Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_1011na 1ON71671636100.0
SAKL0C00550g1.9ON73273321820.0
KLLA0C00572g1.9ON71271521080.0
ZYRO0F18392g1.9ON72572320730.0
Kpol_2002.121.9ON73971620520.0
NCAS0B090701.9ON73070720400.0
NDAI0A001801.9ON74071520240.0
KNAG0C002601.9ON74468620100.0
TPHA0E039701.9ON74772620060.0
TBLA0A075601.9ON74168320010.0
KAFR0D001801.9ON72372419880.0
CAGL0B00418g1.9ON74368419300.0
AGR406C1.9ON68368018890.0
Suva_3.1561.9ON71267818730.0
Smik_3.181.9ON71269318540.0
YCL057W (PRD1)1.9ON71269118470.0
Skud_3.71.9ON71268018110.0
AGR405Cna 1ON71767916860.0
ABR185WsingletonON45741310211e-131
Kpol_297.82.432ON7875204344e-44
KNAG0A062002.432ON7895344034e-40
Skud_11.932.432ON7725083963e-39
KAFR0D029502.432ON7775143945e-39
AFR198W2.432ON7765083937e-39
Ecym_60992.432ON7735033921e-38
TBLA0I007102.432ON7735323902e-38
SAKL0E03938g2.432ON7675273892e-38
NCAS0A042802.432ON7735143822e-37
ZYRO0G20130g2.432ON7865123803e-37
YKL134C (OCT1)2.432ON7725083803e-37
Suva_11.912.432ON7754983795e-37
NDAI0E020102.432ON7784663751e-36
Smik_11.1022.432ON7725063751e-36
CAGL0D02112g2.432ON7615193618e-35
TDEL0A020802.432ON7875133563e-34
Kwal_26.76162.432ON7705233546e-34
TPHA0G023902.432ON7954863441e-32
KLTH0D04730g2.432ON7725353376e-32
KLLA0B12397g2.432ON7796943323e-31
Ecym_64232.73ON52389761.8
ZYRO0G01166g1.367ON99368761.9
Kpol_2000.891.55ON841122716.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1011
         (716 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...  1395   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   845   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   816   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   803   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   795   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   790   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        784   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   778   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   777   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   775   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   770   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   748   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   732   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   726   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   718   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   716   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    702   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   654   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   397   e-131
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   171   4e-44
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   159   4e-40
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   157   3e-39
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   156   5e-39
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   155   7e-39
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   155   1e-38
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   154   2e-38
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   154   2e-38
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   151   2e-37
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   150   3e-37
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   150   3e-37
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   150   5e-37
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   149   1e-36
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   149   1e-36
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   143   8e-35
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   141   3e-34
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   140   6e-34
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   137   1e-32
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   134   6e-32
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   132   3e-31
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    34   1.8  
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    34   1.9  
Kpol_2000.89 s2000 complement(195405..197930) [2526 bp, 841 aa] ...    32   6.4  

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score = 1395 bits (3610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/716 (94%), Positives = 680/716 (94%)

Query: 1   MLQFLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNMSSLLSPKLAPSWDFAADEIV 60
           MLQFLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNMSSLLSPKLAPSWDFAADEIV
Sbjct: 1   MLQFLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNMSSLLSPKLAPSWDFAADEIV 60

Query: 61  SLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRD 120
           SLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRD
Sbjct: 61  SLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRD 120

Query: 121 ASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIHA 180
           ASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIHA
Sbjct: 121 ASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIHA 180

Query: 181 GMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVGVSETTLGQFEKVIE 240
           GMGLPEESRNKIKEIKKK            GEQNDYIAFTKDELVGVSETTLGQFEKVIE
Sbjct: 181 GMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFEKVIE 240

Query: 241 DGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIH 300
           DGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIH
Sbjct: 241 DGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIH 300

Query: 301 GHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYNG 360
           GHPTYASYQLEMKMAKKQETVFNFLY              ENLKSLKEQEYKELGLPYNG
Sbjct: 301 GHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELGLPYNG 360

Query: 361 SFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGK 420
           SFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGK
Sbjct: 361 SFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGK 420

Query: 421 NVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPV 480
           NVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPV
Sbjct: 421 NVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPV 480

Query: 481 TVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAP 540
           TVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAP
Sbjct: 481 TVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAP 540

Query: 541 SQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTV 600
           SQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTV
Sbjct: 541 SQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTV 600

Query: 601 HTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAA 660
           HTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIM          MWSEVFAA
Sbjct: 601 HTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMSGYSAGYYGYMWSEVFAA 660

Query: 661 DMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716
           DMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL
Sbjct: 661 DMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/733 (56%), Positives = 533/733 (72%), Gaps = 20/733 (2%)

Query: 2   LQFLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNM---------------SSLLSP 46
           +  LKR N    S T S L +PALA      +H+  R +               ++L+ P
Sbjct: 1   MLILKRANKF-CSTTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPP 59

Query: 47  KLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQL 106
           + APSW ++ ++I+ L  + I   +  +D++A +E P +E+ V   ++HE+ T   ++QL
Sbjct: 60  QAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQL 119

Query: 107 TFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPEL 166
           TFLQHVSADKEVRDAS +AT+L+Q++ IE S R+DL+ QF KVW+  KDD   KK   EL
Sbjct: 120 TFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFEL 179

Query: 167 YWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVG 226
           Y ++E  +KDY+ AG+ LPEE RN++KE++KK            GEQ +++AFT +EL G
Sbjct: 180 YKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDG 239

Query: 227 VSETTLGQFEKVIE-DGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQI 285
           VS + + QFEK  + DGVEK+K++FKYPDI PVL TAKNPETRKRA+ GDQNKVPQNE +
Sbjct: 240 VSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVL 299

Query: 286 LIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKS 345
            +ETL+LR+ELA + G+ TYA+Y L++KMAKKQETV  FL               E LKS
Sbjct: 300 FLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKS 359

Query: 346 LKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQK 405
           LKE++ KEL +P++  +  WD RYYD+KYLKEN++VDEE++++YFPL+ TI GML IY+ 
Sbjct: 360 LKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYET 419

Query: 406 LFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREGKYGHAANFG 464
           +  LKFVEET    K VWHEDVKQ AVW +DK  +PEFVGWIYFDLHPR+GKYGHAANFG
Sbjct: 420 VLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFG 479

Query: 465 LYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIG 524
           + S YV  +G R +PVT LVCNFSKPS+ +PALLKH E+ TFFHELGHGIH LVG + IG
Sbjct: 480 IASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIG 538

Query: 525 HLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAG 584
             NGP + PWDFVEAPSQMLEFW WNK+++  LS+HYETGE+IP++L+DSLI TKHVN  
Sbjct: 539 RFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGA 598

Query: 585 LSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXX 644
           L  LRQL F LFDMTVHT K+L+ LD+ SLWN+LR+EV+L+ NGD +TKG++SF HIM  
Sbjct: 599 LFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSG 658

Query: 645 X-XXXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGR 703
                    MW+EVFAADMYHT FA +PL+  VG RYRDI+L++GGL +I+D+L EFLGR
Sbjct: 659 AYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGR 718

Query: 704 EPNNKAFLKELGL 716
           EPNN+AFLKELGL
Sbjct: 719 EPNNEAFLKELGL 731

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/715 (54%), Positives = 512/715 (71%), Gaps = 12/715 (1%)

Query: 9   NILKN---SATVSFLLLPALAIAGNRSVHNQERNM---SSLLSPKLAPSWDFAADEIVSL 62
           N+L N    +  S +++P LA A  +   N  R++   +  + P+ APSW++  +E++  
Sbjct: 3   NVLANLRFKSATSLVVIPTLAFASFQ--FNAIRSIMTKTDFVVPQAAPSWNYTTEELLKQ 60

Query: 63  AQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDAS 122
             +AID   +  DS+ S+  P +ENFV   + HE+      +QLTFLQHVS+DKE+RD S
Sbjct: 61  THEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTS 120

Query: 123 IEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIHAGM 182
            + T+LI+ +GIE+S R+ L+ QF  VW Q KDD   KK+  E+Y ++E  +KD++ +G+
Sbjct: 121 TKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEKCHKDFLRSGL 180

Query: 183 GLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVGVSETTLGQFEKVIEDG 242
            LPEE R+K+KEIKKK            GEQN++I FTK+EL+GVSE  + QFE V EDG
Sbjct: 181 NLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDEDG 240

Query: 243 VEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGH 302
           + KYK+TFKYPDI PVL +AKN ETRKRA+IGDQNKVPQNE + +ETL+LRN+LAE+  +
Sbjct: 241 ITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNY 300

Query: 303 PTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYNGSF 362
            +YA Y L++KMAKK+E V  FL                 LK+LKE+E KEL  PY+  +
Sbjct: 301 DSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYDRRY 360

Query: 363 NSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNV 422
             WD RYYD++YLK+NF +DEE++A+YFPL+ TI GML IY+ +  LKF+EE      + 
Sbjct: 361 YIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEED---NGDT 417

Query: 423 WHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTV 482
           WH DVK+ +VW +D   P FVGWIYFDLHPREGKYGHAANFG+ S ++  +G+R YPVT 
Sbjct: 418 WHPDVKKLSVWKMDDNFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTA 477

Query: 483 LVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQ 542
           LVCNFSKP+  +PALLKH E+ TFFHELGHGIH LVG + IG  NGPS+ PWDFVEAPSQ
Sbjct: 478 LVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQ 537

Query: 543 MLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHT 602
           MLEFW WNK ++  LSKHY+T E+IPD L+DSL++TKH+N  L  LRQLHF LFDM VHT
Sbjct: 538 MLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHT 597

Query: 603 DKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXX-XXXXMWSEVFAAD 661
            K++ KL++  LWN+LREE+ LI NGD+ TKG++SF HIM           MW++VFA+D
Sbjct: 598 TKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASD 657

Query: 662 MYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716
           MY+T F  +PL++ VG +YRDIILA+GGL +IED+L EFLGR+PNNKAFLKELGL
Sbjct: 658 MYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/723 (54%), Positives = 511/723 (70%), Gaps = 7/723 (0%)

Query: 1   MLQFLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNMSS---LLSPKLAPSWDFAAD 57
           +L+   R       +  S + +PALAI   R    Q   MSS    ++P+ APSW F   
Sbjct: 2   LLRSCSRVAGFTRKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQ 61

Query: 58  EIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKE 117
            ++    + I+   +FYDS+A L  P +EN V   + HE+      SQLTF Q VSADKE
Sbjct: 62  SLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKE 121

Query: 118 VRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDE-NLKKNDPELYWYMENVNKD 176
           +RDAS++AT+ +Q +GIE S R+DL+ QF K+W + KD        + E+Y Y+E +++D
Sbjct: 122 IRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRD 181

Query: 177 YIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVGVSETTLGQFE 236
           Y   G+ LPE+ R+K+K++K K            GEQ +++AFTK+EL GVSE+ + QFE
Sbjct: 182 YTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFE 241

Query: 237 KVI-EDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNE 295
           +   E+G  KYK+TFKYPDI PVL TAKNP+TRK A+  DQ+KVPQNE++ +ETL+LRNE
Sbjct: 242 QFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNE 301

Query: 296 LAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELG 355
           LA+I G+ TYA+Y LE+KMAK Q+ V+ FL               ENLK +K++E + LG
Sbjct: 302 LADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLG 361

Query: 356 LPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEET 415
           LPY+G +  WD+RYYD+KYLK+N++VD E++++Y+P++ TI GML+IY+ L  LKFVEET
Sbjct: 362 LPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEET 421

Query: 416 RECGKNVWHEDVKQFAVWDLDK-CNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEG 474
               ++VWHEDVKQ AVW +D    PEFVGWIYFDLHPR+GKYGHAANFG+ + YV E+G
Sbjct: 422 DPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDG 481

Query: 475 TRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPW 534
           TR YPVT LVCNFSKPS+ +P+LLKH E+ TFFHELGHGIH LVG++R+   NGP ++PW
Sbjct: 482 TRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPW 541

Query: 535 DFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFS 594
           DFVEAPSQMLEFW WN+ ++ +LS HYE+GE+IP +L+ SLI TKHV+  L  LRQLHF 
Sbjct: 542 DFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFG 601

Query: 595 LFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMX-XXXXXXXXXM 653
           LFDM VHT K + KLD+  LWN LREEV+L+ NGD  TKGYDSF HIM           M
Sbjct: 602 LFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYM 661

Query: 654 WSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKE 713
           W+EVFAADMYHT FA +PLD+  G +YRDI+L +GGL +  D+L EFLGREP+ +AFLKE
Sbjct: 662 WAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKE 721

Query: 714 LGL 716
           LGL
Sbjct: 722 LGL 724

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/716 (53%), Positives = 519/716 (72%), Gaps = 12/716 (1%)

Query: 11  LKNSAT--VSFLLLPALAIAGNRSVHNQERNMSSLLSPKLAPSWDFAADEIVSLAQKAID 68
           LKN  T  VSF  +PA+A    +  ++   N S L++P+ AP+W++  + IV  A+  I 
Sbjct: 25  LKNRKTRIVSFFAVPAIAFTILK--YSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIK 82

Query: 69  EGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEATKL 128
           +  + +D++A++ +P +ENF+V  ++HE++    ++QLTFLQHVSADK++RD+S++AT+L
Sbjct: 83  DSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATEL 142

