Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10121.10ON1771778971e-125
ZYRO0F18370g1.10ON2201511833e-16
SAKL0C00572g1.10ON3381711793e-15
TDEL0C069301.10ON1841491664e-14
KLLA0C00594g1.10ON1941481665e-14
NDAI0A001901.10ON1711401411e-10
KAFR0D001901.10ON1851561351e-09
TPHA0E039601.10ON1771441296e-09
KNAG0C002701.10ON1741371226e-08
NCAS0B090601.10ON1671541112e-06
Kwal_33.130231.10ON193153936e-04
KLTH0F00572g1.10ON195167880.003
ZYRO0E06578g2.578ON45651770.11
Kpol_191.26.4ON584102750.28
TBLA0D015105.548ON633105730.39
KLLA0B05555g4.310ON199749720.63
Kpol_1002.1098.171ON67050672.3
Suva_4.4003.109ON103744672.4
ZYRO0G03454g6.172ON477105654.1
TBLA0A049701.10ON18149635.6
NOTE: 5 genes in the same pillar as Ecym_1012 were not hit in these BLAST results
LIST: Kpol_2002.13 Skud_3.8 Smik_3.19 YCL056C Suva_3.157

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1012
         (177 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...   350   e-125
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...    75   3e-16
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    74   3e-15
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....    69   4e-14
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    69   5e-14
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...    59   1e-10
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    57   1e-09
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    54   6e-09
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    52   6e-08
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    47   2e-06
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    40   6e-04
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    39   0.003
ZYRO0E06578g Chr5 (496299..497669) [1371 bp, 456 aa] {ON} simila...    34   0.11 
Kpol_191.2 s191 (2186..3940) [1755 bp, 584 aa] {ON} (2186..3940)...    33   0.28 
TBLA0D01510 Chr4 complement(377568..379469) [1902 bp, 633 aa] {O...    33   0.39 
KLLA0B05555g Chr2 complement(494997..500990) [5994 bp, 1997 aa] ...    32   0.63 
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    30   2.3  
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    30   2.4  
ZYRO0G03454g Chr7 complement(271038..272471) [1434 bp, 477 aa] {...    30   4.1  
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    29   5.6  

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score =  350 bits (897), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%)

Query: 1   MDEELNQPLSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGII 60
           MDEELNQPLSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGII
Sbjct: 1   MDEELNQPLSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGII 60

Query: 61  KKDNVIYKALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYALKNVLPPASIKKKYNE 120
           KKDNVIYKALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYALKNVLPPASIKKKYNE
Sbjct: 61  KKDNVIYKALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYALKNVLPPASIKKKYNE 120

Query: 121 TKSRVKRSILRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKLSRLLFWILPALNFAH 177
           TKSRVKRSILRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKLSRLLFWILPALNFAH
Sbjct: 121 TKSRVKRSILRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKLSRLLFWILPALNFAH 177

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score = 75.1 bits (183), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 82/151 (54%), Gaps = 15/151 (9%)

Query: 25  DTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF- 83
           D NG   TFED L   L S    +D +YL +++GII +DN++Y+ L  G+   GS+L F 
Sbjct: 49  DPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEW--GSKLWFV 106

Query: 84  -LLLVARKTFLKLLRLVRLWYALKNVLPP-----------ASIKKKYNETKSRVKRSILR 131
            LLL ARK+F +LL++++    LK  +               ++ K+ +   +    I  
Sbjct: 107 TLLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKD 166

Query: 132 LSVDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162
           + ++LL TL YL +V+I++FK  VS    K+
Sbjct: 167 VVLELLQTLAYLAIVVIEVFKINVSQKVIKI 197

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 73.6 bits (179), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 82/171 (47%), Gaps = 14/171 (8%)

Query: 9   LSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYK 68
           LS +   + E   ED      P +FED L   L S    +D +YL ++ GII + N +Y+
Sbjct: 153 LSTVLETSNE-EHEDEKGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYR 211

Query: 69  ALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYAL---KNVLPPAS-------IKKKY 118
            L  G + S   L  L+L  RK+  +L RL R  + L   +   P          I  K+
Sbjct: 212 HLNKGGLGSKLWLATLVLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKF 271

