Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10101.8ON82824101e-53
AFR743W1.8ON82823605e-46
SAKL0C00528g1.8ON110823471e-43
KLTH0F00550g1.8ON82823423e-43
ZYRO0F18414g1.8ON87763346e-42
Kwal_33.130161.8ON82823215e-40
NCAS0B090801.8ON93703218e-40
CAGL0B00396g1.8ON88733131e-38
Kpol_2002.111.8ON86773102e-38
TPHA0E039801.8ON86793033e-37
TBLA0A049601.8ON96733001e-36
YCL057C-A (MOS1)1.8ON97962904e-35
KLLA0C00550g1.8ON82822894e-35
TDEL0C069401.8ON86792894e-35
Smik_3.171.8ON97692852e-34
Suva_3.1551.8ON97962852e-34
Skud_3.61.8ON97692843e-34
KNAG0C002501.8ON94702489e-29
NDAI0A001701.8ON96782481e-28
KAFR0D001701.8ON90892471e-28
YJR142W4.378ON34241650.61
SAKL0C10230g3.119ON97151650.65
Smik_10.4364.378ON34241640.85
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1010
         (82 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   162   1e-53
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   143   5e-46
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   138   1e-43
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   136   3e-43
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   133   6e-42
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   128   5e-40
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   128   8e-40
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   125   1e-38
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   124   2e-38
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   121   3e-37
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   120   1e-36
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   116   4e-35
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   115   4e-35
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   115   4e-35
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   114   2e-34
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   114   2e-34
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   114   3e-34
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   100   9e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   100   1e-28
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   100   1e-28
YJR142W Chr10 (697141..698169) [1029 bp, 342 aa] {ON} Putative p...    30   0.61 
SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} simila...    30   0.65 
Smik_10.436 Chr10 (686200..687228) [1029 bp, 342 aa] {ON} YJR142...    29   0.85 

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  162 bits (410), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60
          MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL
Sbjct: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRTMKA 82
          GRGYAEGDAIFRSHAGLRTMKA
Sbjct: 61 GRGYAEGDAIFRSHAGLRTMKA 82

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  143 bits (360), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%)

Query: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60
          M  +LEV+APSRSILNDKWDVVLSNLVVK GLGF  GV ASVLFFKRRAFPVWLG+GFGL
Sbjct: 1  MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRTMKA 82
          GRGYAEGDAIFRSHAGLR ++A
Sbjct: 61 GRGYAEGDAIFRSHAGLRAVRA 82

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  138 bits (347), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%)

Query: 1   MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60
           M E+L+V+ P++SILNDKWDVVLSN+VVK GLGF  G++ASVL FKRRAFPVWLG+GFGL
Sbjct: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88

Query: 61  GRGYAEGDAIFRSHAGLRTMKA 82
           GRGYAEGDAIFRS AGLRT+ A
Sbjct: 89  GRGYAEGDAIFRSSAGLRTVNA 110

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  136 bits (342), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%)

Query: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60
          M E+L+V+  SRS+LNDKWDVVLSNLVVK GLGF  GV+ASVL FKRRAFPVW+G+GFGL
Sbjct: 1  MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRTMKA 82
          GRGYAEGDAIFRS AGLRT+KA
Sbjct: 61 GRGYAEGDAIFRSSAGLRTVKA 82

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  133 bits (334), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 66/76 (86%), Positives = 71/76 (93%)

Query: 7  VAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAE 66
          V AP++SILNDKWDVVLSNL+VK+GLGF VGV+ASVL FKRRAFPVWLGIGFGLGRGYAE
Sbjct: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71

Query: 67 GDAIFRSHAGLRTMKA 82
          GDAIFRS AGLRT KA
Sbjct: 72 GDAIFRSAAGLRTSKA 87

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  128 bits (321), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 62/82 (75%), Positives = 72/82 (87%)

Query: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60
          M ++ ++A  SRS+LNDKWDVVLSNLVVK GLGF  GV+ASVL FKRRA PVW+G+GFGL
Sbjct: 1  MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRTMKA 82
          GRGY+EGDAIFRS AGLRT+KA
Sbjct: 61 GRGYSEGDAIFRSSAGLRTVKA 82