Query: 129 IQEWGIETSSRYDLYSQFSKVWEQYKDDENL-KKNDP---ELYWYMENVNKDYIHAGMGL 184
           IQ + IE S R DL+ QF K+W   KD+    +K+D    E Y ++E  +KD+I +G+ L
Sbjct: 143 IQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNL 202

Query: 185 PEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVGVSETTLGQFEKVIED--G 242
            +E R  +K+I+KK            GEQ ++IAFTK+EL GVS+  + QFEK  ++  G
Sbjct: 203 SDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTG 262

Query: 243 VEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGH 302
            EK+K+TFKYPDI PVL +AKNP TRK A+  DQNKVP+NE + ++TLKLRN+L+ +  +
Sbjct: 263 EEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDY 322

Query: 303 PTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYNGSF 362
             YA+Y LEMKMAK +ETVFNFL               E LK LKE++ KEL LPY+  +
Sbjct: 323 SNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELNLPYDNHY 382

Query: 363 NSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNV 422
             WD+RYYD+KYLK+NF+VD E++++Y+P++ +IDGML IY+ +  LKFVEET    +NV
Sbjct: 383 YIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNV 442

Query: 423 WHEDVKQFAVWDLDKCN-PEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVT 481
           WHEDVKQ +VW +D  + PEF+GWIYFDLHPR+GKYGHAANFG+ S YV E   R YPVT
Sbjct: 443 WHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVT 502

Query: 482 VLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPS 541
            LVCNFSKP+S +P+LLKH E+ TFFHELGHGIH LVG +R   LNGP S+PWDFVEAPS
Sbjct: 503 ALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPS 562

Query: 542 QMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVH 601
           QMLEFW WNK++++ LSKHY+TGE+IP+ L++SL+ TKHVN  L  LRQLHFS FDM VH
Sbjct: 563 QMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH 622

Query: 602 TDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMX-XXXXXXXXXMWSEVFAA 660
           T +++ KL++  LWN LRE++ L+ NGD ++KGYDSF HIM           MW+EVFA 
Sbjct: 623 TAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFAT 682

Query: 661 DMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716
           DMY+T FA +PL++  G  YRDIIL++GG+ ++ D+LEEFLGREPNN AFLKE+GL
Sbjct: 683 DMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/707 (54%), Positives = 516/707 (72%), Gaps = 7/707 (0%)

Query: 17  VSFLLLPALAIAGNRSVH--NQERNMSSLLSPK-LAPSWDFAADEIVSLAQKAIDEGTKF 73
           +S ++LPA A    R         N   L++P   AP+W ++ + I++  ++ ID  T  
Sbjct: 22  ISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDNATNL 81

Query: 74  YDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWG 133
           YDS+A++E P +E+ V   + +E++    ++QLTFLQHVSADK +RDAS+EAT+L+Q++ 
Sbjct: 82  YDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFS 141

Query: 134 IETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIK 193
           IE S R DL+ QF K+W Q KDD++LK  D E Y ++E V+KDY+  G+ LPEE RN++K
Sbjct: 142 IEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVK 201

Query: 194 EIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVGVSETTLGQFEKVIEDGV--EKYKMTFK 251
           +IKKK            GEQ +Y++FTK++L GVSE+ + QFEK ++     EKYK+TFK
Sbjct: 202 DIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFK 261

Query: 252 YPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLE 311
           YPDI PVL TA+ P+TRK AYI DQNKVPQNE + +ETLKLRN+LA++ G+ TYA+Y L+
Sbjct: 262 YPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLD 321

Query: 312 MKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYNGSFNSWDYRYYD 371
           +KMAK QETVF+F+               E LK+LK+++ +ELGL Y+  +  WD+RYYD
Sbjct: 322 IKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEELGLAYDDHYYIWDHRYYD 381

Query: 372 DKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFA 431
           +K+LK+N++VD E++++Y+PL+ TI GML IY+ L  LKFV+ET    K+VWHEDVKQ A
Sbjct: 382 NKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLA 441

Query: 432 VWDLD-KCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKP 490
           VW +D + NPEF+GWIYFDLHPR+GKY HAANFG+ S Y+T++G R +PVT LVCNFSK 
Sbjct: 442 VWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKS 501

Query: 491 SSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWN 550
           +  +P+LLKH E+ TFFHELGHGIH LVGK++    NGP + PWDFVEAPSQMLEFW WN
Sbjct: 502 TDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWN 561

Query: 551 KDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLD 610
           K+++L LS HY+TGE+I ++L+DSLI TKHVN  L  LRQLHF LFDMTVHT K ++ L+
Sbjct: 562 KNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLN 621

Query: 611 IKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXX-XXXXMWSEVFAADMYHTMFAP 669
           +  LWN LRE++ L+ NG+ LTKGYDSF HIM           MW+EVFAADMY+T FA 
Sbjct: 622 LLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFAS 681

Query: 670 NPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716
           +PL++  G +YRDI+LA GGL +I D L+EFLGREP N AFLKELGL
Sbjct: 682 DPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGL 728

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/715 (54%), Positives = 517/715 (72%), Gaps = 16/715 (2%)

Query: 8   FNILKNSATVSFLLLPALAIAGNRSVHNQERNMSSLLSP-KLAPSWDFAADEIVSLAQKA 66
            NI+++  T S    P   I  N +V+N+       ++P    P W +   +I+   +  
Sbjct: 36  INIIQSKRTYS----PNNIIMTNNTVNNKH----GFIAPANTVPDWTWTPKQILDETKSY 87

Query: 67  IDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEAT 126
           I++  K+Y+S++ +E+P +EN ++  +++E++    ++QLTFLQHVSADK++RDAS+EAT
Sbjct: 88  IEKTNKYYNSISEIESPSIENLIIPYMNYENKMGLLINQLTFLQHVSADKKIRDASLEAT 147

Query: 127 KLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDP-ELYWYMENVNKDYIHAGMGLP 185
           +L+++  I TS R++++ QF KVWE  ++D++  KN   E Y ++E ++KD +  G  L 
Sbjct: 148 RLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKNHQFETYKFIEKIHKDSLRNG--LK 205

Query: 186 EESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVGVSETTLGQFEKVIEDGV-- 243
            E   ++K IK K            GEQN+Y++FTK+EL GVSET + QFEK I+     
Sbjct: 206 SERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNE 265

Query: 244 EKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHP 303
           +KYK+TFKYPDI PVL TAKNP+TRK A++GDQNKVP+NE++L   LKLR ELA   G+ 
Sbjct: 266 KKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYS 325

Query: 304 TYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYNGSFN 363
           TYA+Y L++KMAK QETV  FL               + LK LK++E +ELG+PY+G + 
Sbjct: 326 TYANYNLDIKMAKNQETVLKFLNDLKEKLKPLAEKEIKILKDLKKKECEELGIPYDGHYY 385

Query: 364 SWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVW 423
            WD+RYYD+KYLK+NF+VD E++++Y+PL+ TIDGML IY+ + NLKF+EET    KNVW
Sbjct: 386 IWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVW 445

Query: 424 HEDVKQFAVWDLD-KCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTV 482
           H DVKQ +VW++D + NP FVGWIYFDL+PR+GKYGHAANFG+ S Y+TEE  R YPVT 
Sbjct: 446 HPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASSYITEENKRSYPVTA 505

Query: 483 LVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQ 542
           LVCNFSKP+  +PALLKH E+ TFFHELGHGIH LVG+++    NGP S+PWDFVEAPSQ
Sbjct: 506 LVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQ 565

Query: 543 MLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHT 602
           MLEFW WNK+++L LSKHY+TGE+IP++L+DSLI TKHVN  L  LRQLHF LFDMTVHT
Sbjct: 566 MLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVHT 625

Query: 603 DKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXX-XXXXMWSEVFAAD 661
            K+++ LD+  LWN  REE+ L+ NG+  TKGY+SF HI+           MW+EVFAAD
Sbjct: 626 TKDIENLDLLKLWNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAAD 685

Query: 662 MYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716
           MYHT FAPNPLD SVG +YRD+ILAKGGL +I D+L EFLGREP+NK FLKELGL
Sbjct: 686 MYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDNLLEFLGREPSNKPFLKELGL 740

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/686 (55%), Positives = 493/686 (71%), Gaps = 13/686 (1%)

Query: 44  LSPKLAP------SWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHED 97
           +SP+L P       W+F + +I   A + I+   KFYD +  +  P ++N V   ++HE+
Sbjct: 57  MSPQLVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHEN 116

Query: 98  ETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDE 157
                ++QL FLQHVS+DKE+R+AS +AT+L+Q + IETS R+DL+ QF K+W++ K  +
Sbjct: 117 SIGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRK 176

Query: 158 NLKKNDPE---LYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQN 214
               +D E   +Y ++E  +KD++ AG+ L EE RNK+K+IK K            GEQ 
Sbjct: 177 EEFSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQK 236

Query: 215 DYIAFTKDELVGVSETTLGQFEKVIEDGVEK--YKMTFKYPDIHPVLNTAKNPETRKRAY 272
           +++ F+K++L GVS+T + QFE+V ++   +  YK+TFKYPDI PVL  AKN ETRK A+
Sbjct: 237 EFLLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAF 296

Query: 273 IGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXX 332
            GDQNKVPQNE++ + TLKLR+ELA + G+ TYA+Y LE+KMAKKQ TVF FL       
Sbjct: 297 CGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKL 356

Query: 333 XXXXXXXXENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPL 392
                     LKS+KE E KELG+P++G +  WD+RYYD KYLK+NF+VD E +A+Y+P+
Sbjct: 357 KPLGEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPI 416

Query: 393 QHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLH 451
             TI+GML IY+ +F LKFVEE     KNVW+EDVKQ AVW +D    P FVGWIYFDLH
Sbjct: 417 DSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLH 476

Query: 452 PREGKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELG 511
           PR+GKYGHAANFG+ S Y+ E+G+R YPVT LVCNFSK S+T+P+LLKH E+ TFFHELG
Sbjct: 477 PRDGKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELG 536

Query: 512 HGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDEL 571
           HGIH LVGK+R    NGP + PWDFVEAPSQMLEF+ W+K+ +  LSKHY+TGEQIP++L
Sbjct: 537 HGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKL 596

Query: 572 VDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVL 631
           +DSLI TKHVN  L  LRQLHF LFDMTVHT K++  LD+  LW +LR+E++L+ NG   
Sbjct: 597 LDSLIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQY 656

Query: 632 TKGYDSFSHIMX-XXXXXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGL 690
           TKGYDSF HIM           MW+EVFA DMY T FAPNPLD+SVG +YRDI+LA GGL
Sbjct: 657 TKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGL 716

Query: 691 RDIEDSLEEFLGREPNNKAFLKELGL 716
            +I+D+L+EFLGREP+  AFLKELGL
Sbjct: 717 YEIDDNLKEFLGREPSKDAFLKELGL 742

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/726 (52%), Positives = 515/726 (70%), Gaps = 23/726 (3%)

Query: 14  SATVSFLLLPALAIA-------GNR--SVHNQERNMSSLLSPKLAPSWDFAADEIVSLAQ 64
           S  +S + +PA+AI        G R  +    + N ++ ++P+L+P WDF+ + I+S A+
Sbjct: 21  SILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSPERILSDAK 80

Query: 65  KAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDASIE 124
           K ID    FY+++ ++E P +ENFV+  I+ E+E    ++QLTFLQHVS DK +RDAS+E
Sbjct: 81  KIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLE 140

Query: 125 ATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDE---NLKKNDP---ELYWYMENVNKDYI 178
           AT+LI  + IE S RYD++ QF K++   KD++   +LK   P   E++ Y+E  +KDY+
Sbjct: 141 ATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHKDYV 200

Query: 179 HAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVGVSETTLGQFEKV 238
            +G+ L EE RN+IKEIKK+            GEQN+++AFTK+EL GVS+  + QFE  
Sbjct: 201 RSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETY 260

Query: 239 IED--GVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNEL 296
            ++  G +K+K+TFKYPDI PVL TAKNP TRK A+  DQNKVP+NE++ I+TLKLR +L
Sbjct: 261 TDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQL 320

Query: 297 AEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGL 356
            +I G+ TYA+Y L++KMAK QETV  FL               E LK++K+ E +EL +
Sbjct: 321 GKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNM 380

Query: 357 PYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETR 416
            Y+  +  WD+RYYD+KYLK+ F+VD E++++Y+P++ TI GML IY+ + NLKF+EET 
Sbjct: 381 AYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETD 440

Query: 417 ECGKNVWH-EDVKQFAVWDLDK-CNPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEG 474
           +  K+ W  +DVKQ AVW +D    PEFVGWIYFDLHPREGKYGHAANFG+   Y+ ++ 
Sbjct: 441 KDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDS 500

Query: 475 TRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPW 534
            R YPVT LVCNFS  ++ +PALLKH E+ TFFHELGHGIH LVG + IG  NGP ++PW
Sbjct: 501 KRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPW 560

Query: 535 DFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFS 594
           DFVEAPSQMLEFW WNK+++L LSKHY+TGE+IP+ L++SLI TKHVN  L  LRQLHF 
Sbjct: 561 DFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFG 620

Query: 595 LFDMTVHT---DKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXX-XX 650
           LFDM VHT   D ++D +D+  LWN LREE++L+ NGD + KGYDSF HIM         
Sbjct: 621 LFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYY 680