Query: 119 NETKSRVKRSILRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKLSRLLFWI 169
            +   ++ R I  + +D+L  L YL+VV +D+FK K+    R   RLL W+
Sbjct: 272 TQKIGQLDRQIKDVLLDVLQNLAYLLVVAVDVFKLKLPHRWR---RLLEWV 319

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score = 68.6 bits (166), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 81/149 (54%), Gaps = 14/149 (9%)

Query: 26  TNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF-- 83
           T GS T+FED L   L S  +F+D +Y  +S+GII ++N +Y+ L  G    GS+L F  
Sbjct: 15  TGGSKTSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKG--GWGSKLWFVT 72

Query: 84  LLLVARKTFLKLLRLVRLWYALKNVLPPASIKKK--YNET-KSRV------KRSILRLS- 133
           LLL  RK   ++ ++VR    LK  +       K   N+  K ++        +++R + 
Sbjct: 73  LLLSVRKCLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETL 132

Query: 134 VDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162
           +DLL   VYL++V+ID+FK  +    R++
Sbjct: 133 LDLLQNSVYLMIVVIDVFKLNIPKRARQI 161

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 68.6 bits (166), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 81/148 (54%), Gaps = 14/148 (9%)

Query: 19  LSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSG 78
           ++ ED+ +N    + ED L ++L S  +F+D +YL +S GII   N +Y+ L  G I S 
Sbjct: 23  IANEDAPSN----SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSK 78

Query: 79  SRLLFLLLVARKTFLKLLRLVRLWYAL-KNVLPPAS---------IKKKYNETKSRVKRS 128
             L+ LLL  R++  +L  L+RL   L K  +  AS         +K+K     +++   
Sbjct: 79  VWLVSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLK 138

Query: 129 ILRLSVDLLDTLVYLIVVLIDLFKFKVS 156
           I  L +DLL  L+Y+I+V ID+FK  +S
Sbjct: 139 IRSLCMDLLQDLLYMIIVSIDIFKINLS 166

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 73/140 (52%), Gaps = 16/140 (11%)

Query: 32  TFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF--LLLVAR 89
           T ED +   L      +D +YL +S+GII ++N++Y+ L  G  N GS++ F  L+L  R
Sbjct: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKG--NFGSKIWFVTLILTTR 61

Query: 90  KTFLKLLRLV----RLWYALKNV--------LPPASIKKKYNETKSRVKRSILRLSVDLL 137
           K   +L+R V    RL    KN         L  + + +K +    +    I+ L ++L 
Sbjct: 62  KLVHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELF 121

Query: 138 DTLVYLIVVLIDLFKFKVSD 157
            TLVYL +V I++FK K SD
Sbjct: 122 QTLVYLFLVSINIFKLKFSD 141

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 79/156 (50%), Gaps = 19/156 (12%)

Query: 16  AEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKI 75
           +  L+ +D + +    T ED L + L    T +D IY  +++G+IK+DN IYK L  G +
Sbjct: 2   SSPLTDKDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNL 61

Query: 76  NSGSRLLFLLLVARKTFLKLLRLVRLWYALKNVLPPASIKKKYNET----------KSRV 125
            S   L+ L+L  R+ F  L  + R     K V   + + KK N++          K ++
Sbjct: 62  GSKIWLVSLILSIRRCFKNLTHMYRT--RRKYVTELSIVSKKRNQSSENGLVNGILKDKL 119

Query: 126 KRSILRLSVDLLD-------TLVYLIVVLIDLFKFK 154
            +S+ + +  + D        L+YLI+V+I++FK K
Sbjct: 120 LQSLQKCNSIIRDLLLEFLQVLLYLIIVIIEVFKVK 155

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score = 54.3 bits (129), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 73/144 (50%), Gaps = 13/144 (9%)

Query: 24  SDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF 83
           SD NG+   FE  L   L S    +DL++  +S G+IK++N  Y+ L   + N GS++ F
Sbjct: 8   SDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNL--NRSNIGSKIWF 65

