Sbjct: 232 YIGPHAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLG 291

Query: 296 KNHQISKSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIW 355
           K  ++S + ++PIS + RVSLTFR YKV+      C +CGYPMDLRR YKTP KRGHYIW
Sbjct: 292 KRKKVSAAELHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIW 351

Query: 356 LCTKSYTAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEALKF 408
           +C++ Y++GN  + +  C G+K+A  +   P T  ESEG+ W+ADDDFEAL F
Sbjct: 352 ICSRGYSSGNDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEALNF 404

>SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON}
           conserved hypothetical protein
          Length = 410

 Score =  389 bits (999), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 267/404 (66%), Gaps = 5/404 (1%)

Query: 3   VDDTTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQLEEQRSPPRK 62
           ++ TT+EK+  L  LFP A+ E LL++L SC+GS+R A  L+D S    + ++  S  R 
Sbjct: 6   MESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASV-SQKYDQLYSTKRL 64

Query: 63  VAKVKGXXXXXXXXXXXX-XYNRQSRPSGKPIILYGKKDIELELKYCTYHTDVLPEELAN 121
            AK +                +R  + +  PI L+ K ++E  L YCTYH D+LP E+AN
Sbjct: 65  KAKTQSTLTKLLSDSLTKPGISRGPQKTRTPIALHTKDEVESTLAYCTYHKDILPSEVAN 124

Query: 122 RLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRFNDDM 181
           ++L+  MN+++++ NEFYLFGNKC SN ++ IYS  +       YNG  +  V  + D+M
Sbjct: 125 KILELVMNDKSARSNEFYLFGNKCTSNHKTRIYS-CAEHRKALTYNGRVIDDVGEYTDEM 183

Query: 182 VITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYIGPHS 241
           ++   +IE  VNE LQ R TLP+Q KPG+W S + ++N+Y  DS+LQWHSDR+T IGP +
Sbjct: 184 MVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIGPQA 243

Query: 242 VIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKNHQIS 301
           ++A+LSLGFSR  R R +YPS+SQ+Y++ PEHNS+LIMHAG QEE+KHCVPP+PK  ++ 
Sbjct: 244 IVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCSRVP 303

Query: 302 KSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLCTKSY 361
           K   +PIS TTRV++T+R+ ++    P  C KCGYPM+LRR +K P+ RG Y+W C+KSY
Sbjct: 304 KDEFHPISGTTRVNMTYRN-RIMKKTP-SCIKCGYPMELRRTFKKPDNRGMYMWQCSKSY 361

Query: 362 TAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEA 405
           T  N     +EC G+++A FN+    T  ES  S W+ADDD +A
Sbjct: 362 TEENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQA 405

>Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON}
           [contig 123] FULL
          Length = 423

 Score =  387 bits (993), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 189/408 (46%), Positives = 268/408 (65%), Gaps = 5/408 (1%)

Query: 6   TTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQLEEQRSPPRKVAK 65
           +TDEKL +L+ LFP  + + LLD+LVSC+GS++ +   L  S   T   +      K   
Sbjct: 4   STDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKRLKTKS 63

Query: 66  VKGXXXXXXXXXXXXXYNR--QSRPSGKPIILYGKKDIELELKYCTYHTDVLPEELANRL 123
            +               N+   S+   +P+ L+GK+ IE  + YCTYHTDVLP E+A++L
Sbjct: 64  QQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVADKL 123

Query: 124 LKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRFNDDMVI 183
           L+  + ++N KPN+FYLFGN C SNC S ++    A E  ++YNG  V+    + D+M++
Sbjct: 124 LQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVP-EAREKPFFYNGKEVKNPGNYTDEMML 182

Query: 184 TRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYIGPHSVI 243
            + +IE +VNE + KR  LPFQ K  +W++  V+SN+Y KDS+L WHSDR+T IGP ++I
Sbjct: 183 AQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQAII 242

Query: 244 ATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKNHQISKS 303
           A+LSLGFSR  R R+ YPSNSQ+++++P+HNS++IMHAG QEE+KHCVP L K  +I K 
Sbjct: 243 ASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIPKE 302

Query: 304 AINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLCTKSYTA 363
            ++PIS TTRV+LT+R+Y +   E V C  CG PM+LRR +K P KRG YI+ C++SYTA
Sbjct: 303 DLHPISGTTRVNLTYRNYVMT--ENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTA 360

Query: 364 GNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEALKFCTK 411
            NG +  QEC G  FA F    P  + +SEGS W+A+DD EA +  +K
Sbjct: 361 ANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQSK 408

>KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON}
           conserved hypothetical protein
          Length = 433

 Score =  383 bits (983), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 267/401 (66%), Gaps = 8/401 (1%)