Query: 651 XXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAF 710
             MW+EVFA DMY++ FA +PL+T  G  YRDIILA+GG+R+  D+L+EFLGREP+ +AF
Sbjct: 681 GYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAF 740

Query: 711 LKELGL 716
           LKELGL
Sbjct: 741 LKELGL 746

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/683 (55%), Positives = 503/683 (73%), Gaps = 8/683 (1%)

Query: 42  SLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDG 101
           +L +P+ AP+W++   ++V  A+  ID+   FYD++ +L++PD  NF+V  +++E++   
Sbjct: 58  NLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGS 117

Query: 102 YMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKK 161
            ++QLTFLQHVS++K++RDAS +AT L+Q + IETS RY L+ QF K+W Q KD ++  +
Sbjct: 118 LINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYE 177

Query: 162 NDP---ELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIA 218
            DP   E Y ++  V++D++ AG+ L E  R KIKEIKK             GEQ +++A
Sbjct: 178 KDPKDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVA 237

Query: 219 FTKDELVGVSETTLGQFEKVIED--GVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQ 276
           FTK+EL GVS++ + QFEK  ++  G E YK+TFKYPDI PVL TA+NPETRK+A+ GDQ
Sbjct: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297

Query: 277 NKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXX 336
           NKV +N  +   TLKLRN+LA+I G+ TYA+Y LE+KMAK Q++VF FL           
Sbjct: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357

Query: 337 XXXXENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTI 396
               E LKS+KE+E+KEL LP++  +  WD+RYYD+KYLK+N++VD E++++Y+PL  TI
Sbjct: 358 SKEIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTI 417

Query: 397 DGMLNIYQKLFNLKFVEETREC-GKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPRE 454
           +GMLNIY+ L NLKF+EE  +   KNVWH++VKQ AVW +D   NPEFVGWIYFDLHPR+
Sbjct: 418 EGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRD 477

Query: 455 GKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGI 514
           GKYGHAANFG+ S Y+     R YPVT LVCNFSK ++ +PALLKH E+ TFFHELGHGI
Sbjct: 478 GKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGI 537

Query: 515 HALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDS 574
           H LVGK+     NGP ++PWDFVEAPSQMLEFW WNK+++L LSKHY+TGE+IP EL++S
Sbjct: 538 HDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNS 597

Query: 575 LIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKG 634
           L+ TKHVN  L  LRQLHF LFDM VHT K+L+ LD   LWN LREEV+L+ NGD+ TKG
Sbjct: 598 LVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKG 657

Query: 635 YDSFSHIMXXXXXX-XXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDI 693
           YDSF HIM           MW+EVFA DMY+T FA NPL+T VG  YRD +LA+GGL +I
Sbjct: 658 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEI 717

Query: 694 EDSLEEFLGREPNNKAFLKELGL 716
           ED+L +FLGR+P+N+AFLKELGL
Sbjct: 718 EDNLIQFLGRKPSNEAFLKELGL 740

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/724 (54%), Positives = 513/724 (70%), Gaps = 12/724 (1%)

Query: 1   MLQFLKRFNILKNSATVSFLLLPALA-IAGNRSVHNQERNMSSLLSPKLAPSWDFAADEI 59
           ML  L R  I    + +S + +PA + +  NR   N    +S+ ++P+ APSW++    +
Sbjct: 1   MLNRLSRLVIPSRKSFLSLVCIPATSYLVYNRLYSNM--TISAFIAPQAAPSWNWNPSRL 58

Query: 60  VSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVR 119
           +  A+  ID   + YD ++SL+ P +EN V   + HE++    +++L FLQHVS D ++R
Sbjct: 59  LFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIR 118

Query: 120 DASIEATKLIQEWGIETSSRYDLYSQFSKVWEQY--KDDENLKKNDPELYWYMENVNKDY 177
           +AS++AT+L+Q++ IE S R+DL+ QF K+W++   K D+ +K+ D E + ++E V+KDY
Sbjct: 119 EASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDY 178

Query: 178 IHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDELVGVSETTLGQFEK 237
           + +G+ LPE+ R KIKEIK K            GEQ + IAFT++EL GVS+    QFEK
Sbjct: 179 VRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEK 238

Query: 238 VI--EDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNE 295
            I  E G EK+K+TFKYPDI PVL TAKNPETR++A++ DQNKVPQNE + +ETLKLRNE
Sbjct: 239 FIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNE 298

Query: 296 LAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELG 355
           LA    + TYA+Y LE KMAK+QETV +FL                 LK +K++E KEL 
Sbjct: 299 LATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELN 358

Query: 356 LPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEET 415
             Y+  +  +D+RYYD+KYLK+NF+VD E +++Y+PL+HTI+GML IY++LF LKF EET
Sbjct: 359 REYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET 418

Query: 416 RECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREGKYGHAANFGLYSPYV-TEE 473
           +   K+VWHEDVKQ AVW +D    PEFVGWIYFDLHPR+GKYGHAANFG+ S YV  E 
Sbjct: 419 K--NKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIET 476

Query: 474 GTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIP 533
           G R YPVT LVCNFSK ++TRP+LLKH E+ TFFHELGHGIH LVGK+++   NGP + P
Sbjct: 477 GKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATP 536

Query: 534 WDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHF 593
           WDFVEAPSQMLEFW WN +++  LS HYE+ E+IPD+L+ SLIKTKHVN  L  LRQLHF
Sbjct: 537 WDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHF 596

Query: 594 SLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXX-XXXX 652
            LFDMTVHT   ++ L++  LWN LREE+ L+  G  L+KGYDSF HIM           
Sbjct: 597 GLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGY 656

Query: 653 MWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLK 712
           MW+EVFAADMYHT F+PNPLD+ VG +YRDI+LA GGL +I D+L +FLGREP+  AFLK
Sbjct: 657 MWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLK 716

Query: 713 ELGL 716
           ELGL
Sbjct: 717 ELGL 720

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/684 (54%), Positives = 495/684 (72%), Gaps = 9/684 (1%)

Query: 39  NMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDE 98
           NM SL  P+  PSW+F  ++I+S  ++ I     FYD + +++ P +EN +V  I+HE+E
Sbjct: 62  NMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENE 121

Query: 99  TDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDEN 158
            +  ++QLTFLQHVS DK +RDAS+EAT L+Q++ IE+ SR DL+ QF  +W Q KD ++
Sbjct: 122 NELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKD 181

Query: 159 LKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIA 218
            +  D E++ ++E  +KDY+ AG+ LP +   K+KEIKKK            GEQ +YI 
Sbjct: 182 -EFEDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYIL 240

Query: 219 FTKDELVGVSETTLGQFEKVIED-GVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQN 277
           FT +EL GV E+ + QFEKV ++ G++K K+T+KYPDI PVL  A+NPETR +A++GDQN
Sbjct: 241 FTAEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQN 300

Query: 278 KVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXX 337
           KVP+NE +  +TLKLRNELA + G+ TYA+Y L++KMAK  +TV +F+            
Sbjct: 301 KVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAK 360

Query: 338 XXXENLKSLKEQEYK-ELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTI 396
              + LK+LK+QE++ E  + Y+G +  WD+RYYD+KYLKENF+VDEE++A+Y+PL+ TI
Sbjct: 361 KELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTI 420

Query: 397 DGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREG 455
           DGML IY+ L  LKFVE      K  WH+DVKQ AVW LD   NPEFVGWI+FDLHPR+G
Sbjct: 421 DGMLKIYETLLKLKFVEVKE--NKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDG 478

Query: 456 KYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIH 515
           KYGHAANFGL S Y++  GTR YP+T LVCNFSK +  +P+LLKH E+ TFFHELGHGIH
Sbjct: 479 KYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIH 538

Query: 516 ALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSL 575
            LVG +RIG  NGP ++PWDFVEAPSQMLEFW WN  ++L LS++Y+   +I  +L++SL
Sbjct: 539 DLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESL 598

Query: 576 IKTKHVNAGLSNLRQLHFSLFDMTVH--TDKELDKLDIKSLWNNLREEVTLISNGDVLTK 633
           IKTKHVN  L  LRQLHF LFDM VH  + +ELDKLDIK LWN+LRE++ LISNGD  T 
Sbjct: 599 IKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTT 658

Query: 634 GYDSFSHIMX-XXXXXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRD 692
           GY+SF HIM           MW+EVFA DMY+T F  +PL+  VG +YRDI+LA+GGL +
Sbjct: 659 GYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYE 718

Query: 693 IEDSLEEFLGREPNNKAFLKELGL 716
           I+D+LEEFLGR+P   AFL+ELGL
Sbjct: 719 IDDNLEEFLGRKPAKDAFLEELGL 742

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/680 (52%), Positives = 476/680 (70%), Gaps = 2/680 (0%)

Query: 38  RNMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHED 97
           ++++SL+ P+ APSW+F+A +++SL+ + I++    Y +V   + P ++N+++ +I HE+
Sbjct: 2   KDLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEE 61

Query: 98  ETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDE 157
           ETD   +QL FL++VS D E+R+AS  AT ++ +W I  +S+YDLY  F +VW QYKDDE
Sbjct: 62  ETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDE 121

Query: 158 NLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYI 217
             KK + ELY YME     Y  +GM +P E+R ++ E+K K            GE+ +YI
Sbjct: 122 KFKKENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYI 181

Query: 218 AFTKDELVGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQN 277
           AFTK+EL GV +T L QFEK+IE GVEK+K+TFKYPDI PVL  A NPETR+RA + D+N
Sbjct: 182 AFTKEELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADEN 241

Query: 278 KVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXX 337
           +V  NE +L ETL+LR ELA++ G   +A+Y L+ KMAK +ETV  FL            
Sbjct: 242 RVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGK 301

Query: 338 XXXENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTID 397
              E LK  K ++YK   L ++G F SWD  YY +K L+E ++V+ ++LA+YFP++  I+
Sbjct: 302 NDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIE 361

Query: 398 GMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDL-DKCNPEFVGWIYFDLHPREGK 456
           GMLNIY  LF LKFVE T EC K+VWHEDVKQFAVW++ D+ NP+F GW+YFDLHPR+GK
Sbjct: 362 GMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGK 421

Query: 457 YGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHA 516
           YGHAANFG+ S Y   +G++ YPVT+LV NFSKP+ TRPALLK GE+ TFFHELGHGIH 
Sbjct: 422 YGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHD 481

Query: 517 LVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLI 576
           LVG + +  LNGP S+PWDFVEAPSQMLE+W   +D +  LSKHYETGE+IP  L+D+  
Sbjct: 482 LVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWF 541

Query: 577 KTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYD 636
               +N+GL+NL QL   LFDM VHT ++    +++ LWN+L  E+ L++  +  + GYD
Sbjct: 542 SVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYD 600

Query: 637 SFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDS 696
           SF HIM          +WS+VFAADMY T F PNP + +VG  YRD ILA GGL D+ D+
Sbjct: 601 SFGHIMAGYAAGYYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDN 660

Query: 697 LEEFLGREPNNKAFLKELGL 716
           L +FLGR+PNNKAFL+ LGL
Sbjct: 661 LRKFLGRDPNNKAFLRGLGL 680

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/678 (52%), Positives = 478/678 (70%), Gaps = 9/678 (1%)

Query: 45  SPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMS 104
           +P+  PSW F  ++I    ++ I++  KFYDS++ +E+P + NFV   +  E+E    ++
Sbjct: 36  APQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIIN 95

Query: 105 QLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDP 164
           QLTFLQHVS+DKE+RDAS++++  + E  I+ S R+D++ QF++VW+  +   +    + 
Sbjct: 96  QLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQAD--SIER 153

Query: 165 ELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTKDEL 224
           E + Y+E   KDYIH+G+ L E  R K+KEIKKK            GEQ ++I FTK++L
Sbjct: 154 ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQL 213

Query: 225 VGVSETTLGQFEKVIEDGVEK----YKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVP 280
            GV ++ L QFE  IE G +     YK+TFKYPDI PV+  A + +TRK+A++ DQNKV 
Sbjct: 214 EGVPDSILAQFE-TIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVS 272

Query: 281 QNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXX 340
           +NE IL++TLKLR+E+A + G+ TYA+Y L  KMAK   TV +FL               
Sbjct: 273 ENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKEL 332

Query: 341 ENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGML 400
           + L+ +K ++ K+     + ++  WD+RYYD+KYL ENF+VD E+++++FPL+ TI GML
Sbjct: 333 QILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGML 392

Query: 401 NIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREGKYGH 459
            IY+ LFNLKF+E      K+VWHEDVKQ AVW++D   +P F+GWIYFDLHPR+GKYGH
Sbjct: 393 QIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGH 452

Query: 460 AANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVG 519
           AANFGL S ++  + TR YPVT LVCNFSK +  +P+LLKH E+VTFFHELGHGIH LVG
Sbjct: 453 AANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVG 512

Query: 520 KSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTK 579
           +++    NGP S+PWDFVEAPSQMLEFW WNK++++ LS HY+TGE+IP+ L+DSLIKTK
Sbjct: 513 QNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTK 572

Query: 580 HVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFS 639
           HVN  L  LRQLHF LFDM VH+ K+L  L I   WN LR++++L+SNG  L+KGY SF 
Sbjct: 573 HVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFG 632