Query: 84  --LLLVARKTFLKLLRLVRLWYAL---------KNVLPPASIKKKYNETKSRVKRSILRL 132
             L+L  RK +  +L+  +L   L          N L    I +K     + +K+ I   
Sbjct: 66  VTLILSIRKLYKNILKSTKLLSLLKTELTKIEKNNDLTSDIILQKIQNNNTILKKKIKNF 125

Query: 133 SVDLLDTLVYLIVVLIDLFKFKVS 156
            ++L+   +YLI+V +++FK  +S
Sbjct: 126 IIELIQDFIYLIIVSLEIFKISIS 149

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 28  GSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLFLLLV 87
            +  ++ED L   L S  + +D IYL +S+GII K+N +Y+ L  G + S    L L+L 
Sbjct: 4   AASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILS 63

Query: 88  ARKTFLKLLRLV----RLWYALKNVLPPASIKKK------YNETKSRVKRS---ILRLSV 134
            RK   +L+RLV    +L + ++ +L    +          N+  + +++    I+   +
Sbjct: 64  IRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFL 123

Query: 135 DLLDTLVYLIVVLIDLF 151
           DL   L+YL +V  D F
Sbjct: 124 DLAQLLIYLFIVSGDCF 140

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 73/154 (47%), Gaps = 31/154 (20%)

Query: 31  TTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLFLLLVARK 90
           T  ED +   L S    +D +Y F+SIG++ + N++Y+ L  G    GS+L FL L+   
Sbjct: 2   TGLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDF--GSKLWFLTLLLSS 59

Query: 91  TFLKLLRLVRLWYALKNVLPPASIKKKYNET-------KSRVK---RSILRLS------- 133
                  + RL  +LK     A IKK+ +E+       KS V    R  L LS       
Sbjct: 60  K----KLITRLTKSLK---IRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDI 112

Query: 134 -----VDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162
                ++LL T++YL +  I++FK KV    + L
Sbjct: 113 IRNNVLELLQTMMYLSIAFINVFKVKVPQKWKHL 146

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 66/153 (43%), Gaps = 18/153 (11%)

Query: 24  SDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLF 83
           + TN      E+     + S    +D I+L +S GII + N +Y+ L      S   LL 
Sbjct: 24  TKTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLS 83

Query: 84  LLLVARKTFLKLLRLVRLWYALKNVLPPASIKKKYNETKS--------------RVKRSI 129
           L+L  RK    +  L  LW + ++ L    +    + + S               V R +
Sbjct: 84  LVLSTRKC---IRDLNNLWMS-RSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRL 139

Query: 130 LRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162
           + ++++++  + YLI+V  D+F   + +  + L
Sbjct: 140 ILVALEIMQNIAYLIIVAADVFTLNLVERWKNL 172

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 77/167 (46%), Gaps = 12/167 (7%)

Query: 6   NQPLSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNV 65
           ++PLS   R +     + S   G     E  L   L +    +D + L +S G+I ++NV
Sbjct: 8   SRPLSK--RGSRSCPDKPSTLEGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNV 65

Query: 66  IYKALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYALKNVL------PPASIKKKYN 119
            Y+ L      S + L+ L L +R+    ++ L      LK         P   ++K  N
Sbjct: 66  FYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLN 125

Query: 120 -ETKSRVK---RSILRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKL 162
            +  +R++   + ++ ++++L+  + YL +V  D+  F +++  ++L
Sbjct: 126 AKVTARIQEINQKLILVALELIQNIGYLTLVAADVLAFGLTEKWKRL 172

>ZYRO0E06578g Chr5 (496299..497669) [1371 bp, 456 aa] {ON} similar
           to uniprot|Q04371 Saccharomyces cerevisiae YMR027W High
           level expression reduced Ty3 Transposition
          Length = 456

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 31/51 (60%)

Query: 19  LSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYKA 69
            +++++   G P +F + LT+     VT++D  +LF  I + ++ NV++++
Sbjct: 72  FTQQETAIAGVPASFNEHLTDTRNEGVTWFDAEWLFAEIYMYRRINVLFRS 122

>Kpol_191.2 s191 (2186..3940) [1755 bp, 584 aa] {ON} (2186..3940)
           [1755 nt, 585 aa]
          Length = 584

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 46/102 (45%), Gaps = 24/102 (23%)