Query: 6   TTDEKLAYLQNLFPSANAEVLLDLLVSCNGSV-RDATLLLDLSEEGTQLEEQRSPPRKVA 64
           +T+EK+A LQNL+P    + LLD+LVSC GS+ R A LL D +   +  +  +S  ++  
Sbjct: 32  STEEKIAELQNLYPDYGVDGLLDVLVSCGGSLKRSAQLLGDTTTPESSSKRFKSRQQQTL 91

Query: 65  KVKGXXXXXXXXXXXXXYNRQSRPSGKPIILYGKKDIELELKYCTYHTDVLPEELANRLL 124
                             ++ SRP    I L+ K+D+E  LKYCTYH +VLP ELAN+LL
Sbjct: 92  NRFLDVRLLPKAAIKTNGSKASRP----IELHSKEDVESTLKYCTYHPNVLPLELANKLL 147

Query: 125 KFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRFNDDMVIT 184
           +    + + KPNEFYLFGNKC+SNC+S I+   +  E  +YYNG RV++ + ++D++++ 
Sbjct: 148 EALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEP-FYYNGKRVESYSTYSDEIMMA 206

Query: 185 RSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYIGPHSVIA 244
           + ++E+LVN+ L +R  LPFQ + G W+   V+SN Y++DS+L WHSDR+T IGPH++IA
Sbjct: 207 QILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNIGPHAIIA 266

Query: 245 TLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKNHQISKSA 304
           +LSLGF+R  R RRV+PSNS  Y++ P+HNS++IMHAG QEE+KHCVP LPKN  I    
Sbjct: 267 SLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKNCNIPAED 326

Query: 305 INPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLCTKSYTAG 364
           ++PIS   RV+LTFR+Y + T   V C  CG+PMDLRR +K P KRG YI+ C+KSYT  
Sbjct: 327 VHPISNDVRVNLTFRNYALTT--KVFCKLCGFPMDLRRSFKDPSKRGLYIFQCSKSYTEE 384

Query: 365 NGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEA 405
           N     +EC G  FA F    P T  E++GS W+ADDD EA
Sbjct: 385 NSFKEGRECKGFAFACFKKKPPFTEFETDGSRWIADDDLEA 425

>ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {ON}
           conserved hypothetical protein
          Length = 428

 Score =  290 bits (742), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 173/431 (40%), Positives = 244/431 (56%), Gaps = 36/431 (8%)

Query: 1   MNVDDTTDEKLAYLQNLF----PSA--NAEVLLDLLVSCNGSVRDATLLLD--------- 45
           M+ D  T++KL  L  L+    P++       L++LVSC G++  A  L++         
Sbjct: 1   MSTDGLTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTS 60

Query: 46  ----LSEEGTQLEEQRSPPRKVAK-VKGXXXXXXXXXXXXXYNRQSRPSGKPIILYGKKD 100
               L  +G   +E  SP  KV K +                    + S + I L+ K+D
Sbjct: 61  ETDILCAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKED 120

Query: 101 IELELKYCTYHTDVLPEELANRLLKFTMNEQNS-KPNEFYLFGNKCVSNCRSAIYSN--- 156
           IE  +KY + H +VLPE LAN LLK    + +S  PN+FYLFG KC SN  + ++S+   
Sbjct: 121 IETNIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEE 180

Query: 157 LSAEEDDYYYNGMRVQTVNRFNDDMVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVV 216
           +SA     YYN   +  + +++DD+ + + +IE LVN+ + +R  LP+Q +  +WK  VV
Sbjct: 181 ISAGNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVV 240

Query: 217 ISNIYAKDSDLQWHSDRMTYIGPHSVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSV 276
           + N Y K+S+L WHSD+MT IGP  +IA+LSLG SR  R R+ YPSNSQIY + P HN++
Sbjct: 241 LVNRYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTL 300

Query: 277 LIMHAGCQEEFKHCVPPLPKNHQISKSAINPISQTTRVSLTFRDYKVNTYEPV-HCDKCG 335
           +IMHAG QEE++HCV    KN  +     +PIS   R++LT+R Y     +    C KCG
Sbjct: 301 VIMHAGFQEEYRHCVHGHSKNSPLKP---HPISGHVRINLTYRCYLRKFLDRCPKCKKCG 357

Query: 336 YPMDLRRIYKTPEKRGHYIWLCTKSYTAGNGLNNKQECGGLKFARF-NHPLPTTTTESEG 394
            PMDLRR +K P+ RG YIW C+KSYT        QECGG+  A+F N  L     + EG
Sbjct: 358 SPMDLRRAFKDPKTRGQYIWQCSKSYTG-------QECGGVIRAKFDNDSLTVQNFDEEG 410

Query: 395 SFWVADDDFEA 405
           S W+A DD EA
Sbjct: 411 SRWLAPDDQEA 421

>TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score =  285 bits (728), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 170/424 (40%), Positives = 236/424 (55%), Gaps = 36/424 (8%)

Query: 7   TDEKLAYLQNLFPSA------NAEVLLDLLVSCNGSVRDATLLLDLS---------EEGT 51
           T+EK+A L +L+             LL++L +C+GSV++A+L+L+ S           G 
Sbjct: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61