Query: 640 HIMXXXXXX-XXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLE 698
           HIM           +W+EVFA DMYHT FA +PL+T  G +YRDI+LA+GGLRDI DSL+
Sbjct: 633 HIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLK 692

Query: 699 EFLGREPNNKAFLKELGL 716
           EFLGREP+  AFLKELGL
Sbjct: 693 EFLGREPSKDAFLKELGL 710

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/693 (52%), Positives = 485/693 (69%), Gaps = 11/693 (1%)

Query: 31  RSVHNQERNMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVV 90
           RS+++     S  ++P+  P+W F  ++I    ++ ID+   FY+S++++ETP + NFV 
Sbjct: 22  RSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVE 81

Query: 91  AVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVW 150
             +  E+E    ++QLTFLQHVS+DKE+RDAS+ ++  + E  I+ S R+D+Y QF++VW
Sbjct: 82  PFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVW 141

Query: 151 E--QYKDDENLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXX 208
           +  Q K D   +    E + Y+E   KDYIH+G+ L E +R KIK+IKKK          
Sbjct: 142 QDAQSKSDSIER----ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSK 197

Query: 209 XXGEQNDYIAFTKDELVGVSETTLGQFEKVIEDGVEK---YKMTFKYPDIHPVLNTAKNP 265
             GEQ +YI FTK++L GV ++ L QFE +  D       YK+TFKYPDI PV+  A + 
Sbjct: 198 NLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSA 257

Query: 266 ETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFL 325
           +TRK A++ DQNKVP+NE IL++TL+LR++LA + G+ TYA+Y L  KMAK   TV +FL
Sbjct: 258 QTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFL 317

Query: 326 YXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEE 385
                          E L+ +K ++ K+L    + ++  WD+RYYD+KYL ENF+VD E+
Sbjct: 318 NDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEK 377

Query: 386 LAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVG 444
           +++YFPL+ TI GML IY+ LFNLKF+E      K+VWH+DVKQ AVW++D   +P+FVG
Sbjct: 378 ISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVG 437

Query: 445 WIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVV 504
           WIYFDLHPR+GKYGHAANFGL S ++T +  R YPVT LVCNFSK +  +P+LLKH E+V
Sbjct: 438 WIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIV 497

Query: 505 TFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETG 564
           TFFHELGHGIH LVG+++    NGP S+PWDFVEAPSQMLEFW WNK++++ LS HYETG
Sbjct: 498 TFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETG 557

Query: 565 EQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTL 624
           E+IP+ L+DSLIKTKHVN  L  LRQLHF LFDM VHT K+L  L I   WN LR++++L
Sbjct: 558 EKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISL 617

Query: 625 ISNGDVLTKGYDSFSHIMXXXXXX-XXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDI 683
           ISNG  L+KGYDSF HIM           +W+EVFA DMYHT FA +PL+T  G +YRDI
Sbjct: 618 ISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDI 677

Query: 684 ILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716
           +LA+GGL DI D L++FLGREP+  AFLKELGL
Sbjct: 678 VLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/691 (51%), Positives = 481/691 (69%), Gaps = 7/691 (1%)

Query: 31  RSVHNQERNMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVV 90
           RS+++     S  ++P+  P+W F   +I     + I+    FYDS++ +E+P + NFV 
Sbjct: 22  RSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVE 81

Query: 91  AVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVW 150
             +  E+E    ++QLTFLQHVS+DKE+RDAS+ ++  + E  I+ S R+D++ QF++VW
Sbjct: 82  PFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVW 141

Query: 151 EQYKDDENLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXX 210
           +  +   +    + E + Y+E   KDYIH+G+ L E +R KIKEIKKK            
Sbjct: 142 QDVQSKAD--SVERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNL 199

Query: 211 GEQNDYIAFTKDELVGVSETTLGQFEKVIEDGVEK---YKMTFKYPDIHPVLNTAKNPET 267
           GEQ +YI FTK++L GV ++ L QFE +  D       YK+TFKYPDI PV+  A + +T
Sbjct: 200 GEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQT 259

Query: 268 RKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYX 327
           RK+A++ DQNKVP+NE IL++TLKLR+ELA + G+ TYA+Y L  KMA+   TV NFL  
Sbjct: 260 RKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLND 319

Query: 328 XXXXXXXXXXXXXENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELA 387
                        + L+ +K ++ K+L    + ++  WD+RYYD+KYL ENF+VD E+++
Sbjct: 320 LKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKIS 379

Query: 388 KYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWI 446
           +YFPL+ TI GML IY+ LFNLKF+E      K+VWH+DVKQ AVW++D   +P FVGWI
Sbjct: 380 EYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWI 439

Query: 447 YFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTF 506
           YFDLHPR+GKYGHAANFGL S ++ ++ TR YPVT LVCNFSK +  +P+LLKH E+VTF
Sbjct: 440 YFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTF 499

Query: 507 FHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQ 566
           FHELGHGIH LVG+++    NGP S+PWDFVEAPSQMLEFW WNK++++ LS HY+TGE+
Sbjct: 500 FHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEK 559

Query: 567 IPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLIS 626
           IP+ L++SLIKTKHVN  L  LRQLHF LFDM VHT K+L  L I   WN LR++++LIS
Sbjct: 560 IPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLIS 619

Query: 627 NGDVLTKGYDSFSHIMXXXXXX-XXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIIL 685
           NG  L+KGYDSF HIM           +W+EVFA DMYHT FA +PL+   G +YRDI+L
Sbjct: 620 NGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVL 679

Query: 686 AKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716
           A+GGL DI D+L+EFLGREP+  AFLKELGL
Sbjct: 680 ARGGLYDINDNLKEFLGREPSKDAFLKELGL 710

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/680 (52%), Positives = 478/680 (70%), Gaps = 11/680 (1%)

Query: 44  LSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYM 103
           ++P+  P+W F   +I     + ID+  KFY+ ++ +E+P + NF+   +  E+E    +
Sbjct: 35  IAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPII 94

Query: 104 SQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWE--QYKDDENLKK 161
           ++LTFLQHVS+DKE+RDAS++++  + E  I+ S R+D++ QF++VW+  Q K D +LKK
Sbjct: 95  NRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKAD-SLKK 153

Query: 162 NDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFTK 221
              E + Y+E   KD+IH+G+ L E +R KIKEIKKK            GEQ +YI FTK
Sbjct: 154 ---ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTK 210

Query: 222 DELVGVSETTLGQFEKV-IEDGVEK--YKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNK 278
           ++L GV ++ L QFE    E G E   YK+TFKYPDI PV+  A + +TRK+A++ DQNK
Sbjct: 211 EQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNK 270

Query: 279 VPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXX 338
           VP+NE IL++TLKLR+ELA + G+ TYA Y L  KMAK   TV +FL             
Sbjct: 271 VPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKK 330

Query: 339 XXENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDG 398
             + L+ +K ++ +      + ++  WD+RYYD+K+L ENF+VD E++++YFPL+ TI G
Sbjct: 331 ELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITG 390

Query: 399 MLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREGKY 457
           ML IY+ LFNLKF+E      K+VWHEDVKQ AVW++D   +P F+GWIYFDLHPR+GKY
Sbjct: 391 MLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKY 450

Query: 458 GHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHAL 517
           GHAANFGL S ++  +  R YPVT LVCNFSK +  +P+LLKH E+VTFFHELGHGIH L
Sbjct: 451 GHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDL 510

Query: 518 VGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIK 577
           VG+++    NGP S+PWDFVEAPSQMLEFW WNK++++ LS HY+TGE+IP+ L+DSLIK
Sbjct: 511 VGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIK 570

Query: 578 TKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDS 637
           TKHVN  L  LRQLHF LFDM VHT K+L+ L I   WN LR+E++L+ NG  L+KGYDS
Sbjct: 571 TKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDS 630

Query: 638 FSHIMXXX-XXXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDS 696
           F HIM           +W+EVFA DMYHT FA +PL+T  G +YRDI+LA+GGL DI D+
Sbjct: 631 FGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDN 690

Query: 697 LEEFLGREPNNKAFLKELGL 716
           L+EFLGREP+  AFLKELGL
Sbjct: 691 LKEFLGREPSKDAFLKELGL 710

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/679 (47%), Positives = 446/679 (65%), Gaps = 6/679 (0%)

Query: 42  SLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETP-DLENFVVAVIDHEDETD 100
           SL+ P+  P W++ A E++ LA     +    Y+SV S +    L+N++  ++ ++ ETD
Sbjct: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70

Query: 101 GYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLK 160
              +QL FL++VS D +VR+AS+   K++ +W    SS+YDLY+ F  +W QYKDDE  K
Sbjct: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130

Query: 161 KNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXGEQNDYIAFT 220
             + ELY YME     Y      L      ++ ++ +K            GE+ +YI FT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 221 KDELVGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVP 280
           ++EL GVS   L QFE++IE GV+K K+TFKYPDI PVL TA NPETR++AY+ DQN+V 
Sbjct: 191 EEELEGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVA 250

Query: 281 QNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXX 340
            NEQ+L ETL LR  +A++ G+  YA Y L  KMAK +ETV  FL               
Sbjct: 251 ANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDR 310

Query: 341 ENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGML 400
           E LKS K ++YK   L ++G   +WD  YY++K L+E + +D E++A+YFP++  I+GML
Sbjct: 311 EILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGML 370

Query: 401 NIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLD--KCNPEFVGWIYFDLHPREGKYG 458
           + YQ LF LKFVE T    KNVWHEDVKQFAVW++D   C PEF GWIYFDL+PR+GKY 
Sbjct: 371 DTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDC-PEFQGWIYFDLYPRDGKYS 429

Query: 459 HAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALV 518
           HAANFG+ S +  ++G++ YPVTVLVCN +KP+ TR A+L+ GE+ T FHELGHGIH LV
Sbjct: 430 HAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLV 489

Query: 519 GKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKT 578
             +++   N   S+PWDFVEAPSQMLE+W   +D +  LSKHYETGE+IP  L+D+   +
Sbjct: 490 ANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNS 549

Query: 579 KHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSF 638
             + +GL  L QL   LFDM VHT +E   L+++ LWN++R E++LI++ +  + GY++F
Sbjct: 550 SGLGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTF 608

Query: 639 SHIMX-XXXXXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSL 697
            HIM           +WS+VFAADMY T F  NP +++VG +YRD ILA GGL D+ D+L
Sbjct: 609 GHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNL 668

Query: 698 EEFLGREPNNKAFLKELGL 716
            +FLGREPNN+AFL+ LG 
Sbjct: 669 RKFLGREPNNRAFLRGLGF 687

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  397 bits (1021), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 212/413 (51%), Positives = 269/413 (65%), Gaps = 7/413 (1%)

Query: 306 ASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYNGSFNSW 365
           A+Y LE+K AK  + V +FL                 LK LKEQE KELG  Y+G   S 
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 366 DYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHE 425
           D  YY+ K L++NF VDEEE A+YFPL+HTI  ML+ Y  LF   FVEET    +NVWHE
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 426 DVKQFAVWDLDKCN-PEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTVLV 484
           D KQ++VW +D  + P+F GW+YFDLHPR+GK+GH A F      ++EEG+R YPVT LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 485 CNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQML 544
           CNFS PS  +PALLKH EV  FFHELGHG H L+    +      S +P DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPEL--CCSSSWVPRDFIEAPSQML 286

Query: 545 EFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTD- 603
           E+W W KD I  LSKH ETGE+IP+ LVD ++K+K  NA + NL Q+  +L DM VH   
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKHV 344

Query: 604 KELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMY 663
              + LD+ +LWNNL E+V LI N +  T+ Y SFSHI+           WS+VFAADMY
Sbjct: 345 GSYETLDLNALWNNLCEDVILIKNPEP-TRAYCSFSHIVEGYAAGYYGYQWSKVFAADMY 403

Query: 664 HTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716
            + F    LD ++G  Y D I+A+GGL ++ED+L EFL REPNN+A+L++ GL
Sbjct: 404 FSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 28/47 (59%)

Query: 40 MSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLE 86
          MS++  P+ APSWD +  +I    Q A++   + +  +A+++ P +E
Sbjct: 1  MSTVKIPQPAPSWDLSPAQINDKVQTALESAARMFAELANVKLPTVE 47

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  171 bits (434), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 144/520 (27%), Positives = 247/520 (47%), Gaps = 59/520 (11%)

Query: 212 EQNDYIAFTKDELVGVSETTLGQFEKVIEDGVEKYKM-TFKYPDIHPVLNTAKNPETRKR 270
           + N  ++  + + +G+    L Q EK I    + YK+ T+ Y     +L +  + E R++
Sbjct: 257 DNNVVVSCNQLDSLGIDPELLSQIEKDIAG--KNYKIPTYGYIPF-ALLKSCPSEEIREK 313

Query: 271 AYIGDQNKVPQNEQI--LIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXX 328
            ++   N    NEQI  L + +KLR  L+++ G  +YA YQLE KMAK  + V  F+   
Sbjct: 314 IWVAVHN--CSNEQIKRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFI--- 368

Query: 329 XXXXXXXXXXXXENLKSLKEQEYKELGLPYNGS----------FNSWDYRYYD----DKY 374
                       + L  + E   K+L +  NGS             WD  YY     ++ 
Sbjct: 369 KTLMDFTKPMAAKELDGIAE---KKLTIKSNGSNLSVCDILKTVRPWDRDYYSAIEREQT 425