Query: 5   LNQPLSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDN 64
           LNQ LS +    EEL ++ S+TN S  T E  +            L    +SI + K  N
Sbjct: 304 LNQELSFLLEEVEELQQKISETNFSNDTREKLM------------LQLENKSIVVNKTFN 351

Query: 65  VIYKALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYALK 106
           VIYKAL    +N+G        VA KT     RL R W  +K
Sbjct: 352 VIYKALEFSLLNAG--------VAVKTN----RLARKWLEIK 381

>TBLA0D01510 Chr4 complement(377568..379469) [1902 bp, 633 aa] {ON}
           Anc_5.548 YDR436W
          Length = 633

 Score = 32.7 bits (73), Expect = 0.39,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 3/105 (2%)

Query: 47  FYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYALK 106
           F+DL+ LF   G     N ++    V +       + LLL  +  + +   L+R  +   
Sbjct: 384 FHDLLRLFHKCGFPPSSNYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECA 443

Query: 107 NVLPPASIKKKYNETKSRVKRSILRLSVDLLDTLVYLIVVLIDLF 151
           NV     +   Y+E K R    I ++ VD  +TL  + VV   +F
Sbjct: 444 NV---TKVYGFYDECKRRCSVKIWKVFVDTFNTLPLVSVVAKKIF 485

>KLLA0B05555g Chr2 complement(494997..500990) [5994 bp, 1997 aa]
           {ON} similar to uniprot|Q00416 Saccharomyces cerevisiae
           YLR430W SEN1 Nuclear protein putative helicase required
           for processing of tRNAs rRNAs and small nuclear RNAs
           potential Cdc28p substrate
          Length = 1997

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 9/49 (18%)

Query: 5   LNQPLSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYL 53
            N+P++GIF   E+   +DSD+N       D+L    RS+ TF D+IYL
Sbjct: 736 FNEPVTGIFSDFEKF--KDSDSN-------DELFSFWRSSWTFLDMIYL 775

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 7   QPLSGIFRYAEELSKED--SDTNGSPTTFEDQLTENLRSAVTFYDLIYLF 54
           +PL   F+ AE   KE    D N  P  F D   E+L+S   FY +  +F
Sbjct: 422 EPLQKKFKSAEPQKKEKLPRDANEEPFVFIDSEHESLKSCWNFYGIDNIF 471

>Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {ON}
            YBR150C (REAL)
          Length = 1037

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 15   YAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIG 58
            Y+E+  KE SD N       +++ E L   V FYD  + F+ +G
Sbjct: 991  YSEQGKKEYSDENARSNKLFEKIEEYLDHGVFFYDRDFFFKKLG 1034

>ZYRO0G03454g Chr7 complement(271038..272471) [1434 bp, 477 aa] {ON}
           some similarities with uniprot|P32945 Saccharomyces
           cerevisiae YPL179W PPQ1 Putative protein
           serine/threonine phosphatase null mutation enhances
           efficiency of translational suppressors
          Length = 477

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 46/105 (43%), Gaps = 3/105 (2%)

Query: 47  FYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYALK 106
           F DL+ +F+  G+  + N ++    V +       + LLL  +  +     ++R  +   
Sbjct: 242 FTDLLRIFKLSGVPPETNYLFLGDYVDRGKQSLETILLLLCYKVKYKDNFFMLRGNHESA 301

Query: 107 NVLPPASIKKKYNETKSRVKRSILRLSVDLLDTLVYLIVVLIDLF 151
           NV     I   Y+E K R    + +  VD+ +TL +  ++   +F
Sbjct: 302 NV---TKIYGFYDECKRRTSSKVWKTFVDVFNTLPFAAIIQDKIF 343

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 41 LRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLFLLLVAR 89
          L S  + +D IY  +SIG+I   N+ Y+ L   ++ S   L+ L+L  R
Sbjct: 17 LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,147,961
Number of extensions: 734676
Number of successful extensions: 2427
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2443
Number of HSP's successfully gapped: 32
Length of query: 177
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 75
Effective length of database: 41,785,467
Effective search space: 3133910025
Effective search space used: 3133910025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 62 (28.5 bits)