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  128 bits (321), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%)

Query: 12 RSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAIF 71
          RSILNDKWDVVLSN++VK GLGFSVGV+ASV+FFKRR FPVWLGIGFG+GRGYAEGDAIF
Sbjct: 23 RSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAIF 82

Query: 72 RSHAGLRTMK 81
          RS AGLRT K
Sbjct: 83 RSPAGLRTAK 92

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  125 bits (313), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%)

Query: 9  APSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGD 68
           P RSILNDKWDVVLSN++VK GLGF VGV+ SVLFFKRR+FPVWLG+GFG GRGY+EGD
Sbjct: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74

Query: 69 AIFRSHAGLRTMK 81
          AIFRS AGLR++K
Sbjct: 75 AIFRSTAGLRSVK 87

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  124 bits (310), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 59/77 (76%), Positives = 69/77 (89%), Gaps = 1/77 (1%)

Query: 3  EKLEV-AAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLG 61
          ++L++ +AP+RSILNDKWDVVLSN +VK  LGF  GVLASV+ FKRRAFPVWLGIGFG+G
Sbjct: 6  QELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIG 65

Query: 62 RGYAEGDAIFRSHAGLR 78
          RGY+EGDAIFRS AGLR
Sbjct: 66 RGYSEGDAIFRSAAGLR 82

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  121 bits (303), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 1/79 (1%)

Query: 3  EKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGR 62
            LE+ +P +SILNDKWDVVLSN++VK GLGF VGV+ S+L FKRRAFPVWLGIGFG+GR
Sbjct: 8  NNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFGVGR 66

Query: 63 GYAEGDAIFRSHAGLRTMK 81
          GY++GDAIFRS AGLR+ +
Sbjct: 67 GYSDGDAIFRSAAGLRSTR 85

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 54/73 (73%), Positives = 64/73 (87%)

Query: 9  APSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGD 68
            +RSILNDKWD+V+SN++VK   GF  GVLASV+FFKRRAFPVWLG+GFGLGRGY+EGD
Sbjct: 23 TSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGD 82

Query: 69 AIFRSHAGLRTMK 81
          AIFRS AGLR+ +
Sbjct: 83 AIFRSTAGLRSFQ 95

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  116 bits (290), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (70%), Gaps = 15/96 (15%)

Query: 1  MGEKLEVAAPSRS---------------ILNDKWDVVLSNLVVKAGLGFSVGVLASVLFF 45
          M E+ +   P++S               IL+ KWD+VLSN++VK  +GF VGV  SVLFF
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 46 KRRAFPVWLGIGFGLGRGYAEGDAIFRSHAGLRTMK 81
          KRRAFPVWLGIGFG+GRGYAEGDAIFRS AGLR+ K
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  115 bits (289), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 67/82 (81%)

Query: 1  MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60
          M E+++      SIL+ +WDVVLSN+V K  LG  VG++ASVLFFKRRAFPVW+G+GFGL
Sbjct: 1  MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60

Query: 61 GRGYAEGDAIFRSHAGLRTMKA 82
          GRGYAEGDAIFR++AGLR + A
Sbjct: 61 GRGYAEGDAIFRTNAGLRKVNA 82

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  115 bits (289), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (94%)

Query: 4  KLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRG 63
          +L+VAAPSRSILNDKWDVVLSN++VK GLGF VGV+ SVLFFKRRAFPVWLGIGFGLGRG
Sbjct: 8  QLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIGFGLGRG 67

Query: 64 YAEGDAIFRSHAGLRTMKA 82
          YAEGDAIFRS AGLR++KA
Sbjct: 68 YAEGDAIFRSAAGLRSVKA 86

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%)

Query: 13 SILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAIFR 72
          ++L+ KWD+VLSN++VK  +GF VGV  SVLFFKRRAFPVWLGIGFG+GRGYAEGDAIFR
Sbjct: 28 TVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 73 SHAGLRTMK 81
          S AGLR+ K
Sbjct: 88 SSAGLRSSK 96

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (70%), Gaps = 15/96 (15%)