Query: 375 LKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWD 434
             +N     EE+ KYF L + + G+ N++QK++ +K   +  + G+  W  +V++  V  
Sbjct: 426 SAKNL-YGSEEVLKYFTLGNVMQGLSNLFQKIYGIKLELDVPKIGE-TWSPEVRKINVIS 483

Query: 435 LDKCNPEFVGWIYFDLHPREGKYGHAANFGLY-----SPYVTEE----------GTR-HY 478
            D+     +G IY DL  R GK  +AA+F +      SPY TE+          GTR   
Sbjct: 484 EDE---GLIGIIYCDLFERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQL 540

Query: 479 PVTVLVCNFSKP--SSTRPALLKH-GEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWD 535
           P+  LVCNFSK   S T      H  EV T FHE+GH +H+++G++++ +++G +    D
Sbjct: 541 PIISLVCNFSKTMISETDSVCFLHLPEVETLFHEMGHAMHSMLGRTKLQNISG-TRCATD 599

Query: 536 FVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSL 595
           FVE PS ++E++  +   +  + KHY T E +  E+++  ++            Q   ++
Sbjct: 600 FVELPSILMEYFARDPRVLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAM 659

Query: 596 FDMTVHTD---KELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXX 652
            D T+H +     LD LD+  L+ +L  ++ ++   D  +     F H+           
Sbjct: 660 LDQTLHGETISSHLDHLDVVKLYQDLERQLGVLV--DDKSNWCGKFGHLF-GYSAVYYSY 716

Query: 653 MWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRD 692
           ++    A+ ++  +F  NP   + G +YR+ +L  GG RD
Sbjct: 717 LFDRAIASKIWGALFERNPFSRASGDKYRNSVLQWGGSRD 756

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  159 bits (403), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 130/534 (24%), Positives = 236/534 (44%), Gaps = 49/534 (9%)

Query: 213 QNDYIAFTKDEL--VGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKR 270
           ++++I    +EL   GVS   L Q    +     K       P I  +L + KN   RK 
Sbjct: 260 RSEFIEIASEELDNSGVSPILLRQLTTTVRGTHYKVPAYGTAPYI--ILRSCKNENARKA 317

Query: 271 AYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXX 330
            +    +   +    L   +K+R+ L+ I G   +A YQL+ KMAK  E V NF+     
Sbjct: 318 VWTALHSCPDKQINRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFI---TR 374

Query: 331 XXXXXXXXXXENLKSLKEQEYKELGLPYNGS-------FNSWDYRYYDDKYLK----ENF 379
                     E LK L   +  +LGLP   S          WD  YY  K  +    +N 
Sbjct: 375 LMEHTKPMAAEELKLLANMKLNDLGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQ 434

Query: 380 DVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCN 439
             + E +  YF L   ++G+ N+++ ++ +  +E         W  +V++  V      N
Sbjct: 435 LTNHEPINAYFTLGSVLEGLSNLFKSIYGIS-LEVVASIPGETWSSEVRRVNV---KTEN 490

Query: 440 PEFVGWIYFDLHPREGKYGHAANFG------LYS----PYVTEEGTR------HYPVTVL 483
              +G +Y DL  R+ K    A+F       LY+    P + + G          P+  L
Sbjct: 491 NNIIGVVYCDLFERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISL 550

Query: 484 VCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQM 543
           VCNF++ S     LL+  E+ T FHE+GH +H+++G++++ +++G +    DFVE PS +
Sbjct: 551 VCNFARTSDNELCLLQLSEIETLFHEMGHAMHSMLGQTKLQNISG-TRCTTDFVELPSII 609

Query: 544 LEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTD 603
           +E +  +   +  + +HY T E++P++L+   + +           Q   ++ D  ++ +
Sbjct: 610 MEHFARDPRVLKGIGRHYITKEKVPEDLLAEELNSTRYLQNCETFAQAKMAMLDQRLYDN 669

Query: 604 K---ELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAA 660
                +  LD+  L+++L   + ++   D  T     F H+           +     AA
Sbjct: 670 NIIFHVRDLDVVELYHDLERNLEVLV--DDQTNWCGKFGHLF-GYGATYYSYLLDRAIAA 726

Query: 661 DMYHTMFAPNPLDTSVGTRYRDIILAKGGLRD----IEDSLEEFLGREPNNKAF 710
            ++  +F  +P   + G  +++ +L  GGLRD    I D L++ + ++ + KA 
Sbjct: 727 KIWDCLFVNDPFSRTGGENFKNAVLKWGGLRDPWECIADVLDQPMLKKGDTKAM 780

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  157 bits (396), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 135/508 (26%), Positives = 238/508 (46%), Gaps = 50/508 (9%)

Query: 227 VSETTLGQFEKVIEDGVEKYKM-TFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQI 285
           VS   L Q  K ++   + YK+ TF Y   + +L + +  E RK+ +    +   +  + 
Sbjct: 258 VSAFLLKQLNKDVKG--QNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKR 314

Query: 286 LIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKS 345
           L   +KLR  LA +    +YA YQLE KMAK  + V +F+                 LK 
Sbjct: 315 LSHLIKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTA---NELKF 371

Query: 346 LKEQEYKELGLPYNGSFNS-------WDYRYYDDKYLKENFD--VDEEELAKYFPLQHTI 396
           + E + K+L  P     +        WD  YY  KYL+ N     + +E++ YF L + I
Sbjct: 372 IAELKTKDLKKPLATKTDDILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVI 431

Query: 397 DGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGK 456
           +G+ +++Q ++ ++   E  + G+  W  DV++  V   ++     +G IY DL  R GK
Sbjct: 432 EGLSDLFQHIYGIRLEPEIADEGE-TWSPDVRRLNVISEEE---GIIGIIYCDLFERNGK 487

Query: 457 YGHAANFGLYS-----PYVTEEGTRHY-----------PVTVLVCNFSK-PSSTRPAL-- 497
             + A+F +       P  T+  T              PV  LVCNF+  P +++  L  
Sbjct: 488 TSNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCF 547

Query: 498 LKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKL 557
           L+  EV T FHE+GH +H+++G++ + +++G +    DFVE PS ++E +  +   + K+
Sbjct: 548 LQLSEVETLFHEMGHAMHSMLGRTHMQNISG-TRCATDFVELPSILMEHFAKDIRILTKI 606

Query: 558 SKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDK---ELDKLDIKSL 614
           SKHYETGE I   ++ S ++T +         Q   ++ D + H ++   ++D  DI   
Sbjct: 607 SKHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKN 666

Query: 615 WNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNPLDT 674
           +  L   + ++   D  +     F H+           ++    A+ +++ +F  +P   
Sbjct: 667 YQALERRLKVLV--DDQSNWCGRFGHLF-GYGATYYSYLFDRTIASKIWYALFEDDPYSR 723

Query: 675 SVGTRYRDIILAKGGLRD----IEDSLE 698
             G +++  +L  GGL+D    I D LE
Sbjct: 724 KNGDKFKKHLLKWGGLKDPWKCIADVLE 751

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  156 bits (394), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 129/514 (25%), Positives = 234/514 (45%), Gaps = 45/514 (8%)

Query: 220 TKDELVGVSETTLGQFEKVIEDGV-EKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNK 278
           +K E  G++   L   +K   D + E YK+    P  + VL   KN E R   +    + 
Sbjct: 255 SKLESAGLNRLLLNSLKK---DAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSC 311

Query: 279 VPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXX 338
             +    L   +KLR  LA + G  +++ YQL+ K+AK  + V NF+             
Sbjct: 312 SSEQILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEK 371

Query: 339 XXENLKSLKEQEYKELGL-PYNGSFNS---WDYRYYDDKYLKENFDVDEE---ELAKYFP 391
             + +  LK ++  ++     +G  ++   WD  YY   Y K     + E    L+ YF 
Sbjct: 372 ELKFIADLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFT 431

Query: 392 LQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLH 451
           L    +G+ ++  +++ +K +E         W  DV++  V   ++     +G IYFDL 
Sbjct: 432 LGGVFEGLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINVISEEE---GIIGIIYFDLF 487

Query: 452 PREGKYGHAANFGLYSPY----------VTEEGTR------HYPVTVLVCNFSK---PSS 492
            R GK  + A+F +              + + G++        P+  LVCNFS+    S 
Sbjct: 488 ERYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSD 547

Query: 493 TRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKD 552
               LL   E+ T FHE+GH IH+++G++ + +++G +    DFVE PS ++E +  +  
Sbjct: 548 KTICLLTLSEIETLFHEMGHAIHSMLGRTTLQNVSG-TRCATDFVELPSILMEHFASDTR 606

Query: 553 QILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDK---ELDKL 609
            + K+S HYETGE+I ++ +   +K            Q   ++ D  +H+DK    LD L
Sbjct: 607 VLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNL 666

Query: 610 DIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAP 669
           ++  ++ NL   + ++   D  +     F H+           ++    A  +++ +FA 
Sbjct: 667 NVVEIYQNLERRLQVLV--DDRSNWCGKFGHLF-GYGATYYSYLFDRAIARKVWNHLFAN 723

Query: 670 NPLDTSVGTRYRDIILAKGGLRD----IEDSLEE 699
           +P + + G ++++ +L  GG +D    I D L+E
Sbjct: 724 DPFNKTNGEKFKESLLKWGGSKDPWQCIADVLDE 757

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  155 bits (393), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 133/508 (26%), Positives = 225/508 (44%), Gaps = 57/508 (11%)

Query: 224 LVGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNE 283
           L  +++ T+G   K+   G   Y +          LN   +   R++ +    +   +  
Sbjct: 274 LRQLTKDTMGNNYKIPTSGYAPYTL----------LNACPSEAIRRQVWTAMFSCSEKQV 323

Query: 284 QILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENL 343
           + L   L+LR +LA I G   Y SYQLE KMAK  E V NFL               E L
Sbjct: 324 KRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGELEEL 383

Query: 344 KSLKE-----QEYKELGLPYNGSFNSWDYRYYDD---KYLKENFDVDE-EELAKYFPLQH 394
             LK       E   L L        WD  YY      + + N  VD    +  YF L  
Sbjct: 384 AKLKRNVENLSETNTLKL-----MRPWDRDYYSSLSPNFTRPNHRVDGFTSINTYFSLGV 438

Query: 395 TIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPRE 454
            + G+ ++++ ++ +       + G+  W  DV++  V    +     +G IY DL  R 
Sbjct: 439 VMQGISDLFRDIYGISLKPVVAQAGE-TWAPDVRKLQVISETE---GIIGLIYCDLLERP 494

Query: 455 GKYGHAANFGLYSP---YVTE------------EGTR-HYPVTVLVCNFSKPSSTRP--- 495
           GK    ++F +      Y  E            +G+R   PV  L+CNF      +    
Sbjct: 495 GKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSL 554

Query: 496 ALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQIL 555
            LL+  +V T FHE+GH +H+++G++++ +L+G   +  DFVE PS ++E +  ++  +L
Sbjct: 555 CLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDRRVLL 613

Query: 556 KLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLW 615
           ++S +Y TGE IP+EL+ +  +  +         Q+  S+ D  +H+  + D  DI +++
Sbjct: 614 RISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQD--DIIAVY 671

Query: 616 NNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNPLDTS 675
           + L  E+ ++   D  T     F H+           M     AA ++  +F  +P   S
Sbjct: 672 HGLEREMEVLV--DDQTNWCGRFGHLFGYGASYYSYLM-DRAIAAKIWDHLFKKDPFSRS 728

Query: 676 VGTRYRDIILAKGGLRD----IEDSLEE 699
            G ++++ +L  GG RD    I D+L+E
Sbjct: 729 SGEKFKEGVLKWGGSRDAWQCIADALDE 756

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  155 bits (392), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 126/503 (25%), Positives = 231/503 (45%), Gaps = 37/503 (7%)

Query: 223 ELVGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQN 282
           E  GVS+  L Q  K +     K       P  + ++ T  +   RK+ +    +   + 
Sbjct: 262 EASGVSQMVLQQLSKDLSGKFYKIPTYGYLP--YSIIRTCPSEYIRKKVWTAMYSCPEKQ 319

Query: 283 EQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXEN 342
            + L + ++LR +LA I G P YA+YQLE KMAK  + V NF+               + 
Sbjct: 320 IKRLKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKP 379

Query: 343 LKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYL----KENFDVDEEELAKYFPLQHTIDG 398
           L  +K   + +       S   WD  Y+    L    +    +  + L  YF L   I G
Sbjct: 380 LADMKHDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQG 439

Query: 399 MLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGKYG 458
           + +++Q ++ ++      + G+  W  +V++  V  + + N   +G IY DL  R+GK  
Sbjct: 440 LSDLFQSIYGIRLEPVVAKTGET-WDPEVRKIQV--ISEANG-VIGVIYCDLFERQGKTP 495

Query: 459 HAANFGLYSP---------YVTEEGTRH-------YPVTVLVCNFS--KPSSTRPALLKH 500
           + A+F +            Y T +   H        PV  LVCNFS  +       LL+ 
Sbjct: 496 NPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQL 555

Query: 501 GEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKH 560
            EV T FHE+GH +H+++G++++ +++G +    DFVE PS ++E +  +   + ++S H
Sbjct: 556 SEVETLFHEMGHAMHSMLGRTQLQNISG-TRCATDFVELPSILMEHFAKDLRVLSRISSH 614