Query: 52  QLEEQRSPPRKVAKVKGXXXXXXXXXXXX----XYNRQSRPSGKPIILYGKKDIELELKY 107
           +  +  +   +  KV+                   +R+++ S + I L+ K+D+E  + Y
Sbjct: 62  RKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIGY 121

Query: 108 CTYHTDVLPEELANRLLKFTMNE-QNSKPNEFYLFGNKCVSNCRSAIYSNLSA---EEDD 163
            T H   LPEE AN LL+  M++ +   P EF+LFGNKC SN  S  YS+  A     D 
Sbjct: 122 VTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRDK 181

Query: 164 YYYNGMRVQTVNRFNDDMVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAK 223
            YYN  R  TV  +ND +  T+ +IE +VNE ++K   LPFQ    +WK  VV+ N Y K
Sbjct: 182 IYYNNRR-GTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK 240

Query: 224 DSDLQWHSDRMTYIGPHSVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGC 283
              L WHSDR+T IGP  ++A+LSLG  R  R RR YPS+SQIY V P HNS++IMHAG 
Sbjct: 241 SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF 300

Query: 284 QEEFKHCVPPLPKNHQISKSAINPISQTTRVSLTFRDY-KVNTYEPVHCDKCGYPMDLRR 342
           QEE++H V     N   +   ++PIS+  R +LT+RDY K        C KC  PMDLRR
Sbjct: 301 QEEYRHSVHQQTNNRATN---LHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRR 357

Query: 343 IYKTPEKRGHYIWLCTKSYTAGNGLNNKQECGGLKFARFN-HPLPTTTTESEGSFWVADD 401
            +K PE+RG YIW C+  Y+         ECGG++ A FN + L       EGS W+ADD
Sbjct: 358 AFKDPERRGQYIWQCSSHYSG-------VECGGVRLADFNCNSLVVEKNAGEGSRWLADD 410

Query: 402 DFEA 405
           D+EA
Sbjct: 411 DWEA 414

>ABR016C Chr2 complement(422780..424087) [1308 bp, 435 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL090W
          Length = 435

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 8  DEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGT 51
          DE + +LQ LFP   A VL  +L + NG V  A  +L   E+ T
Sbjct: 4  DEAVQFLQELFPDRTASVLAQVLRNANGDVDTACAMLVEREQAT 47

>Kwal_55.22028 s55 (1079077..1081257) [2181 bp, 726 aa] {ON} YNL311C
           - Hypothetical ORF [contig 124] FULL
          Length = 726

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 108 CTYHTDVLPEELANRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYN 167
           C+Y   V    L N   KF +   N  P+  YL       +C S+ +++     D YY+ 
Sbjct: 419 CSYFHRVKNLRLLNLRSKFDLILSNCFPSLSYL-----TIDCNSSCFNDEKIVSDSYYHR 473

Query: 168 GMRVQTVNRFNDDMVITRSIIEKLVNEQLQKRLTLPFQTKP 208
               +    F+DD    RSI E LV+ ++ + L +P  T P
Sbjct: 474 ----EAFREFSDD----RSIAETLVDAEVTRELIVPPATTP 506

>TDEL0A02700 Chr1 (488090..489478) [1389 bp, 462 aa] {ON}
          Anc_2.494 YKL090W
          Length = 462

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 1  MNVDDTTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLDLSEEGTQ 52
          MN D +TD KL  L  +FP      +L  L S NG   +A  +L LSE  ++
Sbjct: 1  MNSDASTDSKLDELALIFPDKRPAQILRALESANGDSHEACAIL-LSESSSE 51

>Kwal_0.73 s0 complement(33205..35184) [1980 bp, 659 aa] {ON}
           YJL047C (RTT101) - Regulator of Ty1 Transposition
           [contig 76] FULL
          Length = 659

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 13  YLQNLFPSANAEVLLDLLVSCNGSVRDATLLLD 45
           Y  ++F S N EVL DLL+SC    R+  + +D
Sbjct: 155 YFLDMFASHNTEVLSDLLISCFVKARENAIFVD 187

>NDAI0I00670 Chr9 complement(146095..149352) [3258 bp, 1085 aa] {ON}
           Anc_6.286 YMR196W
          Length = 1085

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 117 EELANRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNR 176
           E++A++  +  M   +S   E+ L G     NC      NL  EED +YY+ +   + NR
Sbjct: 640 EDIASKFFEHFMLISDSISFEYEL-GRNMEGNCEEVAKQNLWNEEDQFYYDAITWDSKNR 698

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,657,362
Number of extensions: 2017737
Number of successful extensions: 5238
Number of sequences better than 10.0: 20
Number of HSP's gapped: 5348
Number of HSP's successfully gapped: 21
Length of query: 411
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 299
Effective length of database: 40,638,807
Effective search space: 12151003293
Effective search space used: 12151003293
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)