Query: 1  MGEKLEVAAPSRS---------------ILNDKWDVVLSNLVVKAGLGFSVGVLASVLFF 45
          M E+ +  AP++S               +L+ KWD+VLSN++VK  +GF +GV  SVLFF
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 46 KRRAFPVWLGIGFGLGRGYAEGDAIFRSHAGLRTMK 81
          KRRAFP WLGIGFG+GRGYAEGDAIFRS AGLR+ K
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  114 bits (284), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%)

Query: 13 SILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAIFR 72
          +IL+ KWD+V+SN++VK  +GF VGV  SVLFFKRRAFPVWLGIGFG+GRGYAEGDAIFR
Sbjct: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 73 SHAGLRTMK 81
          S AGLR+ K
Sbjct: 88 SSAGLRSSK 96

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  100 bits (248), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 65/70 (92%)

Query: 12 RSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAIF 71
          RS+LNDKWDVVLSN++VK G+GF VGV+ SVL F+RRAFPVWLGIGFG+GRGY+EGDAIF
Sbjct: 24 RSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEGDAIF 83

Query: 72 RSHAGLRTMK 81
          RS +G+RT+K
Sbjct: 84 RSTSGIRTVK 93

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score =  100 bits (248), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 55/78 (70%), Positives = 66/78 (84%)

Query: 4  KLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRG 63
          + ++A   +SILNDKWD+VLSN +VK GLGF VGV+ SV+FFKRR FPVWLGIGFG GRG
Sbjct: 18 QQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVWLGIGFGAGRG 77

Query: 64 YAEGDAIFRSHAGLRTMK 81
          YAEGDAIFRS AG+R++ 
Sbjct: 78 YAEGDAIFRSSAGIRSVN 95

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 99.8 bits (247), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 72/89 (80%), Gaps = 8/89 (8%)

Query: 1  MGEKLEVAAPS--------RSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPV 52
          M E+ +V  P+        RSILNDKWD+VLSN++VK GLGF VGV+ SV+FFKRRAFPV
Sbjct: 1  MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPV 60

Query: 53 WLGIGFGLGRGYAEGDAIFRSHAGLRTMK 81
          WLGIG+G GR Y+EGDAIFRS+AGLR+++
Sbjct: 61 WLGIGYGFGRAYSEGDAIFRSNAGLRSVQ 89

>YJR142W Chr10 (697141..698169) [1029 bp, 342 aa] {ON} Putative
           protein of unknown function; GST fusion protein is a
           Dbf2-Mob1 phosphoylation target in a proteome chip
           analysis; synthetic lethal with PH085 deletion; plays a
           role in restricting Ty1 transposition
          Length = 342

 Score = 29.6 bits (65), Expect = 0.61,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 3   EKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVL 43
           +K++   P RS     W ++L N ++  GLG+  G+  +VL
Sbjct: 170 KKVQFWVPRRSKTKQTWPLMLDN-IIAGGLGYPYGIYETVL 209

>SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} similar
           to uniprot|Q12252 Saccharomyces cerevisiae YOL084W PHM7
           Protein of unknown function expression is regulated by
           phosphate levels green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery and vacuole
          Length = 971

 Score = 29.6 bits (65), Expect = 0.65,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 34  FSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAIFRSHA---GLRTMK 81
           F  G +A+ L+FKRR  P++  +     R YA G+  F   A   GLR +K
Sbjct: 677 FLAGTVAAHLYFKRRFIPLFDAVPLSAIR-YARGEPTFLYPARDQGLREIK 726

>Smik_10.436 Chr10 (686200..687228) [1029 bp, 342 aa] {ON} YJR142W
           (REAL)
          Length = 342

 Score = 29.3 bits (64), Expect = 0.85,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 3   EKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVL 43
           +K++   P RS     W ++L N ++  G+G+  G+  +VL
Sbjct: 170 KKIQFWVPRRSATKQTWPLMLDN-IIAGGVGYPYGIYETVL 209

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.142    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,397,457
Number of extensions: 227639
Number of successful extensions: 644
Number of sequences better than 10.0: 23
Number of HSP's gapped: 644
Number of HSP's successfully gapped: 23
Length of query: 82
Length of database: 53,481,399
Length adjustment: 54
Effective length of query: 28
Effective length of database: 47,289,435
Effective search space: 1324104180
Effective search space used: 1324104180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)