Query: 561 YETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLRE 620
           Y TGE++P E++ +  +            Q+  ++ D  +H+  + +  DI ++++ L +
Sbjct: 615 YATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEK 673

Query: 621 EVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRY 680
           E+ ++   D  +     F H+           M     AA +++ +F  +P   + G ++
Sbjct: 674 ELQVLV--DDRSNWCGRFGHLFGYGASYYSYLM-DRAIAAKVWNHLFQHDPFSRAGGEKF 730

Query: 681 RDIILAKGGLRD----IEDSLEE 699
           ++ +L  GG RD    I D+L+E
Sbjct: 731 KNSVLKWGGSRDPWRCIADALDE 753

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  154 bits (390), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 137/532 (25%), Positives = 240/532 (45%), Gaps = 62/532 (11%)

Query: 213 QNDYIAFTKDELVGVSETTLGQFEKVIEDGVEKYKMT-------FKYPDIHPVLNTA--- 262
           + DYI    DE           F+K  +    KYK++       +K P    +  TA   
Sbjct: 246 EKDYIKIKCDE-----------FDKACDYPALKYKLSKDLSGKYYKIPTYGKIPYTALLK 294

Query: 263 -KNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETV 321
            K+ E RK+ ++   +   +  + L + +K R ELA++    +Y+ Y LE KMAK  + V
Sbjct: 295 CKDEELRKKLWVAFHSCSNKQIERLTKIIKHRIELAKLLSKSSYSEYTLEGKMAKGPKEV 354

Query: 322 FNFLYXXXXXXXXXXXXXXE---NLKSLKEQ---EYKELGLPYNGSFNSWDYRYYDDKYL 375
            NFL               E   N K L E    E  E  +  N     WD  YY+    
Sbjct: 355 NNFLNALLKSILPEVTKELEPISNKKCLSEGFSLETSEQSILNN--IKPWDRDYYNPIQA 412

Query: 376 KENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDL 435
                  +  + +YF L + I G+ N++  ++ ++F     E G+  W +DV++  V   
Sbjct: 413 TSE-GAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRFEPGKIEDGE-TWSKDVRKLNVISE 470

Query: 436 DKCNPEFVGWIYFDLHPREGK------YGHAANFGLYS---------PYVTEEGTRHY-- 478
           D+     +G IY DL  REGK      Y    +  +YS           V  +  +++  
Sbjct: 471 DE---GLIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQL 527

Query: 479 PVTVLVCNF---SKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWD 535
           P+  LVCNF   +   S R   L+H E+ T FHE+GH +H+++G++R   ++G   +  D
Sbjct: 528 PIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-D 586

Query: 536 FVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSL 595
           FVE PS ++EF+  N   ++ +S+HY++GE I  E+++  ++            Q   +L
Sbjct: 587 FVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGKMAL 646

Query: 596 FDMTVHTD--KELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXM 653
            D  +H +    LD +D+  +++NL +E++++   D  +     F H +          +
Sbjct: 647 LDQRLHAENANSLDNIDVVEIYHNLEKELSVLP--DTESNWCGRFGH-LYGYGALYYCYL 703

Query: 654 WSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREP 705
           +    A  ++ ++F  +P     G  +++ +L  GG +D    + + LG EP
Sbjct: 704 FDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGGSKDPWKCVADVLG-EP 754

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  154 bits (389), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 130/527 (24%), Positives = 243/527 (46%), Gaps = 56/527 (10%)

Query: 213 QNDYIAFTKDEL--VGVSETTLGQFEKVIEDGVEKYKM-TFKYPDIHPVLNTAKNPETRK 269
           +++YI    +EL   G+++  L Q  K I+     YK+ TF Y   + +L +  +   R 
Sbjct: 237 RSNYIKVEVEELNKSGINKIVLNQLSKDIKG--RHYKIPTFGYIP-YSILRSCPDDNIRM 293

Query: 270 RAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXX 329
           + +    +   +    L + +KLR+ LA I G  ++A YQLE KMAK  E V  F+    
Sbjct: 294 KVWSALHSCSEKQIARLDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLI 353

Query: 330 XXXXXXXXXXXENLKSLKEQEYKELGLPYNGSFNS----------WDYRYYDDKY-LKEN 378
                      + +  LK +      +P N    S          WD  +Y   + L++ 
Sbjct: 354 DATKPKAAEELKFIADLKAKH-----VPGNKPAESMHEILEMVKPWDRDFYGSVHALQQR 408

Query: 379 FDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC 438
              + E+++ YF L   I G+ N++++++ + ++E         W  +V++  V    + 
Sbjct: 409 RPFNNEQISSYFSLGVVIQGLSNLFKQIYGI-YLEPVVPKTGETWSPEVRRINVVSEKE- 466

Query: 439 NPEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTR----------------HYPVTV 482
               +G +Y DL  R+GK  + A+F +       +G                    PV  
Sbjct: 467 --GVIGVVYCDLFERQGKTANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVIS 524

Query: 483 LVCNFSKPSSTRP---ALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEA 539
           LVCNFS  + ++     LL+  E+ T FHE+GH +H+++G++++ +++G +    DFVE 
Sbjct: 525 LVCNFSPTTISQEQSICLLQLSEIETLFHEMGHAMHSMLGRTKLQNISG-TRCATDFVEL 583

Query: 540 PSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMT 599
           PS ++E +  +   + +++ HY TGE IP++L+ S               Q   ++ D  
Sbjct: 584 PSILMEHFARDHRVLQRMASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQE 643

Query: 600 VHTD---KELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSE 656
           +H +   KE+  LDI  L++NL  ++ ++S  D  +     F H+           ++  
Sbjct: 644 LHGESIMKEMQYLDIVKLYHNLERQLEVLS--DDKSNWCGRFGHLF-GYGATYYSYLFDR 700

Query: 657 VFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRD----IEDSLEE 699
             A+ ++  +FA +P     G ++++ +L  GG RD    I D+L++
Sbjct: 701 AIASKIWQHLFANDPFCRRSGEKFKNSVLKWGGSRDPWECIADALDK 747

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  151 bits (382), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 131/514 (25%), Positives = 237/514 (46%), Gaps = 58/514 (11%)

Query: 226 GVSETTLGQFEKVIEDGVEKYKMTFKYPDIH--PVLNTAKNPETRKRAYIGDQNKVPQNE 283
           GV+   L Q  K   D   KY   +K P     P+      P+   RA +        N+
Sbjct: 258 GVNSLLLKQLPK---DITGKY---YKIPTSGYIPISLIRSCPDATIRAKVWASLHSCPND 311

Query: 284 QI--LIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXE 341
           QI  L   +KLR  LA +    ++A YQLE KMAK  + V +F+               +
Sbjct: 312 QIRRLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFI---KTLMDYMRPKAAQ 368

Query: 342 NLKSLKEQEYKELGLPYNGS-------FNSWDYRYYDDKYLKENFDVDEEE---LAKYFP 391
            LK + + + KEL +P + S        + WD  YY   + K   DV+  E   +  YF 
Sbjct: 369 ELKFMADLKCKELNIPTSDSTTAILDLISPWDREYYTTIHSKAK-DVNLYENHPINMYFT 427

Query: 392 LQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLH 451
           + + + G+ +I+Q+++ ++      E G+  W  +V++  V    +     +G +Y DL 
Sbjct: 428 MGNIMKGLSHIFQRIYGIRLEAVVPEEGE-TWSPEVRRLNVISETE---GLIGVVYCDLF 483

Query: 452 PREGKYGHAANFGLYSPY---------------VTEEGTR-HYPVTVLVCNFSKPSSTRP 495
            R GK  + A+F +                      +GT    PV  LVCNFS   ++  
Sbjct: 484 ERAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSND 543

Query: 496 ---ALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKD 552
               LL+  E+ T FHE+GH +H+++G+SR+ +++G +    DFVE PS ++E +  +K 
Sbjct: 544 KMICLLQLNEIETLFHEMGHAMHSMLGRSRLQNVSG-TRCATDFVELPSILMEHFARDKR 602

Query: 553 QILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTD---KELDKL 609
            + ++  HYET E++ + ++++ +K            Q   ++ D  ++++   K+LD +
Sbjct: 603 VLHEIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHV 662

Query: 610 DIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAP 669
           D+  ++  L E++ ++ +    +     F H+           ++    A+ ++  +FA 
Sbjct: 663 DVVKIYQTLEEDLKVLVDNK--SNWCGKFGHLF-GYGASYYSYLFDRAIASKVWDQLFAK 719

Query: 670 NPLDTSVGTRYRDIILAKGGLRD----IEDSLEE 699
           +P     G ++++ +L  GGLRD    I D LE+
Sbjct: 720 DPFSREGGEKFKNCVLKWGGLRDPWHCIADVLEQ 753

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 118/512 (23%), Positives = 238/512 (46%), Gaps = 52/512 (10%)

Query: 226 GVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQI 285
           G+++  L Q  K I+   + YK+       + VL    +   RK+ +    +  P  + +
Sbjct: 269 GINQLILSQLSKDIKG--KHYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIV 325

Query: 286 LIETL-KLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLK 344
            ++ L +LR  LA + G  +YA YQLE KMAK  E V +F+               + L 
Sbjct: 326 RLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFI---DSLIKVTQPKAKQELG 382

Query: 345 SLKEQEYKELGLPYNGSFN--------SWDYRYYDDKY---LKENFDVDEEELAKYFPLQ 393
            + + + K + LP + + N         WD  +Y   Y    +    +D+++++ YF L 
Sbjct: 383 FISDLKRKHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLG 442

Query: 394 HTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPR 453
           + + G+ +++ +++ ++      + G+  W  +V++  V   ++     +G +Y DL  R
Sbjct: 443 NVMQGLSDLFHQIYGIRLEPVIAQKGET-WSPEVRRLNVVSDEE---GVIGVVYCDLFER 498

Query: 454 EGKYGHAANFGLYSPY---------------VTEEGTR-HYPVTVLVCNFSKPSST---R 494
           +GK  + ++F +                     ++GT+   P+  LVCNF+    +    
Sbjct: 499 DGKTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQS 558

Query: 495 PALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQI 554
             LL   E+ T FHE+GH +H+++G++R+ +L+G +    DFVE PS ++E +  +   +
Sbjct: 559 LCLLHISEIETLFHEMGHAMHSMLGRTRLQNLSG-TRCATDFVELPSILMEHFARDTRVL 617

Query: 555 LKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDK---ELDKLDI 611
            ++ KH  TGE +P+ L+ + ++            Q   ++ D  +H  +    +D LD+
Sbjct: 618 RQIGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDV 677

Query: 612 KSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNP 671
            +L+ NL  E+ ++ +      G   F H+           ++    A+ ++ ++F  +P
Sbjct: 678 VALYQNLERELRVLVDDQSTWCG--RFGHLF-GYGATYYSYLFDRAIASKVWESLFQEDP 734

Query: 672 LDTSVGTRYRDIILAKGGLRD----IEDSLEE 699
              + G R+++ +L  GG +D    I D L++
Sbjct: 735 FSRAGGQRFKEYVLKWGGAKDPWQCIADVLDQ 766

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 131/508 (25%), Positives = 232/508 (45%), Gaps = 50/508 (9%)

Query: 227 VSETTLGQFEKVIEDGVEKYKM-TFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQI 285
           VS   L Q  K ++   + YK+ TF Y   + +L + +N   RK+ +    +   +  + 
Sbjct: 258 VSTFLLKQLNKDVKG--QNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKR 314

Query: 286 LIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKS 345
           L   +KLR  LA +    +YA YQLE KMAK  + V +F+                 LK 
Sbjct: 315 LSHLIKLRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTA---NELKF 371

Query: 346 LKEQEYKELGLPYNGS-------FNSWDYRYYDDKYLKEN--FDVDEEELAKYFPLQHTI 396
           + E + K+L  P   +          WD  YY  KY + N     + +E++ YF L + I
Sbjct: 372 IAELKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVI 431

Query: 397 DGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGK 456
            G+ +++Q+++ ++      + G+  W  DV++  V   ++     +G IY DL  R GK
Sbjct: 432 QGLSDLFQQIYGIRLEPAITDEGE-TWSPDVRRLNVISEEE---GIIGIIYCDLFERNGK 487

Query: 457 YGHAANFGLYSP---YVTE------------EGTR-HYPVTVLVCNFSK---PSSTRPAL 497
             + A+F +      Y +E            +GT    PV  LVCNFS     S      
Sbjct: 488 TSNPAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCF 547

Query: 498 LKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKL 557
           L+  EV T FHE+GH +H+++G++ + +++G +    DFVE PS ++E +  +   + K+
Sbjct: 548 LQLSEVETLFHEMGHAMHSMLGRTHMQNISG-TRCATDFVELPSILMEHFAKDIRILTKI 606

Query: 558 SKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDK---ELDKLDIKSL 614
            KHY TGE I  +++   +K+ +         Q   ++ D + H +K   ++D  D+   
Sbjct: 607 GKHYGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVEN 666

Query: 615 WNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNPLDT 674
           +  L   + ++   D  +     F H+           ++    A+ +++ +F  +P   
Sbjct: 667 YQALERRLKVLV--DDQSNWCGRFGHLF-GYGATYYSYLFDRTIASKIWYALFEDDPYSR 723

Query: 675 SVGTRYRDIILAKGGLRD----IEDSLE 698
             G +++  +L  GGL+D    I D LE
Sbjct: 724 KNGDKFKKHLLKWGGLKDPWKCIADVLE 751

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  150 bits (379), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 126/498 (25%), Positives = 232/498 (46%), Gaps = 46/498 (9%)

Query: 227 VSETTLGQFEKVIEDGVEKYKM-TFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQI 285
           VS   L Q  K ++   + YK+ TF Y   + +L + +  + RK+ +    +   +  + 
Sbjct: 261 VSAFLLKQLNKDVKG--QNYKVPTFGYA-AYALLKSCEKEQVRKKIWTALHSCSDKQIKR 317

Query: 286 LIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKS 345
           L   +KLR  LA++    +YA YQLE KMAK  + V +F+                 LK 
Sbjct: 318 LNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDKTAT---ELKF 374

Query: 346 LKEQEYKELGLPYNGSFNS-------WDYRYYDDKYLKENFD--VDEEELAKYFPLQHTI 396
           + E + K+L  P     +        WD  YY  KYL+ N       +E++ YF L + I
Sbjct: 375 IAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSAKEISSYFTLGNVI 434

Query: 397 DGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGK 456
            G+ +++Q ++ +K      + G+  W  DV++  V   ++     +G IY DL  R GK
Sbjct: 435 QGLSDLFQHIYGIKLEPAIADEGE-TWSPDVRRLNVISEEE---GIIGIIYCDLFERSGK 490

Query: 457 YGHAANFGLYS-----PYVTEEGTRHY-----------PVTVLVCNFSK-PSSTRPAL-- 497
             + A+F +       P  T+  T              PV  LVCNF+  P +++ +L  
Sbjct: 491 TSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFAPIPIASKKSLCF 550

Query: 498 LKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKL 557
           L+  EV T FHE+GH +H+++G++ + +++G +    DFVE PS ++E +  +   + ++
Sbjct: 551 LQLSEVETLFHEMGHAMHSMLGRTHMQNISG-TRCATDFVELPSILMEHFAKDIRILTRI 609

Query: 558 SKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDK---ELDKLDIKSL 614
            KHYETGE +  +++ S ++T +         Q   ++ D + H ++    +D  D+   
Sbjct: 610 GKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEVISNIDNYDVVKN 669

Query: 615 WNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNPLDT 674
           +  L   + ++   D  +     F H+           ++    A+ +++ +F  +P   
Sbjct: 670 YQALERRLKVLV--DDQSNWCGRFGHLF-GYGATYYSYLFDRTIASKIWYALFEDDPYSR 726

Query: 675 SVGTRYRDIILAKGGLRD 692
             G +++  +L  GGL+D
Sbjct: 727 KNGDKFKKHLLKWGGLKD 744

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  149 bits (375), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/466 (23%), Positives = 217/466 (46%), Gaps = 42/466 (9%)

Query: 258 VLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKK 317
           +L    +PE RK+ ++   +   Q  + L   +K+R  LA   G   YA+Y ++ KMAK 
Sbjct: 293 ILKACTDPEIRKKIWVAMHDCSKQQIERLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKN 352

Query: 318 QETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYN------GSFNSWDYRYYD 371
            + V  FL               + +  L   E  E   P +       +   WD  YY 
Sbjct: 353 PKDVDEFLKSLMDFLKPKAAKELKFISDLIHNEKGE--KPSDDVDEILTAVRPWDREYYT 410

Query: 372 --DKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKN-VWHEDVK 428
              +  +++  +D+  L  Y+PL + I G+ +I++ ++ ++F  E    GK   W  DV+
Sbjct: 411 AIHRNKQKHLLLDDYALDVYYPLGNVIQGLSDIFESIYGIRF--EPAVAGKGETWSSDVR 468

Query: 429 QFAVWDLDKCNPEFVGWIYFDLHPREGKYGHAANFGLYS-----PY----------VTEE 473
           +  V    +     +G IY DL  R+GK  +AA+F +       P+             +
Sbjct: 469 RLNVVSEKE---GLIGIIYCDLFRRQGKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVD 525

Query: 474 GTR-HYPVTVLVCNFSKP---SSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGP 529
           GT+   P+  L+CNF+     S     LL   E+ T FHE+GH IH+++G++R+ +++G 
Sbjct: 526 GTKFQLPIISLLCNFNTRCLNSGETICLLALNEIETLFHEMGHAIHSMLGRTRLQNVSG- 584

Query: 530 SSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLR 589
           +    DFVE PS ++E +  +   + ++  HY+TG+++P  L++  ++            
Sbjct: 585 TRCSTDFVELPSVLMEHFARDTRVLKRIGHHYKTGDRVPATLLNRYLEKARFLKDCETFS 644

Query: 590 QLHFSLFDMTVHTD---KELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXX 646
           Q   ++ D  ++     + +D +D+  +++ L +E+ ++ + +  +     F H+     
Sbjct: 645 QAKMAMLDQRLYDKNIVQNIDSVDVVKIYHELEKELEVLVDDE--SNWCAKFGHLF-GYG 701

Query: 647 XXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRD 692
                 ++    A+ ++  +F  +P   S G ++++ +L  GGLR+
Sbjct: 702 ATYYCYLFDRAIASKVWKKLFEKDPYSRSGGEKFKNDVLKWGGLRE 747

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  149 bits (375), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 130/506 (25%), Positives = 236/506 (46%), Gaps = 46/506 (9%)

Query: 227 VSETTLGQFEKVIEDGVEKYKM-TFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQI 285
           VS   L Q  K ++   + YK+ TF Y     +L + +    RK+ +    +   +  + 
Sbjct: 258 VSTFLLKQLNKDVKG--QNYKVPTFGYAAF-ALLKSCEIEVVRKKIWTALHSCSDKQIKR 314

Query: 286 LIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKS 345
           L   +KLR  LA +    +YA YQLE KMAK  + V +F+               + +  
Sbjct: 315 LDRLIKLRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIAD 374

Query: 346 LKEQEYKELGLPYNGS-----FNSWDYRYYDDKYLKENFD--VDEEELAKYFPLQHTIDG 398
           LK ++ K+  L  N          WD  YY  KY++ N       +E++ YF L + I G
Sbjct: 375 LKAKDLKK-PLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQG 433

Query: 399 MLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGKYG 458
           + +++Q+++ ++      + G+  W  DV++  V   ++     +G IY DL  R GK  
Sbjct: 434 LSDLFQQIYGIRLEPAIADEGE-TWSPDVRRLNVISEEE---GIIGIIYCDLFERNGKTS 489

Query: 459 HAANFGLYS-----PYVTEEGTRHY-----------PVTVLVCNFSK-PSSTRPAL--LK 499
           + A+F +       P+ T+  T              PV  LVCNFS  P +++ +L  L+
Sbjct: 490 NPAHFTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQ 549

Query: 500 HGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSK 559
             EV T FHE+GH +H+++G++ + +++G +    DFVE PS ++E +  +   + ++ K
Sbjct: 550 LSEVETLFHEMGHAMHSMLGRTHMQNISG-TRCATDFVELPSILMEHFAKDIRVLTRIGK 608

Query: 560 HYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDK---ELDKLDIKSLWN 616
           HYETGE I   ++   +KT +         Q   ++ D + H +K   ++D  ++   + 
Sbjct: 609 HYETGETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQ 668

Query: 617 NLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNPLDTSV 676
            L   + ++   D  +     F H+           ++    A+ +++T+F  +P   + 
Sbjct: 669 ALERHLKVLV--DDQSNWCGRFGHLF-GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNN 725

Query: 677 GTRYRDIILAKGGLRD----IEDSLE 698
           G +++  +L  GGL+D    I D LE
Sbjct: 726 GDKFKKHLLKWGGLKDPWKCIADVLE 751

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  143 bits (361), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 122/519 (23%), Positives = 229/519 (44%), Gaps = 45/519 (8%)

Query: 215 DYIAFTKDEL--VGVSETTLGQFEKVIEDGVEKYKMTFKYPDIH-PVLNTAKNPETRKRA 271
           ++I   +DE+   G+S     +  +   D   KY     Y  I   +L +  + + RK  
Sbjct: 234 EFIKVKRDEMDKSGISPLLTARLNR---DLTGKYYKIPTYGQIPLQILKSCPDEDIRKEV 290

Query: 272 YIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXX 331
           +    N      Q L + ++LR  L+ + G  +Y+ YQL+ KMA   E V  F+      
Sbjct: 291 WAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNV 350

Query: 332 XXXXXXXXXENLKSLKEQEYKELGLPYN---GSFNSWDYRYYDDKYLKEN--FDVDEEEL 386
                    E +   K        +  N        WD  Y+  KY  +N    + +E+L
Sbjct: 351 TKPLAARELEFIARDKLNAPDSRHMSDNEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQL 410

Query: 387 AKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWI 446
             YF L + I+G+  ++++++ +       E G+  W  DV++  V   ++     VG I
Sbjct: 411 RYYFSLGNVINGLSELFKRIYGITLQPSRTENGE-TWSPDVRRLDVISEEE---GLVGVI 466

Query: 447 YFDLHPREGKYGHAANFGLYSP---------YVT------EEGTR-HYPVTVLVCNFSK- 489
           Y DL  R GK  + A+F +            + T       +GT    PV  LVCNFS  
Sbjct: 467 YCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTV 526

Query: 490 --PSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFW 547
             P+  R   L   E+ T FHE+GH +H+++G++R+ +++G +    DFVE PS ++E +
Sbjct: 527 ALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISG-TRCATDFVELPSILMEHF 585

Query: 548 PWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTD---K 604
             +   +  +  HYET E  P+ L++  +             Q   ++ D  +H      
Sbjct: 586 ARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLS 645

Query: 605 ELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYH 664
           +++++D   ++  L   + ++++ +    G   F H+           ++    A+ ++ 
Sbjct: 646 DIERIDSAKIYQKLETRLQVLADDESNWCG--RFGHLF-GYGATYYSYLFDRAIASKVWD 702

Query: 665 TMFAPNPLDTSVGTRYRDIILAKGGLRD----IEDSLEE 699
           ++F  +P + + G ++++ +L  GGL++    I D LE+
Sbjct: 703 SLFKDDPFNRTGGEKFKERVLKWGGLKNPWSCIADVLEK 741

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  141 bits (356), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 116/513 (22%), Positives = 235/513 (45%), Gaps = 44/513 (8%)

Query: 213 QNDYIAFTKDEL--VGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKR 270
           +++YI    +E+   G+++  + Q  K +    + YK+       + +L +  + E R  
Sbjct: 255 RSNYIKIKCEEVDNSGINKLLISQLPKDVRG--KYYKIPTHGYIAYSILRSCPDEEIRMN 312

Query: 271 AYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXX 330
            +        +    L + L+LR  LA++ G  ++A YQLE KMA+  + V +F+     
Sbjct: 313 LWTAMHRCSDKQINRLDQLLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVN 372

Query: 331 XXXXXXXXXXENLKSLKEQEYKELGLP------YNGSFNSWDYRYYDDKY-LKENFD-VD 382
                     + +  LK ++ K    P             WD  YY   Y L++  D +D
Sbjct: 373 YMRPKTIEELKFIYELKSKQEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAID 432

Query: 383 EEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPE- 441
           +E+++ YF L + I G+ ++++ ++ ++      + G+  +  +V++  V     C  E 
Sbjct: 433 DEQISSYFTLGNVIQGLSDLFESIYGIRLEPVVPKTGE-TFSPEVRRLNVV----CEQEG 487

Query: 442 FVGWIYFDLHPREGKYGHAANFGLYS-----PYVTEEGTRH-----------YPVTVLVC 485
            +G +Y DL  R GK  + ++F +       P  TE  T              PV  LVC
Sbjct: 488 VIGVVYCDLFERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVC 547

Query: 486 NFSKPSSTRP---ALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQ 542
           NFS  + +      LL+  EV T FHE+GH +H+++G++R+ +++G +    DFVE PS 
Sbjct: 548 NFSSSTDSEGKSICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISG-TRCATDFVELPSI 606

Query: 543 MLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHT 602
           ++E +  +   + ++ KH+ TG  I ++L+ + ++            Q   ++ D  +H 
Sbjct: 607 LMEHFARDVRVLERIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHG 666

Query: 603 D---KELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFA 659
           +   K+ D  D+ + +  L  ++ ++   D  +     F H+           ++    A
Sbjct: 667 EKVIKDFDHFDVTAAYQQLERDMKVLV--DDKSNWCGKFGHLF-GYGATYYSYLFDRAIA 723

Query: 660 ADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRD 692
           + ++ ++F+ +P     G ++++ +L  GG R+
Sbjct: 724 SKVWDSLFSSDPYSRVNGEKFKECVLKWGGSRN 756

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  140 bits (354), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 117/523 (22%), Positives = 234/523 (44%), Gaps = 44/523 (8%)

Query: 213 QNDYIAFTKDEL--VGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKR 270
           ++DY+     EL   GVS   L Q  + +++  + YK+         +L +  N   R +
Sbjct: 242 RSDYVKIPCKELDSSGVSTLLLNQLSRDLKN--QNYKVPAYGYAAFSILRSCPNENVRMK 299

Query: 271 AYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXX 330
            +    +   +    L + + LR  LA I G  +YA YQL  KMAK    V  F+     
Sbjct: 300 IWTAMHSCPEKQISRLKQLVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFV---QS 356

Query: 331 XXXXXXXXXXENLKSLKEQEYKELGLPYNGS-------FNSWDYRYYD--DKYLKENFDV 381
                     E L+ L + +   LG+    S          WD  +Y   +   ++   +
Sbjct: 357 LVDVTKPLAAEELRVLAKLKSGHLGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTL 416

Query: 382 DEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPE 441
           + E ++ YF L   + G+  +++ ++ ++      + G+  W  +V++  V    +    
Sbjct: 417 ENEHISSYFSLGTVMQGLSRLFEDIYGIRLEPVVAKAGET-WSPEVRRINVVSEKE---G 472

Query: 442 FVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTR----------------HYPVTVLVC 485
            +G +Y DL  R+GK  + A+F +        G                    PV  LVC
Sbjct: 473 IIGVVYCDLFERQGKTSNPAHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVC 532

Query: 486 NFSKPSSTRP--ALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQM 543
           +F++ S++R    LL+  +V T FHE+GH +H+++G++ + +++G +    DFVE PS +
Sbjct: 533 SFAQNSASRQGVCLLQLSDVDTLFHEMGHAMHSMLGRTSLQNISG-TRCATDFVELPSIL 591

Query: 544 LEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTD 603
           +E +  +   + ++ +HY T + IP EL+       +         Q   ++ D  +H+ 
Sbjct: 592 MEHFARDSRVLSRIGRHYATDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSS 651

Query: 604 KELD--KLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAAD 661
           K L   KLD+  L++ + +++ +++  D  +     F H++          ++    A+ 
Sbjct: 652 KALTDGKLDVVKLYHGVEKDMEVLA--DDQSNWCGRFGHLL-GYGASYYSYLFDRAIASK 708

Query: 662 MYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGRE 704
           ++  +FA +P +   G ++++ +L  GG +D  + + + L R+
Sbjct: 709 IWQHLFAEDPFNRENGEKFKESVLKWGGSKDPWECVADALDRK 751

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  137 bits (344), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 124/486 (25%), Positives = 218/486 (44%), Gaps = 59/486 (12%)

Query: 246 YKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTY 305
           YK+    P  + +L    N   RK+ +    +   +  + L + + LR +LA++    ++
Sbjct: 296 YKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQEQIERLKKMVTLRYKLAKLLKKKSF 355

Query: 306 ASYQLEMKMAKKQETVFNFLYXXXXXXXXXXXXXXENLKSLKEQEYKELGLPYNGSFN-- 363
           A YQL+ KMAK  E V  F+               + L SL E +  +LGL +    N  
Sbjct: 356 AEYQLQGKMAKNPEEVKKFI---STLLDFTKPLAIKELTSLAEVKAADLGLAFKNDSNFI 412

Query: 364 -----SWDYRYYD--DKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKF----- 411
                 WD  YY   ++Y  +    D  EL  YF L + I G+ N++  ++ ++F     
Sbjct: 413 VNLIRPWDRNYYSKINRYENKQTMEDLNELPYYFSLGNVIAGLSNLFHNIYGIRFELAVP 472

Query: 412 -VEETRECGKNVWHEDVKQFAVWDLDKCNPEFVGWIYFDLHPREGKYGHAANFGLYSPYV 470
            +EET       W  +V++  V    +     +G +Y DL  R  K  +AA+F +     
Sbjct: 473 KLEET-------WLPEVRKLNVISESE---GLIGIVYCDLFERPSKKTNAAHFTICCSRE 522

Query: 471 TEEGTR---------------HYPVTVLVCNFSKP---SSTRPALLKHGEVVTFFHELGH 512
             +G                   P+  L+CNFSK        P  L+  E+ T FHE+GH
Sbjct: 523 IGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLFEENGPCFLQLHEIETLFHEMGH 582

Query: 513 GIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELV 572
            +H+++G++R+ + +G +    DFVE PS ++E +  +   +  +S HY + E    EL+
Sbjct: 583 AMHSVLGRTRLQNTSG-TRCATDFVELPSILMEHFAKDVRVMESISSHYISQEPASPELL 641

Query: 573 DSLIKTKHVNAGLSNLR---QLHFSLFDMTVHTDKEL-DKLDIKSL--WNNLREEVTLIS 626
            + +   H    L NL    Q   S+ D  +H+++   D+ DI  +  +N+L +++ L S
Sbjct: 642 QTWL---HSTDNLQNLELYTQAKMSMLDQILHSNEIFEDQKDINVVKSYNDLEKKLELFS 698

Query: 627 NGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILA 686
             D  +     F H+           ++    A+ ++ ++F  NP   + G +++D +L 
Sbjct: 699 --DDQSNWCGKFGHLF-GYGASYYSYLFDRAIASKVWESLFKQNPFSRTSGLKFKDSVLR 755

Query: 687 KGGLRD 692
            GG RD
Sbjct: 756 WGGSRD 761

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  134 bits (337), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 122/535 (22%), Positives = 243/535 (45%), Gaps = 57/535 (10%)

Query: 213 QNDYIAFTKDEL--VGVSETTLGQFEKVIEDGVEKYKM-TFKYPDIHPVLNTAKNPETRK 269
           +++Y+  + +EL   G+S   L    +  +   + YK+ T+ Y     +L +  +   R 
Sbjct: 243 KSEYVKVSCNELETSGISPLLLNHLSR--DTKGQNYKVPTYGYIAF-SILRSCPSENIRM 299

Query: 270 RAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXX 329
           + +    +   +    L   +KLR  LA+I G  +Y+ YQLE KMAK    V  F+    
Sbjct: 300 KVWTAVHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLA 359

Query: 330 XXXXXXXXXXXENLKSLKEQEYKELGLPYNGS-----FNSWDYRYYDD--KYLKENFDVD 382
                        L +LK   + +L +P            WD  +Y       ++   ++
Sbjct: 360 EAIKPLAMRELRALANLKS-SHLDLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLE 418

Query: 383 EEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEF 442
            E++  YF L   + G+ ++ + ++ ++      + G+  W  +V++  V    +     
Sbjct: 419 NEQINSYFSLGTVMQGLSSLLEDIYGIRLEPAVAKVGET-WSPEVRRINVVSDQE---GV 474

Query: 443 VGWIYFDLHPREGKYGHAANFGLYS-----PYVTEEGTRHY------------PVTVLVC 485
           +G +Y DL  R+GK  + A+F +       P  T+  T               PV  LVC
Sbjct: 475 IGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVC 534

Query: 486 NFSKPSSTRP--ALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQM 543
           +FS+ S ++    LL+  EV T FHE+GH IH+++G++ + +++G +    DFVE PS +
Sbjct: 535 SFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISG-TRCATDFVELPSIL 593

Query: 544 LEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAG----LSN---LRQLHFSLF 596
           +E +  +   + ++ KHY T E +PDEL+       H+N      L N     Q   ++ 
Sbjct: 594 MEHFAHDSRVLSRIGKHYITNEPVPDELL-------HLNQNELKYLQNTETFSQAKMAML 646

Query: 597 DMTVHTDKELD--KLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMW 654
           D  +H+ + L    +D+  +++ + +++ +++  D  +     F H++          ++
Sbjct: 647 DQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLT--DDKSNWCGRFGHLL-GYGASYYSYLF 703

Query: 655 SEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKA 709
               A+ ++  +FA +P     G ++++ +L  GG RD  + + + L ++  +K 
Sbjct: 704 DRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGGSRDPWNCIADALDKQSLSKG 758

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  132 bits (332), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 149/694 (21%), Positives = 295/694 (42%), Gaps = 56/694 (8%)

Query: 38  RNMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHED 97
           R+ S L +     S+  +A+ +V   Q + ++  +    + S+ET D   + +  +D   
Sbjct: 71  RSTSDLETGLFQNSYLKSANGLVEFTQHSFEKAKELVQKIHSIETQDEMKYYIKDLDQLS 130

Query: 98  ETDGYMSQLT-FLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDD 156
           +    +  L  F++    DK+     ++  +   E   E  +  +   +   +  Q   +
Sbjct: 131 DVLCRVIDLCEFIRATHPDKKF----VQTAQQCHEKMFEIMNILNTDVRLCDLLTQCLRE 186

Query: 157 ENLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKXXXXXXXXXXXXG-EQND 215
            ++   D E     + + +D+  +G+ +  E R K  ++ ++               +++
Sbjct: 187 SDVLGLDSEEIRTGKILLEDFEKSGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSN 246

Query: 216 YIAFTKDEL-VGVSETTLGQFEKVIEDGVEKYKM-TFKYPDIHPVLNTAKNPETRKRAYI 273
           YI  + + +   V++    Q +K I    E YK+ T+ Y   H +L T  +   R + + 
Sbjct: 247 YIKISCELMDAHVNKMVCSQMKKDITG--EYYKVPTYGYIP-HTLLRTCSDEVIRMKIWT 303

Query: 274 GDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYXXXXXXX 333
              +      + L + + LR ELA++ G   +A YQL  KMAK  E V  FL        
Sbjct: 304 EMHSCSDAQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTR 363

Query: 334 XXXXXXXENLKSLKEQEYKELGLPYNGS-----FNSWDYRYYDD-----KYLKENFDVDE 383
                  + L  LK  E      P+           WD  YY       +    + D + 
Sbjct: 364 IKAASELKPLAVLKS-ELTGTQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLD-NG 421

Query: 384 EELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKCNPEFV 443
           E ++  F L   + G+ ++++K++ +K V  T + G+  W  DV++  V D    +   +
Sbjct: 422 ESISSSFSLGVVMQGLSDLFEKIYGIKLVPATPKTGET-WSPDVRRIDVVDE---HDGLI 477

Query: 444 GWIYFDLHPREGKYGHAANFGLYSP---YVTEEGTR-------------HYPVTVLVCNF 487
           G +Y DL  REGK  + A+F +      Y+ E  T                PV  LVC+F
Sbjct: 478 GVMYCDLFEREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDF 537

Query: 488 -------SKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAP 540
                        +  LL+  E+ T FHE+GH +H+++G++++ +++G +    DFVE P
Sbjct: 538 RWVEVNMGDGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSG-TRCATDFVELP 596

Query: 541 SQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTV 600
           S ++E +  +   +  +S HY+TG+ +  E++ +               Q+  S  D  +
Sbjct: 597 SILMEHFARDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQEL 656

Query: 601 HT-DKELD-KLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMXXXXXXXXXXMWSEVF 658
           H  D   D  +D+ ++++ L   + ++   D  +     F H+           ++    
Sbjct: 657 HNLDHTTDGSIDVIAIYHRLERRLAVLP--DDQSNWCGKFGHLF-GYGASYYSYLFDRAI 713

Query: 659 AADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRD 692
           A+ ++  +F  +P + + GT++++ +L  GG RD
Sbjct: 714 ASKIWDHLFEQDPFNRTNGTKFKEGLLQWGGSRD 747

>Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar to
           Ashbya gossypii ABL141C
          Length = 523

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 518 VGKSRIGHLNGPSSIPWDFV-EAPSQMLEFWPWNKDQIL--KLSKHYETGEQIPDELVDS 574
           +  SR G  N  S +P+  V   P+  L  W  N   +L  K   HY+     P   + S
Sbjct: 87  IQASRCGSANSNSGLPYLLVGSTPTGKLYVWELNSGNLLSVKAMAHYQ-----PITKIQS 141

Query: 575 LIKTKHVNAGLSNLRQLHFSLFDMTVHTD 603
           ++  K+V    S+ R + +   D+ +H D
Sbjct: 142 IVNGKYVITSGSDARLIIWQTADLVLHDD 170

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 10/68 (14%)

Query: 576 IKTKHVNAGLSNLRQLHFSLFDMTVHTDKEL---DKLDIKSLW--NNLREEVTLISNGDV 630
           +K K +NAG  NL        ++ VH D E    ++++IK L   N+L EE  L++N  V
Sbjct: 676 LKEKRINAGALNLASP-----EVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISV 730

Query: 631 LTKGYDSF 638
             K YDSF
Sbjct: 731 ARKIYDSF 738

>Kpol_2000.89 s2000 complement(195405..197930) [2526 bp, 841 aa]
           {ON} complement(195405..197930) [2526 nt, 842 aa]
          Length = 841

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 49/122 (40%), Gaps = 13/122 (10%)

Query: 430 FAVWDLDKCNPE-FVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFS 488
           F+ +++   N E F     F + P    Y H+   G  +P +++  TR+ P    + +F 
Sbjct: 155 FSAFEMAASNSEPFNYHGNFTVDPHNSNYNHSNVLGQSTPSISQNSTRNDPKNQALFSF- 213

Query: 489 KPSSTRPALLKHGEVVTFFHE--LGHGIHALVGKSRIGHLN--GPSSIPWDFVEAPSQML 544
                   L  H    +F ++  + H      G+   GH N   P+ IP     + +Q  
Sbjct: 214 -------GLEDHTNDRSFANQNHISHSSLYFPGQYNNGHTNNLSPTDIPTPIHSSGNQYT 266

Query: 545 EF 546
           +F
Sbjct: 267 DF 268

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,278,426
Number of extensions: 3661545
Number of successful extensions: 11440
Number of sequences better than 10.0: 63
Number of HSP's gapped: 11571
Number of HSP's successfully gapped: 64
Length of query: 716
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 599
Effective length of database: 40,065,477
Effective search space: 23999220723
Effective search space used: 23999220723
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)